File size: 57,591 Bytes
3965309 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 |
[
{
"question": "What proteins does the protein P68133 interact with?",
"source": "P68133",
"entities": {
"protein": "P68133"
},
"answer": [
{
"name": "GC",
"answer": "P02774"
},
{
"name": "GSN",
"answer": "P06396"
}
],
"type": "one-hop"
},
{
"question": "Could you please specify which proteins the protein Q9NYB9 interacts with?",
"source": "Q9NYB9",
"entities": {
"protein": "Q9NYB9"
},
"answer": [
{
"name": "ADAM19",
"answer": "Q9H013"
}
],
"type": "one-hop"
},
{
"question": "Can you identify proteins that the protein P12814 show interaction with?",
"source": "P12814",
"entities": {
"protein": "P12814"
},
"answer": [
{
"name": "GRB2",
"answer": "P62993"
},
{
"name": "CAMK2A",
"answer": "Q9UQM7"
}
],
"type": "one-hop"
},
{
"question": "I'm curious, which proteins does the protein P63267 interact with?",
"source": "P63267",
"entities": {
"protein": "P63267"
},
"answer": [
{
"name": "GRB2",
"answer": "P62993"
}
],
"type": "one-hop"
},
{
"question": "Do you know what proteins does the protein P36544 interact with?",
"source": "P36544",
"entities": {
"protein": "P36544"
},
"answer": [
{
"name": "APP",
"answer": "P05067"
}
],
"type": "one-hop"
},
{
"question": "What's the amino acid sequence of A0A0A0MTA2?",
"source": "A0A0A0MTA2",
"entities": {
"protein": "A0A0A0MTA2"
},
"answer": [
{
"answer": "LRGAAGRLGGGLLVL",
"header": "tr|A0A0A0MTA2|A0A0A0MTA2_HUMAN",
"source": "UniProt",
"size": "15"
}
],
"type": "one-hop"
},
{
"question": "Can you provide the amino acid sequence of A0A286YF18?",
"source": "A0A286YF18",
"entities": {
"protein": "A0A286YF18"
},
"answer": [
{
"answer": "MPGLAAEGEAEGWSPSPPLYEEYRPPPLDSIRLPRYVLYLLLAALVVVAVAYAIVGHLIKDLAHDLADWAFGPKPDQEAAPRELRPSLTGEDLEGLDLQLALAWQGEEDAGGGGEGAPSEPPPPPEPRRPSIAFKDPPSRSSFWKLMAT",
"header": "sp|A0A286YF18|SMI44_HUMAN",
"source": "UniProt",
"size": "149"
}
],
"type": "one-hop"
},
{
"question": "Could you tell me the amino acid sequence of A0A2R8Y4M4?",
"source": "A0A2R8Y4M4",
"entities": {
"protein": "A0A2R8Y4M4"
},
"answer": [
{
"answer": "MEGAWALPTWKEEGREQAAGQGEEEECPICTEPYGPRERRLALLNCSHGLCVGCLHRLLGSASSADLGRVRCPLCRQKTPVLEWEICRLQEELLQADGPSRQPRREAPASYHRNPGPWGSLEHRYQLRFLAGPVGGRGCLPFLPCPPCLGARLWTLRERGPCARRLALLSLLALELLGLLLVFTPLLLLGLLFVLLDRSGR",
"header": "tr|A0A2R8Y4M4|A0A2R8Y4M4_HUMAN",
"source": "UniProt",
"size": "201"
}
],
"type": "one-hop"
},
{
"question": "Please identify the amino acid sequence of A6NI61.",
"source": "A6NI61",
"entities": {
"protein": "A6NI61"
},
"answer": [
{
"answer": "MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPGLSVLCFMRHDILEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYSGPIGTAILIIAAKWLQKMKEKKGLYPDKSVYTQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAKLDCSTLCCACV",
"header": "sp|A6NI61|MYMK_HUMAN",
"source": "UniProt",
"size": "221"
}
],
"type": "one-hop"
},
{
"question": "Can you display the amino acid sequence that constitutes O60675?",
"source": "O60675",
"entities": {
"protein": "O60675"
},
"answer": [
{
"answer": "MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFARTVARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS",
"header": "sp|O60675|MAFK_HUMAN",
"source": "UniProt",
"size": "156"
}
],
"type": "one-hop"
},
{
"question": "Which biological processes is the protein O60613 associated with?",
"source": "O60613",
"entities": {
"protein": "O60613"
},
"answer": [
{
"answer": "cellular oxidant detoxification",
"description": "Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide. [GOC:dos, GOC:vw]"
},
{
"answer": "sperm DNA condensation",
"description": "The progressive compaction of the spermatid chromatin so that it reaches a level of condensation that is not compatible with nuclear activities such as transcription or DNA replication. [GOC:bf, PMID:11735001]"
},
{
"answer": "'de novo' post-translational protein folding",
"description": "The process of assisting in the correct noncovalent folding of newly formed polypeptides or folding intermediates of polypeptides that have exited the ribosome and/or have been stabilized and transferred by other chaperone proteins. This process could involve several cycles of ATP hydrolysis. [GOC:rb]"
}
],
"type": "one-hop"
},
{
"question": "What biological processes involve the protein Q96MP8?",
"source": "Q96MP8",
"entities": {
"protein": "Q96MP8"
},
"answer": [
{
"answer": "protein homooligomerization",
"description": "The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer. [GOC:ai]"
},
{
"answer": "intracellular potassium ion homeostasis",
"description": "A homeostatic process involved in the maintenance of a steady state level of potassium ions within a cell. [GOC:mah]"
},
{
"answer": "intracellular glutamate homeostasis",
"description": "A homeostatic process involved in the maintenance of a steady state level of glutamate within a cell. [GOC:tb]"
