Spaces:
Running
Running
import copy | |
import tempfile | |
from pathlib import Path | |
import pytest | |
import chroma | |
from chroma.data.protein import Protein | |
BASE_PATH = str(Path(chroma.__file__).parent.parent) | |
PROTEIN_SINGLE_CHAIN = BASE_PATH + "/tests/resources/4kw4.cif" | |
PROTEIN_COMPLEX = BASE_PATH + "/tests/resources/3hn3.cif" | |
CIF_TRAJECTORY = BASE_PATH + "/tests/resources/chroma_trajectory.cif" | |
SEQUENCE = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL" | |
PDB_ID = "1B9C" | |
TESTS = [PROTEIN_SINGLE_CHAIN, PROTEIN_COMPLEX, SEQUENCE, PDB_ID] | |
def test_Protein(protein_path): | |
# Loading Smoke Tests | |
if protein_path.endswith(".pdb"): | |
protein = Protein.from_PDB(protein_path) | |
elif protein_path.endswith(".cif"): | |
protein = Protein.from_CIF(protein_path) | |
elif len(protein_path) == 4: | |
protein = Protein.from_PDBID(protein_path) | |
else: # Protein Sequence Input | |
protein = Protein.from_sequence(protein_path) | |
# Selection Smoke Test | |
# Select all structured residues | |
D = protein.get_mask("all").bool() | |
# Method Smoke Tests | |
protein.canonicalize() | |
protein.sequence() | |
len(protein) | |
protein.display() | |
# Cycles save / load /validate | |
X, C, S = protein.to_XCS() | |
# XCS | |
xcs_cycle_protein = Protein.from_XCS(X, C, S) | |
Xt, Ct, St = xcs_cycle_protein.to_XCS() | |
assert (Xt == X).all() and (Ct == C).all() and (St == S).all() | |
# CIF | |
with tempfile.NamedTemporaryFile(suffix=".cif", delete=True) as temp_file: | |
protein.to_CIF(temp_file.name) | |
Xt, Ct, St = protein.from_CIF(temp_file.name).to_XCS() | |
assert (Xt == X).all() and (Ct == C).all() and (St == S).all() | |
# PDB | |
with tempfile.NamedTemporaryFile(suffix=".pdb", delete=True) as temp_file: | |
protein.to_PDB(temp_file.name) | |
structured_residues = protein.sys.num_structured_residues() | |
round_trip_protein = protein.from_PDB(temp_file.name) | |
assert len(round_trip_protein) == structured_residues | |
# smoke test copy behavior | |
copy.copy(protein) | |
copy.deepcopy(protein) | |
def compare_proteins(A, B): | |
A, B = A.sys, B.sys | |
if ( | |
A.num_chains() != B.num_chains() | |
or A.num_residues() != B.num_residues() | |
or A.num_atoms() != B.num_atoms() | |
or A.num_atom_locations() != B.num_atom_locations() | |
or A.num_structured_residues() != B.num_structured_residues() | |
): | |
return False | |
for cA, cB in zip(A.chains(), B.chains()): | |
if ( | |
cA.num_residues() != cB.num_residues() | |
or cA.cid != cB.cid | |
or cA.segid != cB.segid | |
or cA.authid != cB.authid | |
): | |
print(f"chains {cA} and {cB} differ") | |
return False | |
for rA, rB in zip(cA.residues(), cB.residues()): | |
if ( | |
rA.num_atoms() != rB.num_atoms() | |
or rA.name != rA.name | |
or rA.num != rB.num | |
or rA.authid != rB.authid | |
or rA.icode != rB.icode | |
): | |
print(f"residues {rA} and {rB} differ") | |
return False | |
for aA, aB in zip(rA.atoms(), rB.atoms()): | |
if ( | |
aA.num_locations() != aB.num_locations() | |
or aA.name != aB.name | |
or aA.het != aB.het | |
): | |
print(f"atoms {aA} and {aB} differ") | |
return False | |
for lA, lB in zip(aA.locations(), aB.locations()): | |
if ( | |
(abs(lA.coors - lB.coors) > 0.01).any() | |
or lA.occ != lB.occ | |
or lA.B != lB.B | |
or lA.alt != lB.alt | |
): | |
print(f"atoms {lA} and {lB} differ") | |
return False | |
return True | |
def test_xcs_trajectory(): | |
# Load Trajectory | |
protein = Protein(CIF_TRAJECTORY) | |
# Save out Trajectory | |
X_list, C, S = protein.to_XCS_trajectory() | |
# Load back in via XCS | |
protein_xcs_load = Protein(X_list, C, S) | |
assert compare_proteins(protein, protein_xcs_load) | |
# Print Trajectory | |
print(protein) | |
# Display Trajectory | |
protein.display() | |
def test_trajectory_round_trip(): | |
# Load Trajectory | |
protein = Protein(CIF_TRAJECTORY) | |
# Save out Trajectory | |
X_list, C, S = protein.to_XCS_trajectory() | |
# Load back in via XCS | |
protein_xcs_load = Protein.from_XCS_trajectory(X_list, C, S) | |
assert compare_proteins(protein, protein_xcs_load) | |
# Turn back into XCS | |
X_list_1, C_1, S_1 = protein_xcs_load.to_XCS_trajectory() | |
assert len(X_list) == len(X_list_1) | |
assert [(x1 == x2).all() for x1, x2 in zip(X_list, X_list_1)] | |
assert (C == C_1).all() | |
assert (S == S_1).all() | |
def test_edge_cases(pdb_id): | |
Protein(pdb_id, canonicalize=True) | |