from __future__ import annotations import time import json import gradio as gr from gradio_molecule3d import Molecule3D import torch from pinder.core import get_pinder_location get_pinder_location() from pytorch_lightning import LightningModule import torch import lightning.pytorch as pl import torch.nn.functional as F import torch.nn as nn import torchmetrics import torch.nn as nn import torch.nn.functional as F from torch_geometric.nn import MessagePassing from torch_geometric.nn import global_mean_pool from torch.nn import Sequential, Linear, BatchNorm1d, ReLU from torch_scatter import scatter from torch.nn import Module import pinder.core as pinder pinder.__version__ from torch_geometric.loader import DataLoader from pinder.core.loader.dataset import get_geo_loader from pinder.core import download_dataset from pinder.core import get_index from pinder.core import get_metadata from pathlib import Path import pandas as pd from pinder.core import PinderSystem import torch from pinder.core.loader.dataset import PPIDataset from pinder.core.loader.geodata import NodeRepresentation import pickle from pinder.core import get_index, PinderSystem from torch_geometric.data import HeteroData import os from enum import Enum import numpy as np import torch import lightning.pytorch as pl from numpy.typing import NDArray from torch_geometric.data import HeteroData from pinder.core.index.system import PinderSystem from pinder.core.loader.structure import Structure from pinder.core.utils import constants as pc from pinder.core.utils.log import setup_logger from pinder.core.index.system import _align_monomers_with_mask from pinder.core.loader.structure import Structure import torch import torch.nn as nn import torch.nn.functional as F from torch_geometric.nn import MessagePassing from torch_geometric.nn import global_mean_pool from torch.nn import Sequential, Linear, BatchNorm1d, ReLU from torch_scatter import scatter from torch.nn import Module import time from torch_geometric.nn import global_max_pool import copy import inspect import warnings from typing import Optional, Tuple, Union import torch from torch import Tensor from torch_geometric.data import Data, Dataset, HeteroData from torch_geometric.data.feature_store import FeatureStore from torch_geometric.data.graph_store import GraphStore from torch_geometric.loader import ( LinkLoader, LinkNeighborLoader, NeighborLoader, NodeLoader, ) from torch_geometric.loader.dataloader import DataLoader from torch_geometric.loader.utils import get_edge_label_index, get_input_nodes from torch_geometric.sampler import BaseSampler, NeighborSampler from torch_geometric.typing import InputEdges, InputNodes try: from lightning.pytorch import LightningDataModule as PLLightningDataModule no_pytorch_lightning = False except (ImportError, ModuleNotFoundError): PLLightningDataModule = object no_pytorch_lightning = True from lightning.pytorch.callbacks import ModelCheckpoint from lightning.pytorch.loggers.tensorboard import TensorBoardLogger from lightning.pytorch.callbacks.early_stopping import EarlyStopping from torch_geometric.data.lightning.datamodule import LightningDataset from pytorch_lightning.loggers.wandb import WandbLogger def get_system(system_id: str) -> PinderSystem: return PinderSystem(system_id) from Bio import PDB from Bio.PDB.PDBIO import PDBIO def extract_coordinates_from_pdb(filename): r""" Extracts atom coordinates from a PDB file and returns them as a list of tuples. Each tuple contains (x, y, z) coordinates of an atom. """ parser = PDB.PDBParser(QUIET=True) structure = parser.get_structure("structure", filename) coordinates = [] # Loop through each model, chain, residue, and atom to collect coordinates for model in structure: for chain in model: for residue in chain: # Retrieve atoms and their coordinates for atom in residue: xyz = atom.coord # Coordinates are in a numpy