},
{
"answer": "positive regulation of transporter activity",
"description": "Any process that activates or increases the activity of a transporter. [GOC:mah]"
},
{
"answer": "membrane hyperpolarization",
"description": "The process in which membrane potential increases with respect to its steady-state potential, usually from negative potential to a more negative potential. For example, during the repolarization phase of an action potential the membrane potential often becomes more negative or hyperpolarized before returning to the steady-state resting potential. [GOC:dph]"
}
],
"type": "one-hop"
},
{
"question": "Can you list the biological processes that the protein Q8NGP9 is associated with?",
"source": "Q8NGP9",
"entities": {
"protein": "Q8NGP9"
},
"answer": [
{
"answer": "G protein-coupled receptor signaling pathway",
"description": "The series of molecular signals initiated by a ligand binding to its receptor, in which the activated receptor promotes the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, and ends with regulation of a downstream cellular process. The pathway can start from the plasma membrane, Golgi or nuclear membrane. [GOC:bf, GOC:mah, PMID:16902576, PMID:24568158, Wikipedia:G_protein-coupled_receptor]"
},
{
"answer": "detection of chemical stimulus involved in sensory perception of smell",
"description": "The series of events involved in the perception of smell in which an olfactory chemical stimulus is received and converted into a molecular signal. [GOC:ai]"
}
],
"type": "one-hop"
},
{
"question": "Could you identify which biological processes is the protein O95257 associated with?",
"source": "O95257",
"entities": {
"protein": "O95257"
},
"answer": [
{
"answer": "cell differentiation",
"description": "The cellular developmental process in which a relatively unspecialized cell, e.g. embryonic or regenerative cell, acquires specialized structural and/or functional features that characterize a specific cell. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state. [ISBN:0198506732]"
},
{
"answer": "positive regulation of p38MAPK cascade",
"description": "Any process that activates or increases the frequency, rate or extent of p38MAPK cascade. [GOC:TermGenie]"
},
{
"answer": "positive regulation of apoptotic process",
"description": "Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process. [GOC:jl, GOC:mtg_apoptosis]"
},
{
"answer": "regulation of cell cycle",
"description": "Any process that modulates the rate or extent of progression through the cell cycle. [GOC:ai, GOC:dph, GOC:tb]"
},
{
"answer": "apoptotic process",
"description": "A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died. [GOC:cjm, GOC:dhl, GOC:ecd, GOC:go_curators, GOC:mtg_apoptosis, GOC:tb, ISBN:0198506732, PMID:18846107, PMID:21494263]"
},
{
"answer": "positive regulation of JNK cascade",
"description": "Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the JNK cascade. [GOC:bf]"
},
{
"answer": "positive regulation of cold-induced thermogenesis",
"description": "Any process that activates or increases the frequency, rate or extent of cold-induced thermogenesis. [PMID:27876809]"
}
],
"type": "one-hop"
},
{
"question": "I'm curious, biological processes is the protein P60866 associated with?",
"source": "P60866",
"entities": {
"protein": "P60866"
},
"answer": [
{
"answer": "translation",
"description": "The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome. [GOC:go_curators]"
},
{
"answer": "cytoplasmic translation",
"description": "The chemical reactions and pathways resulting in the formation of a protein in the cytoplasm. This is a ribosome-mediated process in which the information in messenger RNA (mRNA) is used to specify the sequence of amino acids in the protein. [GOC:hjd]"
},
{
"answer": "positive regulation of signal transduction by p53 class mediator",
"description": "Any process that activates or increases the frequency, rate or extent of signal transduction by p53 class mediator. [GOC:TermGenie]"
}
],
"type": "one-hop"
},
{
"question": "In which pathways is the protein O75022 annotated?",
"source": "O75022",
"entities": {
"protein": "O75022"
},
"answer": [
{
"answer": "Neutrophil degranulation",
"description": "Neutrophil degranulation",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-6798695",
"source": "Reactome"
},
{
"answer": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell",
"description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-198933",
"source": "Reactome"
}
],
"type": "one-hop"
},
{
"question": "Can you identify the pathways where the protein Q92667 is annotated?",
"source": "Q92667",
"entities": {
"protein": "Q92667"
},
"answer": [
{
"answer": "Factors involved in megakaryocyte development and platelet production",
