thnaks
Browse files
app.py
CHANGED
@@ -1,506 +1,506 @@
|
|
1 |
-
import spaces
|
2 |
-
import logging
|
3 |
-
import gradio as gr
|
4 |
-
import os
|
5 |
-
import uuid
|
6 |
-
from datetime import datetime
|
7 |
-
import numpy as np
|
8 |
-
from configs.configs_base import configs as configs_base
|
9 |
-
from configs.configs_data import data_configs
|
10 |
-
from configs.configs_inference import inference_configs
|
11 |
-
from runner.inference import download_infercence_cache, update_inference_configs, infer_predict, infer_detect, InferenceRunner
|
12 |
-
from protenix.config import parse_configs, parse_sys_args
|
13 |
-
from runner.msa_search import update_infer_json
|
14 |
-
from protenix.web_service.prediction_visualization import plot_best_confidence_measure, PredictionLoader
|
15 |
-
from process_data import process_data
|
16 |
-
import json
|
17 |
-
from typing import Dict, List
|
18 |
-
from Bio.PDB import MMCIFParser, PDBIO
|
19 |
-
import tempfile
|
20 |
-
import shutil
|
21 |
-
from Bio import PDB
|
22 |
-
from gradio_molecule3d import Molecule3D
|
23 |
-
|
24 |
-
EXAMPLE_PATH = './examples/example.json'
|
25 |
-
example_json=[{'sequences': [{'proteinChain': {'sequence': 'MAEVIRSSAFWRSFPIFEEFDSETLCELSGIASYRKWSAGTVIFQRGDQGDYMIVVVSGRIKLSLFTPQGRELMLRQHEAGALFGEMALLDGQPRSADATAVTAAEGYVIGKKDFLALITQRPKTAEAVIRFLCAQLRDTTDRLETIALYDLNARVARFFLATLRQIHGSEMPQSANLRLTLSQTDIASILGASRPKVNRAILSLEESGAIKRADGIICCNVGRLLSIADPEEDLEHHHHHHHH', 'count': 2}}, {'dnaSequence': {'sequence': 'CTAGGTAACATTACTCGCG', 'count': 2}}, {'dnaSequence': {'sequence': 'GCGAGTAATGTTAC', 'count': 2}}, {'ligand': {'ligand': 'CCD_PCG', 'count': 2}}], 'name': '7pzb_need_search_msa'}]
|
26 |
-
|
27 |
-
# Custom CSS for styling
|
28 |
-
custom_css = """
|
29 |
-
#logo {
|
30 |
-
|
31 |
-
}
|
32 |
-
.title {
|
33 |
-
|
34 |
-
|
35 |
-
|
36 |
-
|
37 |
-
|
38 |
-
}
|
39 |
-
"""
|
40 |
-
|
41 |
-
|
42 |
-
os.environ["LAYERNORM_TYPE"] = "fast_layernorm"
|
43 |
-
os.environ["USE_DEEPSPEED_EVO_ATTTENTION"] = "False"
|
44 |
-
# Set environment variable in the script
|
45 |
-
#os.environ['CUTLASS_PATH'] = './cutlass'
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
46 |
|
47 |
# reps = [
|
48 |
# {
|
49 |
# "model": 0,
|
50 |
# "chain": "",
|
51 |
# "resname": "",
|
52 |
-
# "style": "cartoon",
|
53 |
# "color": "whiteCarbon",
|
54 |
# "residue_range": "",
|
55 |
# "around": 0,
|
56 |
# "byres": False,
|
57 |
-
# "
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
58 |
# }
|
59 |
# ]
|
|
|
60 |
|
61 |
-
|
62 |
-
|
63 |
-
|
64 |
-
|
65 |
-
|
66 |
-
|
67 |
-
|
68 |
-
|
69 |
-
|
70 |
-
|
71 |
-
|
72 |
-
|
73 |
-
|
74 |
-
|
75 |
-
|
76 |
-
|
77 |
-
|
78 |
-
|
79 |
-
|
80 |
-
|
81 |
-
"byres": False,
|
82 |
-
"opacity": 0.8,
|
83 |
-
}
|
84 |
-
]
|
85 |
-
##
|
86 |
-
|
87 |
-
|
88 |
-
def align_pdb_files(pdb_file_1, pdb_file_2):
|
89 |
-
# Load the structures
|
90 |
-
parser = PDB.PPBuilder()
|
91 |
-
io = PDB.PDBIO()
|
92 |
-
structure_1 = PDB.PDBParser(QUIET=True).get_structure('Structure_1', pdb_file_1)
|
93 |
-
structure_2 = PDB.PDBParser(QUIET=True).get_structure('Structure_2', pdb_file_2)
|
94 |
-
|
95 |
-
# Superimpose the second structure onto the first
|
96 |
-
super_imposer = PDB.Superimposer()
|
97 |
-
model_1 = structure_1[0]
|
98 |
-
model_2 = structure_2[0]
|
99 |
-
|
100 |
-
# Extract the coordinates from the two structures
|
101 |
-
atoms_1 = [atom for atom in model_1.get_atoms() if atom.get_name() == "CA"] # Use CA atoms
|
102 |
-
