File size: 599 Bytes
3b0fa5f bfc37d0 1438451 e734c05 3b0fa5f 1438451 6497384 1438451 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 |
---
license: cc-by-nc-sa-4.0
tags:
- biology
widget:
- text: >-
EV<mask>LVESGGGLVQPGGSLRLSCAASGFTFSSYNMNWVRQAPGKGLEWVSYISSSSSTIYYADSVKGRFTISRDNAKNSLSLQMNSLRDEDTAVYYCARAYYYGMDVWGQGTTVTVSS
---
# Model Card for nanoBERT
nanoBERT is a nanobody-specific transformer to predict amino acids in a given position in a query sequence.
The model was trained on nanobody sequences from [INDI (Integrated Nanobody Database for Immunoinformatics)](https://pubmed.ncbi.nlm.nih.gov/34747487/)
Example usage: [notebook](nanoBERTExample.ipynb).
For more information please contact: [email protected] |