"description": "Factors involved in megakaryocyte development and platelet production",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-983231",
"source": "Reactome"
},
{
"answer": "Mitochondrial calcium ion transport",
"description": "Mitochondrial calcium ion transport",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-8949215",
"source": "Reactome"
}
],
"type": "one-hop"
},
{
"question": "In what pathways has the protein P43487 been annotated?",
"source": "P43487",
"entities": {
"protein": "P43487"
},
"answer": [
{
"answer": "Rev-mediated nuclear export of HIV RNA",
"description": "Rev-mediated nuclear export of HIV RNA",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-165054",
"source": "Reactome"
}
],
"type": "one-hop"
},
{
"question": "Could you please specify the pathways in which the protein Q01449 is annotated?",
"source": "Q01449",
"entities": {
"protein": "Q01449"
},
"answer": [
{
"answer": "Smooth Muscle Contraction",
"description": "Smooth Muscle Contraction",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-445355",
"source": "Reactome"
}
],
"type": "one-hop"
},
{
"question": "What pathways include the protein Q9UPV0?",
"source": "Q9UPV0",
"entities": {
"protein": "Q9UPV0"
},
"answer": [
{
"answer": "AURKA Activation by TPX2",
"description": "AURKA Activation by TPX2",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-8854518",
"source": "Reactome"
},
{
"answer": "Recruitment of NuMA to mitotic centrosomes",
"description": "Recruitment of NuMA to mitotic centrosomes",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-380320",
"source": "Reactome"
},
{
"answer": "Loss of proteins required for interphase microtubule organization from the centrosome",
"description": "Loss of proteins required for interphase microtubule organization from the centrosome",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-380284",
"source": "Reactome"
},
{
"answer": "Loss of Nlp from mitotic centrosomes",
"description": "Loss of Nlp from mitotic centrosomes",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-380259",
"source": "Reactome"
},
{
"answer": "Anchoring of the basal body to the plasma membrane",
"description": "Anchoring of the basal body to the plasma membrane",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-5620912",
"source": "Reactome"
},
{
"answer": "Recruitment of mitotic centrosome proteins and complexes",
"description": "Recruitment of mitotic centrosome proteins and complexes",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-380270",
"source": "Reactome"
},
{
"answer": "Regulation of PLK1 Activity at G2/M Transition",
"description": "Regulation of PLK1 Activity at G2/M Transition",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-2565942",
"source": "Reactome"
}
],
"type": "one-hop"
},
{
"question": "What are the structure(s) of protein Q99062-3? Just tell me the PDB ID.",
"source": "Q99062-3",
"entities": {
"protein": "Q99062-3"
},
"answer": [
{
"link": "http://www.rcsb.org/structure/2D9Q",
"answer": "2D9Q",
"source": "Uniprot"
}
],
"type": "one-hop"
},
{
"question": "Please provide the PDB ID(s) of the structure(s) of the protein Q96KS0.",
"source": "Q96KS0",
"entities": {
"protein": "Q96KS0"
},
"answer": [
{
"link": "http://www.rcsb.org/structure/5V1B",
"answer": "5V1B",
"source": "Uniprot"
}
],
"type": "one-hop"
},
{
"question": "What are the PDB ID(s) for the structure(s) of protein Q7L5Y1?",
"source": "Q7L5Y1",
"entities": {
"protein": "Q7L5Y1"
},
"answer": [
{
"link": "http://www.rcsb.org/structure/4A35",
"answer": "4A35",
"source": "Uniprot"
}
],
"type": "one-hop"
},
{
"question": "What is the PDB ID for protein Q9UJY4's structure, or if there are multiple, what are they?",
"source": "Q9UJY4",
"entities": {
"protein": "Q9UJY4"
},
"answer": [
{
"link": "http://www.rcsb.org/structure/1MHQ",
"answer": "1MHQ",
"source": "Uniprot"
}
],
"type": "one-hop"
},
{
"question": "Which diseases is the protein M0QYG6 associated with?",
"source": "M0QYG6",
"entities": {
"protein": "M0QYG6"
},
"answer": [
{
"answer": "neuroendocrine tumor",
"description": "An endocrine gland cancer that has_material_basis_in neuroendocrine cells. [url:http\\://en.wikipedia.org/wiki/Neuroendocrine_cell, url:http\\://en.wikipedia.org/wiki/Neuroendocrine_tumor, url:http\\://www.cancer.gov/dictionary?CdrID=44904]"
},
{
"answer": "alcohol dependence",
"description": "A substance dependence that is characterized by tolerance, withdrawal symptoms, increasing use, persistent desire to decrease consumption, time spent obtaining or recovering from alcohol caused by a physical and psychological dependence on alcohol. [url:https\\://en.wikipedia.org/wiki/Alcohol_dependence]"
},
{
"answer": "substance dependence",
"description": "A substance-related disorder that involves the continued use of alcohol or other drugs despite problems related to use of the substance. [url:http\\://en.wikipedia.org/wiki/Drug_dependence]"