atoms_2 = [atom for atom in model_2.get_atoms() if atom.get_name() == "CA"]
|
103 |
-
|
104 |
-
# Align the structures based on the CA atoms
|
105 |
-
coord_1 = [atom.get_coord() for atom in atoms_1]
|
106 |
-
coord_2 = [atom.get_coord() for atom in atoms_2]
|
107 |
|
108 |
-
|
109 |
-
|
110 |
-
|
111 |
-
|
112 |
-
|
113 |
-
|
114 |
-
|
115 |
-
# Function to convert .cif to .pdb and save as a temporary file
|
116 |
-
def convert_cif_to_pdb(cif_path):
|
117 |
-
|
118 |
-
|
119 |
-
|
120 |
-
|
121 |
-
|
122 |
-
|
123 |
-
|
124 |
-
|
125 |
-
|
126 |
-
|
127 |
-
|
128 |
-
|
129 |
-
|
130 |
-
|
131 |
-
|
132 |
-
|
133 |
-
|
134 |
-
|
135 |
-
|
136 |
-
|
137 |
-
|
138 |
-
|
139 |
-
|
140 |
-
|
141 |
-
def plot_3d(pred_loader):
|
142 |
-
|
143 |
-
|
144 |
-
|
145 |
-
|
146 |
-
|
147 |
-
|
148 |
-
|
149 |
-
|
150 |
-
def parse_json_input(json_data: List[Dict]) -> Dict:
|
151 |
-
|
152 |
-
|
153 |
-
|
154 |
-
|
155 |
-
|
156 |
-
|
157 |
-
|
158 |
|
159 |
-
|
160 |
-
|
161 |
-
|
162 |
-
|
163 |
-
|
164 |
-
|
165 |
-
|
166 |
-
|
167 |
-
|
168 |
-
|
169 |
-
|
170 |
-
|
171 |
-
|
172 |
-
|
173 |
-
|
174 |
-
|
175 |
-
|
176 |
-
|
177 |
-
|
178 |
-
|
179 |
-
def create_protenix_json(input_data: Dict) -> List[Dict]:
|
180 |
-
|
181 |
-
|
182 |
|
183 |
-
|
184 |
-
|
185 |
-
|
186 |
-
|
187 |
-
|
188 |
-
|
189 |
-
|
190 |
|
191 |
-
|
192 |
-
|
193 |
-
|
194 |
-
|
195 |
-
|
196 |
-
|
197 |
-
|
198 |
|
199 |
-
|
200 |
-
|
201 |
-
|
202 |
-
|
203 |
-
|
204 |
-
|
205 |
-
|
206 |
|
207 |
-
|
208 |
-
|
209 |
-
|
210 |
-
|
211 |
-
|
212 |
-
|
213 |
-
#@torch.inference_mode()
|
214 |
-
@spaces.GPU(duration=120) # Specify a duration to avoid timeout
|
215 |
-
def predict_structure(input_collector: dict):
|
216 |
-
|
217 |
-
|
218 |
-
|
219 |
-
|
220 |
|
221 |
-
|
222 |
-
|
223 |
-
|
224 |
-
|
225 |
-
|
226 |
-
|
227 |
-
|
228 |
-
|
229 |
-
|
230 |
-
|
231 |
-
|
232 |
-
|
233 |
-
|
234 |
-
|
235 |
-
|
236 |
-
|
237 |
-
|
238 |
-
|
239 |
-
|
240 |
-
|
241 |
-
|
242 |
-
|
243 |
-
|
244 |
-
|
245 |
-
|
246 |
-
|
247 |
-
|
248 |
-
|
249 |
-
|
250 |
-
|
251 |
-
|
252 |
-
|
253 |
-
|
254 |
-
|
255 |
-
|
256 |
-
|
257 |
-
|
258 |
-
|
259 |
-
|
260 |
-
|
261 |
-
|
262 |
-
|
263 |
-
|
264 |
-
|
265 |
-
|
266 |
-
|
267 |
-
|
268 |
-
|
269 |
-
logger = logging.getLogger(__name__)
|
270 |
-
LOG_FORMAT = "%(asctime)s,%(msecs)-3d %(levelname)-8s [%(filename)s:%(lineno)s %(funcName)s] %(message)s"
|
271 |
-
logging.basicConfig(
|
272 |
-
|
273 |
-
|
274 |
-
|
275 |
-
|
276 |
-
)
|
277 |
-
configs_base["use_deepspeed_evo_attention"] = (
|
278 |
-
|
279 |
-
)
|
280 |
-
arg_str = "--seeds 101 --dump_dir ./output --input_json_path ./examples/example.json --model.N_cycle 10 --sample_diffusion.N_sample 5 --sample_diffusion.N_step 200 "
|
281 |
-
configs = {**configs_base, **{"data": data_configs}, **inference_configs}
|
282 |
-
configs = parse_configs(
|
283 |
-
|
284 |
-
|
285 |
-
|
286 |
-
)
|
287 |
-
configs.load_checkpoint_path='./checkpoint.pt'
|
288 |
-
download_infercence_cache()
|
289 |
-
configs.use_deepspeed_evo_attention=False
|
290 |
-
|
291 |
-
add_watermark = gr.Checkbox(label="Add Watermark", value=True)
|
292 |
-
add_watermark1 = gr.Checkbox(label="Add Watermark", value=True)
|
293 |
-
|
294 |
-
|
295 |
-
with gr.Blocks(title="FoldMark", css=custom_css) as demo:
|
296 |
-
|
297 |
-
|
298 |
-
|
299 |
-
|
300 |
-
|
301 |
-
|
302 |
-
|
303 |
|
304 |
-
|
305 |
-
|
306 |
-
|
307 |
-
|
308 |
-
|
309 |
-
|
310 |
-
|
311 |
|
312 |
-
|
313 |
-
|
314 |
-
|
315 |
|
316 |
-
|
317 |
-
|
318 |
-
|
319 |
-
|
320 |
-
|