array # Append the coordinates (x, y, z) as a tuple coordinates.append((xyz[0], xyz[1], xyz[2])) return coordinates log = setup_logger(__name__) try: from torch_cluster import knn_graph torch_cluster_installed = True except ImportError as e: log.warning( "torch-cluster is not installed!" "Please install the appropriate library for your pytorch installation." "See https://github.com/rusty1s/pytorch_cluster/issues/185 for background." ) torch_cluster_installed = False def structure2tensor( atom_coordinates: NDArray[np.double] | None = None, atom_types: NDArray[np.str_] | None = None, element_types: NDArray[np.str_] | None = None, residue_coordinates: NDArray[np.double] | None = None, residue_ids: NDArray[np.int_] | None = None, residue_types: NDArray[np.str_] | None = None, chain_ids: NDArray[np.str_] | None = None, dtype: torch.dtype = torch.float32, ) -> dict[str, torch.Tensor]: property_dict = {} if atom_types is not None: unknown_name_idx = max(pc.ALL_ATOM_POSNS.values()) + 1 types_array_at = np.zeros((len(atom_types), 1)) for i, name in enumerate(atom_types): types_array_at[i] = pc.ALL_ATOM_POSNS.get(name, unknown_name_idx) property_dict["atom_types"] = torch.tensor(types_array_at).type(dtype) if element_types is not None: types_array_ele = np.zeros((len(element_types), 1)) for i, name in enumerate(element_types): types_array_ele[i] = pc.ELE2NUM.get(name, pc.ELE2NUM["other"]) property_dict["element_types"] = torch.tensor(types_array_ele).type(dtype) if residue_types is not None: unknown_name_idx = max(pc.AA_TO_INDEX.values()) + 1 types_array_res = np.zeros((len(residue_types), 1)) for i, name in enumerate(residue_types): types_array_res[i] = pc.AA_TO_INDEX.get(name, unknown_name_idx) property_dict["residue_types"] = torch.tensor(types_array_res).type(dtype) if atom_coordinates is not None: property_dict["atom_coordinates"] = torch.tensor(atom_coordinates, dtype=dtype) if residue_coordinates is not None: property_dict["residue_coordinates"] = torch.tensor( residue_coordinates, dtype=dtype ) if residue_ids is not None: property_dict["residue_ids"] = torch.tensor(residue_ids, dtype=dtype) if chain_ids is not None: property_dict["chain_ids"] = torch.zeros(len(chain_ids), dtype=dtype) property_dict["chain_ids"][chain_ids == "L"] = 1 return property_dict class NodeRepresentation(Enum): Surface = "surface" Atom = "atom" Residue = "residue" class PairedPDB(HeteroData): # type: ignore @classmethod def from_tuple_system( cls, tupal: tuple = (Structure , Structure , Structure), add_edges: bool = True, k: int = 10, ) -> PairedPDB: return cls.from_structure_pair( holo=tupal[0], apo=tupal[1], add_edges=add_edges, k=k, ) @classmethod def from_structure_pair( cls, holo: Structure, apo: Structure, add_edges: bool = True, k: int = 10, ) -> PairedPDB: graph = cls() holo_calpha = holo.filter("atom_name", mask=["CA"]) apo_calpha = apo.filter("atom_name", mask=["CA"]) r_h = (holo.dataframe['chain_id'] == 'R').sum() r_a = (apo.dataframe['chain_id'] == 'R').sum() holo_r_props = structure2tensor( atom_coordinates=holo.coords[:r_h], atom_types=holo.atom_array.atom_name[:r_h], element_types=holo.atom_array.element[:r_h], residue_coordinates=holo_calpha.coords[:r_h], residue_types=holo_calpha.atom_array.res_name[:r_h], residue_ids=holo_calpha.atom_array.res_id[:r_h], ) holo_l_props = structure2tensor( atom_coordinates=holo.coords[r_h:], atom_types=holo.atom_array.atom_name[r_h:], element_types=holo.atom_array.element[r_h:], residue_coordinates=holo_calpha.coords[r_h:], residue_types=holo_calpha.atom_array.res_name[r_h:], residue_ids=holo_calpha.atom_array.res_id[r_h:], ) apo_r_props = structure2tensor( atom_coordinates=apo.coords[:r_a], atom_types=apo.atom_array.atom_name[:r_a], element_types=apo.atom_array.element[:r_a], residue_coordinates=apo_calpha.coords[:r_a], residue_types=apo_calpha.atom_array.res_name[:r_a], residue_ids=apo_calpha.atom_array.res_id[:r_a], ) apo_l_props = structure2tensor( atom_coordinates=apo.coords[r_a:], atom_types=apo.atom_array.atom_name[r_a:], element_types=apo.atom_array.element[r_a:], residue_coordinates=apo_calpha.coords[r_a:], residue_types=apo_calpha.atom_array.res_name[r_a:], residue_ids=apo_calpha.atom_array.res_id[r_a:], ) graph["ligand"].x = apo_l_props["atom_types"] graph["ligand"].pos = apo_l_props["atom_coordinates"] graph["receptor"].x = apo_r_props["atom_types"] graph["receptor"].pos = apo_r_props["atom_coordinates"] graph["ligand"].y = holo_l_props["atom_coordinates"] # graph["ligand"].pos = holo_l_props["atom_coordinates"] graph["receptor"].y = holo_r_props["atom_coordinates"] # graph["receptor"].pos = holo_r_props["atom_coordinates"] if add_edges and torch_cluster_installed: graph["ligand"].edge_index = knn_graph( graph["ligand"].pos, k=k ) graph["receptor"].edge_index = knn_graph( graph["receptor"].pos, k=k ) # graph["ligand"].edge_index = knn_graph( # graph["ligand"].pos, k=k # ) # graph["receptor"].edge_index = knn_graph( # graph["receptor"].pos, k=k # ) return graph #create_graph takes inputs apo_ligand, apo_residue and paired holo as pdb3(ground truth). def create_graph(pdb1, pdb2, k=5): r""" Create a heterogeneous graph from two PDB files, with the ligand and receptor as separate nodes, and their respective features and edges. Args: pdb1 (str): PDB file path for ligand. pdb2 (str): PDB file path for receptor. coords3 (list): List of coordinates used for `y` values (e.g., binding affinity, etc.). k (int): Number of nearest neighbors for constructing the knn graph. Returns: HeteroData: A PyG HeteroData object containing ligand and receptor data. """ # Extract coordinates from PDB files coords1 = torch.tensor(extract_coordinates_from_pdb(pdb1),dtype=torch.float) coords2 = torch.tensor(extract_coordinates_from_pdb(pdb2),dtype=torch.float) # coords3 = torch.tensor(extract_coordinates_from_pdb(pdb3),dtype=torch.float) # Create the HeteroData object data = HeteroData() # Define ligand node features data["ligand"].x = torch.tensor(coords1, dtype=torch.float) data["ligand"].pos = coords1 # data["ligand"].y = torch.tensor(coords3[:len(coords1)], dtype=torch.float) # Define receptor node features data["receptor"].x = torch.tensor(coords2, dtype=torch.float) data["receptor"].pos = coords2 # data["receptor"].y = torch.tensor(coords3[len(coords1):], dtype=torch.float) # Construct k-NN graph for ligand ligand_edge_index = knn_graph(data["ligand"].pos, k=k) data["ligand"].edge_index = ligand_edge_index # Construct k-NN graph for receptor receptor_edge_index = knn_graph(data["receptor"].pos, k=k) data["receptor"].edge_index = receptor_edge_index # Convert edge index to SparseTensor for ligand data["ligand", "ligand"].edge_index = ligand_edge_index # Convert edge index to SparseTensor for receptor data["receptor", "receptor"].edge_index = receptor_edge_index return data def update_pdb_coordinates_from_tensor(input_filename, output_filename, coordinates_tensor): r""" Updates atom coordinates in a PDB file with new transformed coordinates provided in a tensor. Parameters: - input_filename (str): Path to the original PDB file. - output_filename (str): Path to the new PDB file to save updated coordinates. - coordinates_tensor (torch.Tensor): Tensor of shape (1, N, 3) with transformed coordinates. """ # Convert the tensor to a list of tuples new_coordinates = coordinates_tensor.squeeze(0).tolist() # Create a parser and parse the structure parser = PDB.PDBParser(QUIET=True) structure = parser.get_structure("structure", input_filename) # Flattened iterator for atoms to update coordinates atom_iterator = (atom for model in structure for chain in model for residue in chain for atom in residue) # Update each atom's coordinates for atom, (new_x, new_y, new_z) in zip(atom_iterator, new_coordinates): original_anisou = atom.get_anisou() original_uij = atom.get_siguij() original_tm= atom.get_sigatm() original_occupancy = atom.get_occupancy() original_bfactor = atom.get_bfactor() original_altloc = atom.get_altloc() original_fullname = atom.get_fullname() original_serial_number = atom.get_serial_number() original_element = atom.get_charge() original_id = atom.get_full_id() original_idx = atom.get_id() original_level = atom.get_level() original_name = atom.get_name() original_parent = atom.get_parent() original_radius = atom.get_radius() # Update only the atom coordinates, keep other fields intact atom.coord = np.array([new_x, new_y, new_z]) # Reapply the preserved properties atom.set_anisou(original_anisou) atom.set_siguij(original_uij) atom.set_sigatm(original_tm) atom.set_occupancy(original_occupancy) atom.set_bfactor(original_bfactor) atom.set_altloc(original_altloc) # atom.set_fullname(original_fullname) atom.set_serial_number(original_serial_number) atom.set_charge(original_element) atom.set_radius(original_radius) atom.set_parent(original_parent) # atom.set_name(original_name) # atom.set_leve output_filename = "/tmp/" + output_filename # Save the updated structure to a new PDB file io = PDBIO() io.set_structure(structure) io.save(output_filename) # Return the path to the updated PDB file return output_filename def merge_pdb_files(file1, file2, output_file): r""" Merges two PDB files by concatenating them without altering their contents. Parameters: - file1 (str): Path to the first PDB file (e.g., receptor). - file2 (str): Path to the second PDB file (e.g., ligand). - output_file (str): Path to the output file where the merged structure will be saved. """ output_file = "/tmp/" + output_file with open(output_file, 'w') as outfile: # Copy the contents of the first file with open(file1, 'r') as f1: lines = f1.readlines() # Write all lines except the last 'END' line outfile.writelines(lines[:-1]) # Copy the contents of the second file with open(file2, 'r') as f2: outfile.write(f2.read()) print(f"Merged PDB saved to {output_file}") return output_file class MPNNLayer(MessagePassing): def __init__(self, emb_dim=64, edge_dim=4, aggr='add'): r"""Message Passing Neural Network Layer Args: emb_dim: (int) - hidden dimension d edge_dim: (int) - edge feature dimension d_e aggr: (str) - aggregation function \oplus (sum/mean/max) """ # Set the aggregation function super().__init__(aggr=aggr) self.emb_dim = emb_dim self.edge_dim = edge_dim # MLP \psi for computing messages m_ij # Implemented as a stack of Linear->BN->ReLU->Linear->BN->ReLU # dims: (2d + d_e) -> d self.mlp_msg = Sequential( Linear(2*emb_dim + edge_dim, emb_dim), BatchNorm1d(emb_dim), ReLU(), Linear(emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU() ) # MLP \phi for computing updated node features h_i^{l+1} # Implemented as a stack of Linear->BN->ReLU->Linear->BN->ReLU # dims: 2d -> d self.mlp_upd = Sequential( Linear(2*emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU(), Linear(emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU() ) def forward(self, h, edge_index, edge_attr): r""" The forward pass updates node features h via one round of message passing. As our MPNNLayer class inherits from the PyG MessagePassing parent class, we simply need to call the propagate() function which starts the message passing procedure: message() -> aggregate() -> update(). The MessagePassing class handles most of the logic for the implementation. To build custom GNNs, we only need to define our own message(), aggregate(), and update() functions (defined subsequently). Args: h: (n, d) - initial node features edge_index: (e, 2) - pairs of edges (i, j) edge_attr: (e, d_e) - edge features Returns: out: (n, d) - updated node features """ out = self.propagate(edge_index, h=h, edge_attr=edge_attr) return out def message(self, h_i, h_j, edge_attr): r"""Step (1) Message The