},
{
"answer": "primary ovarian insufficiency",
"description": "An ovarian disease where ovaries do not produce estrogen despite high levels of circulating gonadotropins in women under 40. [url:http\\://en.wikipedia.org/wiki/Premature_ovarian_failure, url:https\\://pubmed.ncbi.nlm.nih.gov/27861765/, url:https\\://www.ncbi.nlm.nih.gov/pmc/articles/PMC7477642/]"
}
],
"type": "one-hop"
},
{
"question": "Could you please specify which diseases the protein E9PI22 is associated with?",
"source": "E9PI22",
"entities": {
"protein": "E9PI22"
},
"answer": [
{
"answer": "male infertility",
"description": "male infertility"
}
],
"type": "one-hop"
},
{
"question": "What are the diseases that the protein M0R2J8 is associated with?",
"source": "M0R2J8",
"entities": {
"protein": "M0R2J8"
},
"answer": [
{
"answer": "esophagus squamous cell carcinoma",
"description": "An esophageal carcinoma that derives_from epithelial squamous cells located_in the esophagus. [url:http\\://www.cancer.gov/cancertopics/types/esophageal]"
}
],
"type": "one-hop"
},
{
"question": "Can you identify diseases that the protein Q9NTW7 is associated with?",
"source": "Q9NTW7",
"entities": {
"protein": "Q9NTW7"
},
"answer": [
{
"answer": "leukemia",
"description": "A cancer that affects the blood or bone marrow characterized by an abnormal proliferation of blood cells. [url:http\\://en.wikipedia.org/wiki/Leukemia, url:http\\://www.cancer.gov/dictionary?CdrID=45343]"
},
{
"answer": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland. [url:http\\://en.wikipedia.org/wiki/Breast_cancer, url:http\\://en.wikipedia.org/wiki/Mammary, url:http\\://www.cancer.gov/cancertopics/types/breast, url:http\\://www.nlm.nih.gov/medlineplus/breastcancer.html, url:https\\://www.genome.gov/Genetic-Disorders/Breast-Cancer]"
},
{
"answer": "childhood leukemia",
"description": "A leukemia that occurs in children. [url:http\\://www.nlm.nih.gov/medlineplus/leukemiachildhood.html]"
}
],
"type": "one-hop"
},
{
"question": "What molecular functions is the protein Q9H8M9 associated with?",
"source": "Q9H8M9",
"entities": {
"protein": "Q9H8M9"
},
"answer": [
{
"answer": "protein binding",
"description": "Binding to a protein. [GOC:go_curators]"
}
],
"type": "one-hop"
},
{
"question": "Can you specify the molecular functions that the protein P12525 is associated with?",
"source": "P12525",
"entities": {
"protein": "P12525"
},
"answer": [
{
"answer": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
"description": "Binding to a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site) located in cis relative to the transcription start site (i.e., on the same strand of DNA) of a gene transcribed by RNA polymerase II. [GOC:txnOH-2018]"
},
{
"answer": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"description": "A DNA-binding transcription factor activity that modulates the transcription of specific gene sets transcribed by RNA polymerase II. [GOC:txnOH-2018]"
},
{
"answer": "DNA-binding transcription factor activity",
"description": "A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. [GOC:txnOH-2018]"
},
{
"answer": "protein dimerization activity",
"description": "The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits. [ISBN:0198506732]"
}
],
"type": "one-hop"
},
{
"question": "Which specific molecular functions is the protein Q9NUD5 associated with?",
"source": "Q9NUD5",
"entities": {
"protein": "Q9NUD5"
},
"answer": [
{
"answer": "zinc ion binding",
"description": "Binding to a zinc ion (Zn). [GOC:ai]"
},
{
"answer": "double-stranded DNA binding",
"description": "Binding to double-stranded DNA. [GOC:elh, GOC:vw]"
},
{
"answer": "RNA binding",
"description": "Binding to an RNA molecule or a portion thereof. [GOC:jl, GOC:mah]"
},
{
"answer": "protein binding",
"description": "Binding to a protein. [GOC:go_curators]"
}
],
"type": "one-hop"
},
{
"question": "Could you tell me what molecular functions is the protein Q96NX5 associated with?",
"source": "Q96NX5",
"entities": {
"protein": "Q96NX5"
},
"answer": [
{
"answer": "calmodulin-dependent protein kinase activity",
"description": "Calmodulin-dependent catalysis of the reactions: ATP + a protein serine = ADP + protein serine phosphate; and ATP + a protein threonine = ADP + protein threonine phosphate. [GOC:mah, PMID:11264466]"
},
{
"answer": "ATP binding",
"description": "Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator. [ISBN:0198506732]"
},
{
"answer": "calmodulin binding",
"description": "Binding to calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states. [GOC:krc]"
},
{
"answer": "protein serine kinase activity",
"description": "Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate. [RHEA:17989]"
},
{
"answer": "protein binding",