321 |
-
|
322 |
-
|
323 |
-
|
324 |
-
|
325 |
-
|
326 |
-
|
327 |
-
|
328 |
-
|
329 |
-
|
330 |
-
|
331 |
-
|
332 |
-
|
333 |
-
|
334 |
-
|
335 |
-
|
336 |
-
|
337 |
-
|
338 |
-
|
339 |
-
|
340 |
|
341 |
-
|
342 |
-
|
343 |
-
|
344 |
-
|
345 |
-
|
346 |
-
|
347 |
-
|
348 |
-
|
349 |
-
|
350 |
-
|
351 |
-
|
352 |
-
|
353 |
-
|
354 |
-
|
355 |
-
|
356 |
-
|
357 |
-
|
358 |
-
|
359 |
-
|
360 |
-
|
361 |
-
|
362 |
-
|
363 |
-
|
364 |
-
|
365 |
-
|
366 |
-
|
367 |
-
|
368 |
-
|
369 |
-
|
370 |
-
|
371 |
-
|
372 |
-
|
373 |
-
|
374 |
-
|
375 |
-
|
376 |
-
|
377 |
-
|
378 |
-
|
379 |
-
|
380 |
-
|
381 |
-
|
382 |
-
|
383 |
-
|
384 |
-
|
385 |
-
|
386 |
-
|
387 |
-
|
388 |
|
389 |
-
|
390 |
-
|
391 |
-
|
392 |
|
393 |
-
|
394 |
-
|
395 |
-
|
396 |
-
|
397 |
-
|
398 |
-
|
399 |
-
|
400 |
-
|
401 |
|
402 |
-
|
403 |
-
|
404 |
-
|
405 |
-
|
406 |
-
|
407 |
-
|
408 |
-
|
409 |
|
410 |
-
|
411 |
-
|
412 |
-
|
413 |
-
|
414 |
-
|
415 |
-
|
416 |
|
417 |
-
|
418 |
|
419 |
-
|
420 |
-
|
421 |
-
|
422 |
-
|
423 |
-
|
424 |
-
|
425 |
-
|
426 |
-
|
427 |
-
|
428 |
-
|
429 |
-
|
430 |
-
|
431 |
-
|
432 |
-
|
433 |
-
|
434 |
-
|
435 |
-
|
436 |
-
|
437 |
-
|
438 |
|
439 |
-
|
440 |
-
|
441 |
-
|
442 |
-
|
443 |
-
|
444 |
-
|
445 |
-
|
446 |
-
|
447 |
-
|
448 |
-
|
449 |
-
|
450 |
-
|
451 |
-
|
452 |
-
|
453 |
-
|
454 |
-
|
455 |
-
|
456 |
-
|
457 |
-
|
458 |
-
|
459 |
-
|
460 |
-
|
461 |
-
|
462 |
|
463 |
-
|
464 |
-
|
465 |
|
466 |
-
|
467 |
-
|
468 |
-
|
469 |
-
|
470 |
-
|
471 |
-
|
472 |
-
|
473 |
-
|
474 |
-
|
475 |
-
|
476 |
|
477 |
|
478 |
|
479 |
-
|
480 |
-
|
481 |
-
|
482 |
|
483 |
-
|
484 |
-
|
485 |
|
486 |
-
|
487 |
-
|
488 |
|
489 |
-
|
490 |
-
|
491 |
|
492 |
-
|
493 |
-
|
494 |
-
|
495 |
-
|
496 |
-
|
497 |
|
498 |
-
|
499 |
|
500 |
|
501 |
|
502 |
|
503 |
|
504 |
|
505 |
-
if __name__ == "__main__":
|
506 |
-
|
|
|
1 |
+
# import spaces
|
2 |
+
# import logging
|
3 |
+
# import gradio as gr
|
4 |
+
# import os
|
5 |
+
# import uuid
|
6 |
+
# from datetime import datetime
|
7 |
+
# import numpy as np
|
8 |
+
# from configs.configs_base import configs as configs_base
|
9 |
+
# from configs.configs_data import data_configs
|
10 |
+
# from configs.configs_inference import inference_configs
|
11 |
+
# from runner.inference import download_infercence_cache, update_inference_configs, infer_predict, infer_detect, InferenceRunner
|
12 |
+
# from protenix.config import parse_configs, parse_sys_args
|
13 |
+
# from runner.msa_search import update_infer_json
|
14 |
+
# from protenix.web_service.prediction_visualization import plot_best_confidence_measure, PredictionLoader
|
15 |
+
# from process_data import process_data
|
16 |
+
# import json
|
17 |
+
# from typing import Dict, List
|
18 |
+
# from Bio.PDB import MMCIFParser, PDBIO
|
19 |
+
# import tempfile
|
20 |
+
# import shutil
|
21 |
+
# from Bio import PDB
|
22 |
+
# from gradio_molecule3d import Molecule3D
|
23 |
+
|
24 |
+
# EXAMPLE_PATH = './examples/example.json'
|
25 |
+
# example_json=[{'sequences': [{'proteinChain': {'sequence': 'MAEVIRSSAFWRSFPIFEEFDSETLCELSGIASYRKWSAGTVIFQRGDQGDYMIVVVSGRIKLSLFTPQGRELMLRQHEAGALFGEMALLDGQPRSADATAVTAAEGYVIGKKDFLALITQRPKTAEAVIRFLCAQLRDTTDRLETIALYDLNARVARFFLATLRQIHGSEMPQSANLRLTLSQTDIASILGASRPKVNRAILSLEESGAIKRADGIICCNVGRLLSIADPEEDLEHHHHHHHH', 'count': 2}}, {'dnaSequence': {'sequence': 'CTAGGTAACATTACTCGCG', 'count': 2}}, {'dnaSequence': {'sequence': 'GCGAGTAATGTTAC', 'count': 2}}, {'ligand': {'ligand': 'CCD_PCG', 'count': 2}}], 'name': '7pzb_need_search_msa'}]