message() function constructs messages from source nodes j to destination nodes i for each edge (i, j) in edge_index. The arguments can be a bit tricky to understand: message() can take any arguments that were initially passed to propagate. Additionally, we can differentiate destination nodes and source nodes by appending _i or _j to the variable name, e.g. for the node features h, we can use h_i and h_j. This part is critical to understand as the message() function constructs messages for each edge in the graph. The indexing of the original node features h (or other node variables) is handled under the hood by PyG. Args: h_i: (e, d) - destination node features h_j: (e, d) - source node features edge_attr: (e, d_e) - edge features Returns: msg: (e, d) - messages m_ij passed through MLP \psi """ msg = torch.cat([h_i, h_j, edge_attr], dim=-1) return self.mlp_msg(msg) def aggregate(self, inputs, index): r"""Step (2) Aggregate The aggregate function aggregates the messages from neighboring nodes, according to the chosen aggregation function ('sum' by default). Args: inputs: (e, d) - messages m_ij from destination to source nodes index: (e, 1) - list of source nodes for each edge/message in input Returns: aggr_out: (n, d) - aggregated messages m_i """ return scatter(inputs, index, dim=self.node_dim, reduce=self.aggr) def update(self, aggr_out, h): r""" Step (3) Update The update() function computes the final node features by combining the aggregated messages with the initial node features. update() takes the first argument aggr_out, the result of aggregate(), as well as any optional arguments that were initially passed to propagate(). E.g. in this case, we additionally pass h. Args: aggr_out: (n, d) - aggregated messages m_i h: (n, d) - initial node features Returns: upd_out: (n, d) - updated node features passed through MLP \phi """ upd_out = torch.cat([h, aggr_out], dim=-1) return self.mlp_upd(upd_out) def __repr__(self) -> str: return (f'{self.__class__.__name__}(emb_dim={self.emb_dim}, aggr={self.aggr})') class MPNNModel(Module): def __init__(self, num_layers=4, emb_dim=64, in_dim=11, edge_dim=4, out_dim=1): r"""Message Passing Neural Network model for graph property prediction Args: num_layers: (int) - number of message passing layers L emb_dim: (int) - hidden dimension d in_dim: (int) - initial node feature dimension d_n edge_dim: (int) - edge feature dimension d_e out_dim: (int) - output dimension (fixed to 1) """ super().__init__() # Linear projection for initial node features # dim: d_n -> d self.lin_in = Linear(in_dim, emb_dim) # Stack of MPNN layers self.convs = torch.nn.ModuleList() for layer in range(num_layers): self.convs.append(MPNNLayer(emb_dim, edge_dim, aggr='add')) # Global pooling/readout function R (mean pooling) # PyG handles the underlying logic via global_mean_pool() self.pool = global_mean_pool # Linear prediction head # dim: d -> out_dim self.lin_pred = Linear(emb_dim, out_dim) def forward(self, data): r""" Args: data: (PyG.Data) - batch of PyG graphs Returns: out: (batch_size, out_dim) - prediction for each graph """ h = self.lin_in(data.x) # (n, d_n) -> (n, d) for conv in self.convs: h = h + conv(h, data.edge_index, data.edge_attr) # (n, d) -> (n, d) # Note that we add a residual connection after each MPNN layer h_graph = self.pool(h, data.batch) # (n, d) -> (batch_size, d) out = self.lin_pred(h_graph) # (batch_size, d) -> (batch_size, 1) return out.view(-1) class EquivariantMPNNLayer(MessagePassing): def __init__(self, emb_dim=64, aggr='add'): r"""Message Passing Neural Network Layer This layer is equivariant to 3D rotations and translations. Args: emb_dim: (int) - hidden dimension d edge_dim: (int) - edge feature dimension d_e aggr: (str) - aggregation function \oplus (sum/mean/max) """ # Set the aggregation function super().