"description": "Binding to a protein. [GOC:go_curators]"
}
],
"type": "one-hop"
},
{
"question": "What proteins does the protein O94842 act on?",
"source": "O94842",
"entities": {
"protein": "O94842"
},
"answer": [
{
"answer": "Q96SB3",
"name": "PPP1R9B"
},
{
"answer": "P15692",
"name": "VEGFA"
},
{
"answer": "Q5MIZ7",
"name": "PPP4R3B"
},
{
"answer": "P41236",
"name": "PPP1R2"
}
],
"type": "one-hop"
},
{
"question": "On which proteins does the protein Q9UN86 act?",
"source": "Q9UN86",
"entities": {
"protein": "Q9UN86"
},
"answer": [
{
"answer": "O75153",
"name": "CLUH"
},
{
"answer": "O15173",
"name": "PGRMC2"
},
{
"answer": "Q14694",
"name": "USP10"
},
{
"answer": "Q9BYK8",
"name": "HELZ2"
},
{
"answer": "Q01085",
"name": "TIAL1"
}
],
"type": "one-hop"
},
{
"question": "Could you identify the proteins that the protein Q96RJ6 acts on?",
"source": "Q96RJ6",
"entities": {
"protein": "Q96RJ6"
},
"answer": [
{
"answer": "P15884",
"name": "TCF4"
},
{
"answer": "Q86U70",
"name": "LDB1"
},
{
"answer": "O43679",
"name": "LDB2"
},
{
"answer": "Q99081",
"name": "TCF12"
}
],
"type": "one-hop"
},
{
"question": "Could you specify the proteins that are acted on by the protein Q6ZNF0?",
"source": "Q6ZNF0",
"entities": {
"protein": "Q6ZNF0"
},
"answer": [
{
"answer": "P05187",
"name": "ALPP"
},
{
"answer": "P05186",
"name": "ALPL"
},
{
"answer": "P10619",
"name": "CTSA"
},
{
"answer": "Q9H3G5",
"name": "CPVL"
},
{
"answer": "Q9UNW1",
"name": "MINPP1"
},
{
"answer": "Q08623",
"name": "PUDP"
}
],
"type": "one-hop"
},
{
"question": "What is the molecular function of the protein translated from the gene COL21A1?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Molecular_function",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "COL21A1",
"name": "collagen type XXI alpha 1 chain"
},
"MidAttributes": {
"id": "Q96P44",
"name": "COL21A1"
},
"answer": [
{
"answer": "extracellular matrix structural constituent conferring tensile strength",
"description": "A constituent of the extracellular matrix that enables the matrix to resist longitudinal stress. [GOC:mah, ISBN:0815316194]"
}
],
"type": "multi-hop"
},
{
"question": "What is the molecular function of the protein translated from the gene WFDC5?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Molecular_function",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "WFDC5",
"name": "WAP four-disulfide core domain 5"
},
"MidAttributes": {
"id": "Q8TCV5",
"name": "WFDC5"
},
"answer": [
{
"answer": "serine-type endopeptidase inhibitor activity",
"description": "Binds to and stops, prevents or reduces the activity of a serine-type endopeptidase. [GOC:ai]"
},
{
"answer": "protein binding",
"description": "Binding to a protein. [GOC:go_curators]"
}
],
"type": "multi-hop"
},
{
"question": "What is the molecular function of the protein translated from the gene TMEM127?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Molecular_function",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "TMEM127",
"name": "transmembrane protein 127"
},
"MidAttributes": {
"id": "O75204",
"name": "TMEM127"
},
"answer": [
{
"answer": "small GTPase binding",
"description": "Binding to a small monomeric GTPase. [GOC:mah, PMID:27218782]"
},
{
"answer": "molecular_function",
"description": "A molecular process that can be carried out by the action of a single macromolecular machine, usually via direct physical interactions with other molecular entities. Function in this sense denotes an action, or activity, that a gene product (or a complex) performs. [GOC:pdt]"
}
],
"type": "multi-hop"
},
{
"question": "What is the molecular function of the protein translated from the gene PLA2G3?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Molecular_function",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "PLA2G3",
"name": "phospholipase A2 group III"
},
"MidAttributes": {
"id": "Q9NZ20",
"name": "PLA2G3"
},
"answer": [
{
"answer": "metal ion binding",
"description": "Binding to a metal ion. [GOC:ai]"
},
{
"answer": "calcium-dependent phospholipase A2 activity",
"description": "Catalysis of the reaction: phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate. This reaction requires Ca2+. [EC:3.1.1.4]"
}
],
"type": "multi-hop"
},
{
"question": "What is the modified protein translated from the gene THRB and its modification site?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Modified_protein",
"EdgeTypes": [
"TRANSLATED_INTO",
"HAS_MODIFIED_SITE"
],
"InitialAttributes": {
"id": "THRB",
"name": "thyroid hormone receptor beta"
},
"MidAttributes": {
"id": "P10828",
"name": "THRB"
},
"answer": [
{
"answer": null,
"description": null
}
],
"type": "multi-hop"
},
{
"question": "What is the modified protein translated from the gene RND3 and its modification site?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Modified_protein",
"EdgeTypes": [