|
26 |
+
|
27 |
+
# # Custom CSS for styling
|
28 |
+
# custom_css = """
|
29 |
+
# #logo {
|
30 |
+
# width: 50%;
|
31 |
+
# }
|
32 |
+
# .title {
|
33 |
+
# font-size: 32px;
|
34 |
+
# font-weight: bold;
|
35 |
+
# color: #4CAF50;
|
36 |
+
# display: flex;
|
37 |
+
# align-items: center; /* Vertically center the logo and text */
|
38 |
+
# }
|
39 |
+
# """
|
40 |
+
|
41 |
+
|
42 |
+
# os.environ["LAYERNORM_TYPE"] = "fast_layernorm"
|
43 |
+
# os.environ["USE_DEEPSPEED_EVO_ATTTENTION"] = "False"
|
44 |
+
# # Set environment variable in the script
|
45 |
+
# #os.environ['CUTLASS_PATH'] = './cutlass'
|
46 |
+
|
47 |
+
# # reps = [
|
48 |
+
# # {
|
49 |
+
# # "model": 0,
|
50 |
+
# # "chain": "",
|
51 |
+
# # "resname": "",
|
52 |
+
# # "style": "cartoon", # Use cartoon style
|
53 |
+
# # "color": "whiteCarbon",
|
54 |
+
# # "residue_range": "",
|
55 |
+
# # "around": 0,
|
56 |
+
# # "byres": False,
|
57 |
+
# # "visible": True # Ensure this representation is visible
|
58 |
+
# # }
|
59 |
+
# # ]
|
60 |
|
61 |
# reps = [
|
62 |
# {
|
63 |
# "model": 0,
|
64 |
# "chain": "",
|
65 |
# "resname": "",
|
66 |
+
# "style": "cartoon",
|
67 |
# "color": "whiteCarbon",
|
68 |
# "residue_range": "",
|
69 |
# "around": 0,
|
70 |
# "byres": False,
|
71 |
+
# "opacity": 0.2,
|
72 |
+
# },
|
73 |
+
# {
|
74 |
+
# "model": 1,
|
75 |
+
# "chain": "",
|
76 |
+
# "resname": "",
|
77 |
+
# "style": "cartoon",
|
78 |
+
# "color": "cyanCarbon",
|
79 |
+
# "residue_range": "",
|
80 |
+
# "around": 0,
|
81 |
+
# "byres": False,
|
82 |
+
# "opacity": 0.8,
|
83 |
# }
|
84 |
# ]
|
85 |
+
# ##
|
86 |
|
87 |
+
|
88 |
+
# def align_pdb_files(pdb_file_1, pdb_file_2):
|
89 |
+
# # Load the structures
|
90 |
+
# parser = PDB.PPBuilder()
|
91 |
+
# io = PDB.PDBIO()
|
92 |
+
# structure_1 = PDB.PDBParser(QUIET=True).get_structure('Structure_1', pdb_file_1)
|
93 |
+
# structure_2 = PDB.PDBParser(QUIET=True).get_structure('Structure_2', pdb_file_2)
|
94 |
+
|
95 |
+
# # Superimpose the second structure onto the first
|
96 |
+
# super_imposer = PDB.Superimposer()
|
97 |
+
# model_1 = structure_1[0]
|
98 |
+
# model_2 = structure_2[0]
|
99 |
+
|
100 |
+
# # Extract the coordinates from the two structures
|
101 |
+
# atoms_1 = [atom for atom in model_1.get_atoms() if atom.get_name() == "CA"] # Use CA atoms
|
102 |
+
# atoms_2 = [atom for atom in model_2.get_atoms() if atom.get_name() == "CA"]
|
103 |
+
|
104 |
+
# # Align the structures based on the CA atoms
|
105 |
+
# coord_1 = [atom.get_coord() for atom in atoms_1]
|
106 |
+
# coord_2 = [atom.get_coord() for atom in atoms_2]
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
107 |
|
108 |
+
# super_imposer.set_atoms(atoms_1, atoms_2)
|
109 |
+
# super_imposer.apply(model_2) # Apply the transformation to model_2
|
110 |
+
|
111 |
+
# # Save the aligned structure back to the original file
|
112 |
+
# io.set_structure(structure_2) # Save the aligned structure to the second file (original file)
|
113 |
+
# io.save(pdb_file_2)
|
114 |
+
|
115 |
+
# # Function to convert .cif to .pdb and save as a temporary file
|
116 |
+
# def convert_cif_to_pdb(cif_path):
|
117 |
+
# """
|
118 |
+
# Convert a CIF file to a PDB file and save it as a temporary file.
|
119 |
+
|
120 |
+
# Args:
|
121 |
+
# cif_path (str): Path to the input CIF file.
|
122 |
+
|
123 |
+
# Returns:
|
124 |
+
# str: Path to the temporary PDB file.
|
125 |
+
# """
|
126 |
+
# # Initialize the MMCIF parser
|
127 |
+
# parser = MMCIFParser()
|