__init__(aggr=aggr) self.emb_dim = emb_dim # self.mlp_msg = Sequential( Linear(2 * emb_dim + 1, emb_dim), BatchNorm1d(emb_dim), ReLU(), Linear(emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU() ) self.mlp_pos = Sequential( Linear(emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU(), Linear(emb_dim,1) ) # MLP \psi self.mlp_upd = Sequential( Linear(2*emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU(), Linear(emb_dim,emb_dim), BatchNorm1d(emb_dim), ReLU() ) # MLP \phi # =========================================== def forward(self, h, pos, edge_index): r""" The forward pass updates node features h via one round of message passing. Args: h: (n, d) - initial node features pos: (n, 3) - initial node coordinates edge_index: (e, 2) - pairs of edges (i, j) edge_attr: (e, d_e) - edge features Returns: out: [(n, d),(n,3)] - updated node features """ # out = self.propagate(edge_index=edge_index, h=h, pos=pos) return out # ========================================== # def message(self, h_i,h_j,pos_i,pos_j): # Compute distance between nodes i and j (Euclidean distance) #distance_ij = torch.norm(pos_i - pos_j, dim=-1, keepdim=True) # (e, 1) pos_diff = pos_i - pos_j dists = torch.norm(pos_diff,dim=-1).unsqueeze(1) # Concatenate node features, edge features, and distance msg = torch.cat([h_i , h_j, dists], dim=-1) msg = self.mlp_msg(msg) pos_diff = pos_diff * self.mlp_pos(msg) # (e, 2d + d_e + 1) # (e, d) return msg , pos_diff # ... # def aggregate(self, inputs, index): r"""The aggregate function aggregates the messages from neighboring nodes, according to the chosen aggregation function ('sum' by default). Args: inputs: (e, d) - messages m_ij from destination to source nodes index: (e, 1) - list of source nodes for each edge/message in input Returns: aggr_out: (n, d) - aggregated messages m_i """ msgs , pos_diffs = inputs msg_aggr = scatter(msgs, index , dim = self.node_dim , reduce = self.aggr) pos_aggr = scatter(pos_diffs, index, dim = self.node_dim , reduce = "mean") return msg_aggr , pos_aggr def update(self, aggr_out, h , pos): msg_aggr , pos_aggr = aggr_out upd_out = self.mlp_upd(torch.cat((h, msg_aggr), dim=-1)) upd_pos = pos + pos_aggr return upd_out , upd_pos def __repr__(self) -> str: return (f'{self.__class__.__name__}(emb_dim={self.emb_dim}, aggr={self.aggr})') class FinalMPNNModel(MPNNModel): def __init__(self, num_layers=4, emb_dim=64, in_dim=3, num_heads = 2): r"""Message Passing Neural Network model for graph property prediction This model uses both node features and coordinates as inputs, and is invariant to 3D rotations and translations (the constituent MPNN layers are equivariant to 3D rotations and translations). Args: num_layers: (int) - number of message passing layers L emb_dim: (int) - hidden dimension d in_dim: (int) - initial node feature dimension d_n edge_dim: (int) - edge feature dimension d_e out_dim: (int) - output dimension (fixed to 1) """ super().__init__() # Linear projection for initial node features # dim: d_n -> d self.lin_in = Linear(in_dim, emb_dim) self.equiv_layer = EquivariantMPNNLayer(emb_dim=emb_dim) # Stack of MPNN layers self.convs = torch.nn.ModuleList() for layer in range(num_layers): self.convs.append(EquivariantMPNNLayer(emb_dim, aggr='add')) self.cross_attention = nn.MultiheadAttention(emb_dim, num_heads, batch_first=True) self.fc_rotation = nn.Linear(emb_dim, 9) self.fc_translation = nn.Linear(emb_dim, 3) # Global pooling/readout function R (mean pooling) # PyG handles the underlying logic via global_mean_pool() # self.pool = global_mean_pool def naive_single(self, receptor, ligand , receptor_edge_index , ligand_edge_index): r""" Processes a single receptor-ligand pair. Args: receptor: Tensor of shape (1, num_receptor_atoms, 3) (receptor coordinates) ligand: Tensor of shape (1, num_ligand_atoms, 3) (ligand coordinates) Returns: rotation_matrix: Tensor of shape (1, 3, 3) predicted rotation matrix for the ligand. translation_vector: Tensor of shape (1, 3) predicted translation vector for the ligand. """ # h_receptor = receptor # Initial node features for the receptor # h_ligand = ligand h_receptor = self.lin_in(receptor) h_ligand = self.lin_in(ligand) # Initial node features for the ligand pos_receptor = receptor # Initial positions pos_ligand = ligand for layer in self.convs: # Apply the equivariant message-passing layer for both receptor and ligand h_receptor, pos_receptor = layer(h_receptor, pos_receptor,receptor_edge_index ) h_ligand, pos_ligand = layer(h_ligand, pos_ligand, ligand_edge_index) # print("Shape of h_receptor:", h_receptor.shape) # print("Shape of h_ligand:", h_ligand.shape) # Pass the layer outputs through MLPs for embeddings emb_features_receptor = h_receptor emb_features_ligand = h_ligand attn_output, _ = self.cross_attention(emb_features_receptor, emb_features_ligand, emb_features_ligand) rotation_matrix = self.fc_rotation(attn_output.mean(dim=0)) rotation_matrix = rotation_matrix.view(-1, 3, 3) translation_vector = self.fc_translation(attn_output.mean(dim=0)) return rotation_matrix, translation_vector def forward(self, data): r""" The main forward pass of the model. Args: batch: Same as in forward_rot_trans. Returns: transformed_ligands: List of tensors, each of shape (1, num_ligand_atoms, 3) representing the transformed ligand coordinates after applying the predicted rotation and translation. """ receptor = data['receptor']['pos'] ligand = data['ligand']['pos'] receptor_edge_index = data['receptor']['edge_index'] ligand_edge_index = data['ligand']['edge_index'] rotation_matrix, translation_vector = self.naive_single(receptor, ligand,receptor_edge_index , ligand_edge_index) # for i in range(len(ligands)): # ligands[i] = ligands[i] @ rotation_matrix[i] + translation_vector[i] ligands = data['ligand']['pos'] @ rotation_matrix + translation_vector return ligands class FinalMPNNModelight(pl.LightningModule): def __init__(self, num_layers=4, emb_dim=32, in_dim=3, num_heads=1, lr=1e-4): super().__init__() self.lin_in = nn.Linear(in_dim, emb_dim) self.convs = nn.ModuleList([EquivariantMPNNLayer(emb_dim, aggr='add') for _ in range(num_layers)]) self.cross_attention = nn.MultiheadAttention(emb_dim, num_heads, batch_first=True) self.fc_rotation = nn.Linear(emb_dim, 9) self.fc_translation = nn.Linear(emb_dim, 3) self.lr = lr def naive_single(self, receptor, ligand, receptor_edge_index, ligand_edge_index): h_receptor = self.lin_in(receptor) h_ligand = self.lin_in(ligand) pos_receptor, pos_ligand = receptor, ligand for layer in self.convs: h_receptor, pos_receptor = layer(h_receptor, pos_receptor, receptor_edge_index) h_ligand, pos_ligand = layer(h_ligand, pos_ligand, ligand_edge_index) attn_output, _ = self.cross_attention(h_receptor, h_ligand, h_ligand) rotation_matrix = self.fc_rotation(attn_output.mean(dim=0)).view(-1, 3, 3) translation_vector = self.fc_translation(attn_output.mean(dim=0)) return rotation_matrix, translation_vector def forward(self, data): device = torch.device('cuda:0' if torch.cuda.is_available() else 'cpu') receptor = data['receptor']['pos'].to(device) ligand = data['ligand']['pos'].to(device) receptor_edge_index = data['receptor', 'receptor']['edge_index'].to(device) ligand_edge_index = data['ligand', 'ligand']['edge_index'].to(device) rotation_matrix, translation_vector = self.naive_single(receptor, ligand, receptor_edge_index, ligand_edge_index) # transformed_ligand = torch.matmul(ligand ,rotation_matrix) + translation_vector return rotation_matrix, translation_vector def training_step(self, batch, batch_idx): ligand_pred = self(batch) ligand_true = batch['ligand']['y'] loss = F.mse_loss(ligand_pred.squeeze(0), ligand_true) self.log('train_loss', loss, batch_size=8) return loss def validation_step(self, batch, batch_idx): ligand_pred = self(batch) ligand_true = batch['ligand']['y'] loss = F.l1_loss(ligand_pred.squeeze(0), ligand_true) self.log('val_loss', loss, prog_bar=True, batch_size=8) return loss def test_step(self, batch, batch_idx): ligand_pred = self(batch) ligand_true = batch['ligand']['y'] loss = F.l1_loss(ligand_pred.squeeze(0), ligand_true) self.log('test_loss', loss, prog_bar=True, batch_size=8) return loss def configure_optimizers(self): optimizer = torch.optim.Adam(self.parameters(), lr=self.lr) scheduler = torch.optim.lr_scheduler.ReduceLROnPlateau( optimizer, mode="min", factor=0.1, patience=5 ) return { "optimizer": optimizer, "lr_scheduler": { "scheduler": scheduler, "monitor": "val_loss", # Monitor validation loss to adjust the learning rate }, } model_path = "./EquiMPNN-epoch=413-val_loss=9.25-val_acc=0.00.ckpt" model = FinalMPNNModelight.load_from_checkpoint(model_path) trainer = pl.Trainer( fast_dev_run=False, accelerator="gpu" if torch.cuda.is_available() else "cpu", precision="bf16-mixed", devices=1, ) model.eval() def predict (input_seq_1, input_msa_1, input_protein_1, input_seq_2,input_msa_2, input_protein_2): start_time = time.time() device = torch.device("cuda" if torch.cuda.is_available() else "cpu") data = create_graph(input_protein_1, input_protein_2, k=10) with torch.no_grad(): mat, vect = model(data) mat = mat.to(device) vect = vect.to(device) ligand1 = torch.tensor(extract_coordinates_from_pdb(input_protein_1),dtype=torch.float).to(device) # receptor1 = torch.tensor(extract_coordinates_from_pdb(input_protein_2),dtype=torch.float).to(device) transformed_ligand = torch.matmul(ligand1, mat) + vect # transformed_receptor = torch.matmul(receptor1, mat) + vect file1 = update_pdb_coordinates_from_tensor(input_protein_1, "holo_ligand.pdb", transformed_ligand) # file2 = update_pdb_coordinates_from_tensor(input_protein_2, "holo_receptor.pdb", transformed_receptor) out_pdb = merge_pdb_files(file1,input_protein_2,"output.pdb") # return an output pdb file with the protein and two chains A and B. # also return a JSON with any metrics you want to report metrics = {"mean_plddt": 80, "binding_affinity": 2} end_time = time.time() run_time = end_time - start_time return out_pdb,json.dumps(metrics), run_time with gr.Blocks() as app: gr.Markdown("# Template for inference") gr.Markdown("EquiMPNN MOdel") with gr.Row(): with gr.Column(): input_seq_1 = gr.Textbox(lines=3, label="Input Protein 1 sequence (FASTA)") input_msa_1 = gr.File(label="Input MSA Protein 1 (A3M)") input_protein_1 = gr.File(label="Input Protein 2 monomer (PDB)") with gr.Column(): input_seq_2 = gr.Textbox(lines=3, label="Input Protein 2 sequence (FASTA)") input_msa_2 = gr.File(label="Input MSA Protein 2 (A3M)") input_protein_2 = gr.File(label="Input Protein 2 structure (PDB)") # define any options here # for automated inference the default options are used # slider_option = gr.Slider(0,10, label="Slider Option") # checkbox_option = gr.Checkbox(label="Checkbox Option") # dropdown_option = gr.Dropdown(["Option 1", "Option 2", "Option 3"], label="Radio Option") btn = gr.Button("Run Inference") gr.Examples( [ [ "GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD", "3v1c_A.pdb", "GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD", "3v1c_B.pdb", ], ], [input_seq_1, input_protein_1, input_seq_2, input_protein_2], ) reps = [ { "model": 0, "style": "cartoon", "chain": "A", "color": "whiteCarbon", }, { "model": 0, "style": "cartoon", "chain": "B", "color": "greenCarbon", }, { "model": 0, "chain": "A", "style": "stick", "sidechain": True, "color": "whiteCarbon", }, { "model": 0, "chain": "B", "style": "stick", "sidechain": True, "color": "greenCarbon" } ] # outputs out = Molecule3D(reps=reps) metrics = gr.JSON(label="Metrics") run_time = gr.Textbox(label="Runtime") btn.click(predict, inputs=[input_seq_1, input_msa_1, input_protein_1, input_seq_2, input_msa_2, input_protein_2], outputs=[out, metrics, run_time]) app.launch()