"TRANSLATED_INTO",
"HAS_MODIFIED_SITE"
],
"InitialAttributes": {
"id": "RND3",
"name": "Rho family GTPase 3"
},
"MidAttributes": {
"id": "P61587",
"name": "RND3"
},
"answer": [
{
"answer": null,
"description": null
}
],
"type": "multi-hop"
},
{
"question": "What is the modified protein translated from the gene SCN8A and its modification site?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Modified_protein",
"EdgeTypes": [
"TRANSLATED_INTO",
"HAS_MODIFIED_SITE"
],
"InitialAttributes": {
"id": "SCN8A",
"name": "sodium voltage-gated channel alpha subunit 8"
},
"MidAttributes": {
"id": "Q9UQD0",
"name": "SCN8A"
},
"answer": [
{
"answer": null,
"description": null
}
],
"type": "multi-hop"
},
{
"question": "What is the modified protein translated from the gene EPB41 and its modification site?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Modified_protein",
"EdgeTypes": [
"TRANSLATED_INTO",
"HAS_MODIFIED_SITE"
],
"InitialAttributes": {
"id": "EPB41",
"name": "erythrocyte membrane protein band 4.1"
},
"MidAttributes": {
"id": "P11171",
"name": "EPB41"
},
"answer": [
{
"answer": null,
"description": null
}
],
"type": "multi-hop"
},
{
"question": "What biological processes are associated with the protein encoded by the gene SPAAR?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Biological_process",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "SPAAR",
"name": "small regulatory polypeptide of amino acid response"
},
"MidAttributes": {
"id": "A0A1B0GVQ0",
"name": "SPAAR"
},
"answer": [
{
"answer": "negative regulation of TORC1 signaling",
"description": "Any process that stops, prevents or reduces the frequency, rate or extent of TORC1 signaling. [GO_REF:0000058, GOC:TermGenie, PMID:25366275]"
},
{
"answer": "regulation of skeletal muscle tissue regeneration",
"description": "Any process that modulates the frequency, rate or extent of skeletal muscle. [GOC:jl]"
},
{
"answer": "cellular response to amino acid stimulus",
"description": "Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups. [GOC:mah]"
}
],
"type": "multi-hop"
},
{
"question": "What biological processes are associated with the protein encoded by the gene WFDC5?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Biological_process",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "WFDC5",
"name": "WAP four-disulfide core domain 5"
},
"MidAttributes": {
"id": "Q8TCV5",
"name": "WFDC5"
},
"answer": [
{
"answer": "antibacterial humoral response",
"description": "An immune response against bacteria mediated through a body fluid. Examples of this process are the antibacterial humoral responses in Mus musculus and Drosophila melanogaster. [GOC:go_curators, GOC:mtg_sensu]"
},
{
"answer": "innate immune response",
"description": "Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens. [GO_REF:0000022, GOC:add, GOC:ebc, GOC:mtg_sensu]"
}
],
"type": "multi-hop"
},
{
"question": "What biological processes are associated with the protein encoded by the gene TMEM127?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Biological_process",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "TMEM127",
"name": "transmembrane protein 127"
},
"MidAttributes": {
"id": "O75204",
"name": "TMEM127"
},
"answer": [
{
"answer": "negative regulation of TOR signaling",
"description": "Any process that stops, prevents, or reduces the frequency, rate or extent of TOR signaling. [GOC:mah]"
},
{
"answer": "endosome organization",
"description": "A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of endosomes. [GOC:dph, GOC:jl, GOC:mah]"
},
{
"answer": "regulation of TOR signaling",
"description": "Any process that modulates the frequency, rate or extent of TOR signaling. [GOC:mah]"
},
{
"answer": "negative regulation of cell population proliferation",
"description": "Any process that stops, prevents or reduces the rate or extent of cell proliferation. [GOC:go_curators]"
}
],
"type": "multi-hop"
},
{
"question": "What biological processes are associated with the protein encoded by the gene EOLA1?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Biological_process",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "EOLA1",
"name": "endothelium and lymphocyte associated ASCH domain 1"
},
"MidAttributes": {
"id": "Q8TE69",
"name": "EOLA1"
},
"answer": [
{
"answer": "regulation of gene expression",
"description": "Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product (protein or RNA). [GOC:txnOH-2018]"
},
{
"answer": "regulation of interleukin-6 production",
"description": "Any process that modulates the frequency, rate, or extent of interleukin-6 production. [GOC:mah]"
}
],
"type": "multi-hop"
},
{
"question": "What diseases are associated with the protein encoded by the gene KCNS1?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Disease",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "KCNS1",