128 |
+
# structure = parser.get_structure("protein", cif_path)
|
129 |
+
|
130 |
+
# # Create a temporary file for the PDB output
|
131 |
+
# with tempfile.NamedTemporaryFile(suffix=".pdb", delete=False) as temp_file:
|
132 |
+
# temp_pdb_path = temp_file.name
|
133 |
+
|
134 |
+
# # Save the structure as a PDB file
|
135 |
+
# io = PDBIO()
|
136 |
+
# io.set_structure(structure)
|
137 |
+
# io.save(temp_pdb_path)
|
138 |
+
|
139 |
+
# return temp_pdb_path
|
140 |
+
|
141 |
+
# def plot_3d(pred_loader):
|
142 |
+
# # Get the CIF file path for the given prediction ID
|
143 |
+
# cif_path = sorted(pred_loader.cif_paths)[0]
|
144 |
+
|
145 |
+
# # Convert the CIF file to a temporary PDB file
|
146 |
+
# temp_pdb_path = convert_cif_to_pdb(cif_path)
|
147 |
+
|
148 |
+
# return temp_pdb_path, cif_path
|
149 |
+
|
150 |
+
# def parse_json_input(json_data: List[Dict]) -> Dict:
|
151 |
+
# """Convert Protenix JSON format to UI-friendly structure"""
|
152 |
+
# components = {
|
153 |
+
# "protein_chains": [],
|
154 |
+
# "dna_sequences": [],
|
155 |
+
# "ligands": [],
|
156 |
+
# "complex_name": ""
|
157 |
+
# }
|
158 |
|
159 |
+
# for entry in json_data:
|
160 |
+
# components["complex_name"] = entry.get("name", "")
|
161 |
+
# for seq in entry["sequences"]:
|
162 |
+
# if "proteinChain" in seq:
|
163 |
+
# components["protein_chains"].append({
|
164 |
+
# "sequence": seq["proteinChain"]["sequence"],
|
165 |
+
# "count": seq["proteinChain"]["count"]
|
166 |
+
# })
|
167 |
+
# elif "dnaSequence" in seq:
|
168 |
+
# components["dna_sequences"].append({
|
169 |
+
# "sequence": seq["dnaSequence"]["sequence"],
|
170 |
+
# "count": seq["dnaSequence"]["count"]
|
171 |
+
# })
|
172 |
+
# elif "ligand" in seq:
|
173 |
+
# components["ligands"].append({
|
174 |
+
# "type": seq["ligand"]["ligand"],
|
175 |
+
# "count": seq["ligand"]["count"]
|
176 |
+
# })
|
177 |
+
# return components
|
178 |
+
|
179 |
+
# def create_protenix_json(input_data: Dict) -> List[Dict]:
|
180 |
+
# """Convert UI inputs to Protenix JSON format"""
|
181 |
+
# sequences = []
|
182 |
|
183 |
+
# for pc in input_data["protein_chains"]:
|
184 |
+
# sequences.append({
|
185 |
+
# "proteinChain": {
|
186 |
+
# "sequence": pc["sequence"],
|
187 |
+
# "count": pc["count"]
|
188 |
+
# }
|
189 |
+
# })
|
190 |
|
191 |
+
# for dna in input_data["dna_sequences"]:
|
192 |
+
# sequences.append({
|
193 |
+
# "dnaSequence": {
|
194 |
+
# "sequence": dna["sequence"],
|
195 |
+
# "count": dna["count"]
|
196 |
+
# }
|
197 |
+
# })
|
198 |
|
199 |
+
# for lig in input_data["ligands"]:
|
200 |
+
# sequences.append({
|
201 |
+
# "ligand": {
|
202 |
+
# "ligand": lig["type"],
|
203 |
+
# "count": lig["count"]
|
204 |
+
# }
|
205 |
+
# })
|
206 |
|
207 |
+
# return [{
|
208 |
+
# "sequences": sequences,
|
209 |
+
# "name": input_data["complex_name"]
|
210 |
+
# }]
|
211 |
+
|
212 |
+
|
213 |
+
# #@torch.inference_mode()
|
214 |
+
# @spaces.GPU(duration=120) # Specify a duration to avoid timeout
|
215 |
+
# def predict_structure(input_collector: dict):
|
216 |
+
# #first initialize runner
|
217 |
+
# runner = InferenceRunner(configs)
|
218 |
+
# """Handle both input types"""
|
219 |
+
# os.makedirs("./output", exist_ok=True)
|
220 |
|
221 |
+
# # Generate random filename with timestamp
|
222 |
+
# random_name = f"{datetime.now().strftime('%Y%m%d_%H%M%S')}_{uuid.uuid4().hex[:8]}"
|
223 |
+
# save_path = os.path.join("./output", f"{random_name}.json")
|
224 |
+
|
225 |
+
# print(input_collector)
|
226 |
+
|
227 |
+
# # Handle JSON input
|
228 |
+
# if input_collector["json"]:
|
229 |
+
# # Handle different input types
|
230 |
+
# if isinstance(input_collector["json"], str): # Example JSON case (file path)
|
231 |
+
# input_data = json.load(open(input_collector["json"]))
|
232 |
+
# elif hasattr(input_collector["json"], "name"): # File upload case
|
233 |
+
# input_data = json.load(open(input_collector["json"].name))
|
234 |
+
# else: # Direct JSON data case
|
235 |
+
# input_data = input_collector["json"]
|
236 |
+
# else: # Manual input case
|
237 |
+
# input_data = create_protenix_json(input_collector["data"])
|
238 |
+
|
239 |
+
# with open(save_path, "w") as f:
|
240 |
+
# json.dump(input_data, f, indent=2)
|
241 |
+
|
242 |
+
# if input_data==example_json and input_collector['watermark']==True:
|
243 |
+
# configs.saved_path = './output/example_output/'
|
244 |
+
# else:
|
245 |
+
# # run msa
|
246 |
+
# json_file = update_infer_json(save_path, './output', True)
|
247 |
+
|
248 |
+
# # Run prediction
|
249 |
+
# configs.input_json_path = json_file
|
250 |
+
# configs.watermark = input_collector['watermark']
|
251 |
+
# configs.saved_path = os.path.join("./output/", random_name)
|
252 |
+
# infer_predict(runner, configs)
|
253 |
+
# #saved_path = os.path.join('./output', f"{sample_name}", f"seed_{seed}", 'predictions')
|
254 |
+
|
255 |
+
# # Generate visualizations
|
256 |
+
# pred_loader = PredictionLoader(os.path.join(configs.saved_path, 'predictions'))
|
257 |
+
# view3d, cif_path = plot_3d(pred_loader=pred_loader)
|
258 |
+
# if configs.watermark:
|
259 |
+
# pred_loader = PredictionLoader(os.path.join(configs.saved_path, 'predictions_orig'))
|
260 |
+
# view3d_orig, _ = plot_3d(pred_loader=pred_loader)
|
261 |
+
# align_pdb_files(view3d, view3d_orig)
|
262 |
+
# view3d = [view3d, view3d_orig]
|
263 |
+
# plot_best_confidence_measure(os.path.join(configs.saved_path, 'predictions'))
|
264 |
+
# confidence_img_path = os.path.join(os.path.join(configs.saved_path, 'predictions'), "best_sample_confidence.png")
|
265 |
+
|
266 |
+
# return view3d, confidence_img_path, cif_path
|
267 |
+
|
268 |
+
|
269 |
+
# logger = logging.getLogger(__name__)
|
270 |
+
# LOG_FORMAT = "%(asctime)s,%(msecs)-3d %(levelname)-8s [%(filename)s:%(lineno)s %(funcName)s] %(message)s"
|
271 |
+
# logging.basicConfig(
|
272 |
+
# format=LOG_FORMAT,
|
273 |
+
# level=logging.INFO,
|
274 |
+
# datefmt="%Y-%m-%d %H:%M:%S",
|
275 |
+
# filemode="w",
|
276 |
+
# )
|
277 |
+
# configs_base["use_deepspeed_evo_attention"] = (
|
278 |
+
# os.environ.get("USE_DEEPSPEED_EVO_ATTTENTION", False) == "False"
|
279 |
+
# )
|
280 |
+
# arg_str = "--seeds 101 --dump_dir ./output --input_json_path ./examples/example.json --model.N_cycle 10 --sample_diffusion.N_sample 5 --sample_diffusion.N_step 200 "
|
281 |
+
# configs = {**configs_base, **{"data": data_configs}, **inference_configs}
|
282 |
+
# configs = parse_configs(
|
283 |
+
# configs=configs,
|
284 |
+
# arg_str=arg_str,
|
285 |
+
# fill_required_with_null=True,
|
286 |
+
# )
|
287 |
+
# configs.load_checkpoint_path='./checkpoint.pt'
|
288 |
+
# download_infercence_cache()
|
289 |
+
# configs.use_deepspeed_evo_attention=False
|
290 |
+
|
291 |
+
# add_watermark = gr.Checkbox(label="Add Watermark", value=True)
|
292 |
+
# add_watermark1 = gr.Checkbox(label="Add Watermark", value=True)
|
293 |
+
|
294 |
+
|
295 |
+
# with gr.Blocks(title="FoldMark", css=custom_css) as demo:
|
296 |