"name": "potassium voltage-gated channel modifier subfamily S member 1"
},
"MidAttributes": {
"id": "Q96KK3",
"name": "KCNS1"
},
"answer": [
{
"answer": "generalized anxiety disorder",
"description": "An anxiety disorder that is characterized by long-lasting anxiety that is not focused on any one object or situation. [url:http\\://en.wikipedia.org/wiki/Anxiety_disorder]"
},
{
"answer": "anxiety disorder",
"description": "A cognitive disorder that involves an excessive, irrational dread of everyday situations. [url:http\\://www.nimh.nih.gov/health/topics/anxiety-disorders/index.shtml]"
},
{
"answer": "phobic disorder",
"description": "An anxiety disorder where fear and anxiety are triggered by a specific stimulus or situation. [url:http\\://en.wikipedia.org/wiki/Anxiety_disorder]"
},
{
"answer": "sensory peripheral neuropathy",
"description": "A neuropathy that involves damage to nerves of the peripheral nervous system. [url:https\\://www.mayoclinic.org/diseases-conditions/peripheral-neuropathy/symptoms-causes/syc-20352061]"
}
],
"type": "multi-hop"
},
{
"question": "What diseases are associated with the protein encoded by the gene DHFR2?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Disease",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "DHFR2",
"name": "dihydrofolate reductase 2"
},
"MidAttributes": {
"id": "Q86XF0",
"name": "DHFR2"
},
"answer": [
{
"answer": "Down syndrome",
"description": "A chromosomal disease that is characterized by flat-looking facial features and weak muscle tone (hypotonia) in infancy and is caused by trisomy of all or a critical portion of chromosome 21 and is associated with intellectual disability. [url:http\\://en.wikipedia.org/wiki/Down_syndrome, url:http\\://ghr.nlm.nih.gov/condition/down-syndrome, url:http\\://www.nichd.nih.gov/health/topics/down/Pages/default.aspx, url:http\\://www.omim.org/entry/190685?search=down%20syndrome&highlight=down%20syndromic%20syndrome, url:https\\://research.nhgri.nih.gov/atlas/condition/trisomy-21]"
}
],
"type": "multi-hop"
},
{
"question": "What diseases are associated with the protein encoded by the gene ATP6V1G3?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Disease",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "ATP6V1G3",
"name": "ATPase H+ transporting V1 subunit G3"
},
"MidAttributes": {
"id": "Q96LB4",
"name": "ATP6V1G3"
},
"answer": [
{
"answer": "nonpapillary renal cell carcinoma",
"description": "A hereditary renal cell carcinoma that has_material_basis_in a loss of 3p13-pter sequences. [url:https\\://www.ncbi.nlm.nih.gov/pubmed/2921777, url:https\\://www.ncbi.nlm.nih.gov/pubmed/8415591]"
},
{
"answer": "renal cell carcinoma",
"description": "A renal carcinoma that has_material_basis_in the lining of the proximal convoluted renal tubule of the kidney. [url:http\\://en.wikipedia.org/wiki/Renal_cell_carcinoma, url:http\\://www.cancer.gov/dictionary?CdrID=661352]"
},
{
"answer": "clear cell renal cell carcinoma",
"description": "A renal cell carcinoma that has_material_basis_in cells that appear very pale or clear when examined under microscope. [url:http\\://www.cancer.gov/dictionary?CdrID=45063, url:https\\://cancergenome.nih.gov/cancersselected/kidneyclearcell]"
}
],
"type": "multi-hop"
},
{
"question": "What diseases are associated with the protein encoded by the gene GAGE2C?",
"InitialType": "Gene",
"MidType": "Protein",
"FinalType": "Disease",
"EdgeTypes": [
"TRANSLATED_INTO",
"ASSOCIATED_WITH"
],
"InitialAttributes": {
"id": "GAGE2C",
"name": "G antigen 2C"
},
"MidAttributes": {
"id": "Q13066",
"name": "GAGE2B"
},
"answer": [
{
"answer": "lung carcinoma",
"description": "A lung cancer that has_material_basis_in abnormally proliferating cells derives_from epithelial cells and is located_in the lungs and has_symptom cough and has_symptom chest discomfort or pain and has_symptom weight loss and has_symptom hemoptysis. [url:https\\://merck.com/mmpe/sec05/ch062/ch062b.html]"
},
{
"answer": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder. [url:http\\://en.wikipedia.org/wiki/Bladder_cancer]"
},
{
"answer": "melanoma",
"description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives_from melanocytes which are found in skin, the bowel and the eye. [url:http\\://en.wikipedia.org/wiki/Melanoma, url:https\\://www.ncbi.nlm.nih.gov/pubmed/22123420]"
}
],
"type": "multi-hop"
},
{
"question": "Which biological process are the proteins Q9UKD2 and P62750 both associated with?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Biological_process",
"EdgeType": "ASSOCIATED_WITH",
"Entity1Attributes": {
"id": "Q9UKD2"
},
"Entity2Attributes": {
"id": "P62750"
},
"answer": [
{
"answer": "ribosomal large subunit assembly",
"description": "The aggregation, arrangement and bonding together of constituent RNAs and proteins to form the large ribosomal subunit. [GOC:jl, PMID:30467428]",