+
# with gr.Row():
|
297 |
+
# # Use a Column to align the logo and title horizontally
|
298 |
+
# gr.Image(value="./assets/foldmark_head.png", elem_id="logo", label="Logo", height=150, show_label=False)
|
299 |
+
|
300 |
+
# with gr.Tab("Structure Predictor (JSON Upload)"):
|
301 |
+
# # First create the upload component
|
302 |
+
# json_upload = gr.File(label="Upload JSON", file_types=[".json"])
|
303 |
|
304 |
+
# # Then create the example component that references it
|
305 |
+
# gr.Examples(
|
306 |
+
# examples=[[EXAMPLE_PATH]],
|
307 |
+
# inputs=[json_upload],
|
308 |
+
# label="Click to use example JSON:",
|
309 |
+
# examples_per_page=1
|
310 |
+
# )
|
311 |
|
312 |
+
# # Rest of the components
|
313 |
+
# upload_name = gr.Textbox(label="Complex Name (optional)")
|
314 |
+
# upload_output = gr.JSON(label="Parsed Components")
|
315 |
|
316 |
+
# json_upload.upload(
|
317 |
+
# fn=lambda f: parse_json_input(json.load(open(f.name))),
|
318 |
+
# inputs=json_upload,
|
319 |
+
# outputs=upload_output
|
320 |
+
# )
|
321 |
+
|
322 |
+
# # Shared prediction components
|
323 |
+
# with gr.Row():
|
324 |
+
# add_watermark.render()
|
325 |
+
# submit_btn = gr.Button("Predict Structure", variant="primary")
|
326 |
+
# #structure_view = gr.HTML(label="3D Visualization")
|
327 |
+
|
328 |
+
# with gr.Row():
|
329 |
+
# view3d = Molecule3D(label="3D Visualization", reps=reps)
|
330 |
+
# legend = gr.Markdown("""
|
331 |
+
# **Color Legend:**
|
332 |
+
|
333 |
+
# - <span style="color:grey">Unwatermarked Structure</span>
|
334 |
+
# - <span style="color:cyan">Watermarked Structure</span>
|
335 |
+
# """)
|
336 |
+
# with gr.Row():
|
337 |
+
# cif_file = gr.File(label="Download CIF File")
|
338 |
+
# with gr.Row():
|
339 |
+
# confidence_plot_image = gr.Image(label="Confidence Measures")
|
340 |
|
341 |
+
# input_collector = gr.JSON(visible=False)
|
342 |
+
|
343 |
+
# # Map inputs to a dictionary
|
344 |
+
# submit_btn.click(
|
345 |
+
# fn=lambda j, w: {"json": j, "watermark": w},
|
346 |
+
# inputs=[json_upload, add_watermark],
|
347 |
+
# outputs=input_collector
|
348 |
+
# ).then(
|
349 |
+
# fn=predict_structure,
|
350 |
+
# inputs=input_collector,
|
351 |
+
# outputs=[view3d, confidence_plot_image, cif_file]
|
352 |
+
# )
|
353 |
+
|
354 |
+
# gr.Markdown("""
|
355 |
+
# The example of the uploaded json file for structure prediction.
|
356 |
+
# <pre>
|
357 |
+
# [{
|
358 |
+
# "sequences": [
|
359 |
+
# {
|
360 |
+
# "proteinChain": {
|
361 |
+
# "sequence": "MAEVIRSSAFWRSFPIFEEFDSETLCELSGIASYRKWSAGTVIFQRGDQGDYMIVVVSGRIKLSLFTPQGRELMLRQHEAGALFGEMALLDGQPRSADATAVTAAEGYVIGKKDFLALITQRPKTAEAVIRFLCAQLRDTTDRLETIALYDLNARVARFFLATLRQIHGSEMPQSANLRLTLSQTDIASILGASRPKVNRAILSLEESGAIKRADGIICCNVGRLLSIADPEEDLEHHHHHHHH",
|
362 |
+
# "count": 2
|
363 |
+
# }
|
364 |
+
# },
|
365 |
+
# {
|
366 |
+
# "dnaSequence": {
|
367 |
+
# "sequence": "CTAGGTAACATTACTCGCG",
|
368 |
+
# "count": 2
|
369 |
+
# }
|
370 |
+
# },
|
371 |
+
# {
|
372 |
+
# "dnaSequence": {
|
373 |
+
# "sequence": "GCGAGTAATGTTAC",
|
374 |
+
# "count": 2
|
375 |
+
# }
|
376 |
+
# },
|
377 |
+
# {
|
378 |
+
# "ligand": {
|
379 |
+
# "ligand": "CCD_PCG",
|
380 |
+
# "count": 2
|
381 |
+
# }
|
382 |
+
# }
|
383 |
+
# ],
|
384 |
+
# "name": "7pzb"
|
385 |
+
# }]
|
386 |
+
# </pre>
|
387 |
+
# """)
|
388 |
|
389 |
+
# with gr.Tab("Structure Predictor (Manual Input)"):
|
390 |
+
# with gr.Row():
|
391 |
+
# complex_name = gr.Textbox(label="Complex Name")
|
392 |
|
393 |
+