"id": "GO:0000027"
}
],
"type": "conjunction"
},
{
"question": "Which biological process are the proteins Q9H7B2 and Q14137 both associated with?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Biological_process",
"EdgeType": "ASSOCIATED_WITH",
"Entity1Attributes": {
"id": "Q9H7B2"
},
"Entity2Attributes": {
"id": "Q14137"
},
"answer": [
{
"answer": "maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
"description": "Any process involved in the maturation of a precursor Large SubUnit (LSU) ribosomal RNA (rRNA) molecule into a mature LSU-rRNA molecule from the pre-rRNA molecule originally produced as a tricistronic rRNA transcript that contains the Small Subunit (SSU) rRNA, 5.8S rRNA, and Large Subunit (LSU) in that order from 5' to 3' along the primary transcript. [GOC:curators]",
"id": "GO:0000463"
},
{
"answer": "ribosomal large subunit assembly",
"description": "The aggregation, arrangement and bonding together of constituent RNAs and proteins to form the large ribosomal subunit. [GOC:jl, PMID:30467428]",
"id": "GO:0000027"
},
{
"answer": "regulation of signal transduction by p53 class mediator",
"description": "Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator. [GOC:TermGenie]",
"id": "GO:1901796"
}
],
"type": "conjunction"
},
{
"question": "Which pathway are the proteins P02778 and P25106 both annotated in?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Pathway",
"EdgeType": "ANNOTATED_IN_PATHWAY",
"Entity1Attributes": {
"id": "P02778"
},
"Entity2Attributes": {
"id": "P25106"
},
"answer": [
{
"id": "R-HSA-380108",
"description": "Chemokine receptors bind chemokines",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-380108",
"source": "Reactome",
"answer": "Chemokine receptors bind chemokines"
}
],
"type": "conjunction"
},
{
"question": "Which pathway are the proteins P02649 and P50120 both annotated in?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Pathway",
"EdgeType": "ANNOTATED_IN_PATHWAY",
"Entity1Attributes": {
"id": "P02649"
},
"Entity2Attributes": {
"id": "P50120"
},
"answer": [
{
"id": "R-HSA-975634",
"description": "Retinoid metabolism and transport",
"linkout": "https://reactome.org/PathwayBrowser/#/R-HSA-975634",
"source": "Reactome",
"answer": "Retinoid metabolism and transport"
}
],
"type": "conjunction"
},
{
"question": "What molecular function are the proteins P01732 and P32927 both associated with?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Molecular_function",
"EdgeType": "ASSOCIATED_WITH",
"Entity1Attributes": {
"id": "P01732"
},
"Entity2Attributes": {
"id": "P32927"
},
"answer": [
{
"description": "Combining with an extracellular or intracellular messenger, and in cooperation with a nearby primary receptor, initiating a change in cell activity. [GOC:go_curators]",
"answer": "coreceptor activity"
}
],
"type": "conjunction"
},
{
"question": "What molecular function are the proteins P10415 and Q9UMX3 both associated with?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Molecular_function",
"EdgeType": "ASSOCIATED_WITH",
"Entity1Attributes": {
"id": "P10415"
},
"Entity2Attributes": {
"id": "Q9UMX3"
},
"answer": [
{
"description": "Binding to a Bcl-2 homology (BH) protein domain. Bcl-2-related proteins share homology in one to four conserved regions designated the Bcl-2 homology (BH) domains BH1, BH2, BH3 and BH4. These domains contribute at multiple levels to the function of these proteins in cell death and survival. Anti-apoptotic members of the Bcl-2 family have four BH domains (BH1-BH4). Pro-apoptotic members have fewer BH domains. [PMID:11048732, PMID:12133724, PMID:9020082, PMID:9704409]",
"answer": "BH domain binding"
}
],
"type": "conjunction"
},
{
"question": "Which disease are the proteins O15303 and P13667 both associated with?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Disease",
"EdgeType": "ASSOCIATED_WITH",
"Entity1Attributes": {
"id": "O15303"
},
"Entity2Attributes": {
"id": "P13667"
},
"answer": [
{
"answer": "cancer",
"description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis. [url:http\\://en.wikipedia.org/wiki/cancer, url:http\\://www2.merriam-webster.com/cgi-bin/mwmednlm?book=Medical&va=cancer]",
"id": "DOID:162"
}
],
"type": "conjunction"
},
{
"question": "Which disease are the proteins Q9P2E3 and P50150 both associated with?",
"EntityType1": "Protein",
"EntityType2": "Protein",
"MidType": "Disease",
"EdgeType": "ASSOCIATED_WITH",
"Entity1Attributes": {
"id": "Q9P2E3"
},
"Entity2Attributes": {
"id": "P50150"
},
"answer": [
{
"answer": "cancer",
"description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis. [url:http\\://en.wikipedia.org/wiki/cancer, url:http\\://www2.merriam-webster.com/cgi-bin/mwmednlm?book=Medical&va=cancer]",
"id": "DOID:162"
}
],
"type": "conjunction"
}
] |