# # Replace gr.Group with gr.Accordion
|
394 |
+
# with gr.Accordion(label="Protein Chains", open=True):
|
395 |
+
# protein_chains = gr.Dataframe(
|
396 |
+
# headers=["Sequence", "Count"],
|
397 |
+
# datatype=["str", "number"],
|
398 |
+
# row_count=1,
|
399 |
+
# col_count=(2, "fixed")
|
400 |
+
# )
|
401 |
|
402 |
+
# # Repeat for other groups
|
403 |
+
# with gr.Accordion(label="DNA Sequences", open=True):
|
404 |
+
# dna_sequences = gr.Dataframe(
|
405 |
+
# headers=["Sequence", "Count"],
|
406 |
+
# datatype=["str", "number"],
|
407 |
+
# row_count=1
|
408 |
+
# )
|
409 |
|
410 |
+
# with gr.Accordion(label="Ligands", open=True):
|
411 |
+
# ligands = gr.Dataframe(
|
412 |
+
# headers=["Ligand Type", "Count"],
|
413 |
+
# datatype=["str", "number"],
|
414 |
+
# row_count=1
|
415 |
+
# )
|
416 |
|
417 |
+
# manual_output = gr.JSON(label="Generated JSON")
|
418 |
|
419 |
+
# complex_name.change(
|
420 |
+
# fn=lambda x: {"complex_name": x},
|
421 |
+
# inputs=complex_name,
|
422 |
+
# outputs=manual_output
|
423 |
+
# )
|
424 |
+
|
425 |
+
# # Shared prediction components
|
426 |
+
# with gr.Row():
|
427 |
+
# add_watermark1.render()
|
428 |
+
# submit_btn = gr.Button("Predict Structure", variant="primary")
|
429 |
+
# #structure_view = gr.HTML(label="3D Visualization")
|
430 |
+
|
431 |
+
# with gr.Row():
|
432 |
+
# view3d = Molecule3D(label="3D Visualization (Gray: Unwatermarked; Cyan: Watermarked)", reps=reps)
|
433 |
+
|
434 |
+
# with gr.Row():
|
435 |
+
# cif_file = gr.File(label="Download CIF File")
|
436 |
+
# with gr.Row():
|
437 |
+
# confidence_plot_image = gr.Image(label="Confidence Measures")
|
438 |
|
439 |
+
# input_collector = gr.JSON(visible=False)
|
440 |
+
|
441 |
+
# # Map inputs to a dictionary
|
442 |
+
# submit_btn.click(
|
443 |
+
# fn=lambda c, p, d, l, w: {"data": {"complex_name": c, "protein_chains": p, "dna_sequences": d, "ligands": l}, "watermark": w},
|
444 |
+
# inputs=[complex_name, protein_chains, dna_sequences, ligands, add_watermark1],
|
445 |
+
# outputs=input_collector
|
446 |
+
# ).then(
|
447 |
+
# fn=predict_structure,
|
448 |
+
# inputs=input_collector,
|
449 |
+
# outputs=[view3d, confidence_plot_image, cif_file]
|
450 |
+
# )
|
451 |
+
|
452 |
+
# @spaces.GPU(duration=120)
|
453 |
+
# def is_watermarked(file):
|
454 |
+
# #first initialize runner
|
455 |
+
# runner = InferenceRunner(configs)
|
456 |
+
# # Generate a unique subdirectory and filename
|
457 |
+
# unique_id = str(uuid.uuid4().hex[:8])
|
458 |
+
# subdir = os.path.join('./output', unique_id)
|
459 |
+
# os.makedirs(subdir, exist_ok=True)
|
460 |
+
# filename = f"{unique_id}.cif"
|
461 |
+
# file_path = os.path.join(subdir, filename)
|
462 |
|
463 |
+
# # Save the uploaded file to the new location
|
464 |
+
# shutil.copy(file.name, file_path)
|
465 |
|
466 |
+
# # Call your processing functions
|
467 |
+
# configs.process_success = process_data(subdir)
|
468 |
+
# configs.subdir = subdir
|
469 |
+
# result = infer_detect(runner, configs)
|
470 |
+
# # This function should return 'Watermarked' or 'Not Watermarked'
|
471 |
+
# temp_pdb_path = convert_cif_to_pdb(file_path)
|
472 |
+
# if result==False:
|
473 |
+
# return "Not Watermarked", temp_pdb_path
|
474 |
+
# else:
|
475 |
+
# return "Watermarked", temp_pdb_path
|
476 |
|
477 |
|
478 |
|
479 |
+
# with gr.Tab("Watermark Detector"):
|
480 |
+
# # First create the upload component
|
481 |
+
# cif_upload = gr.File(label="Upload .cif", file_types=["..cif"])
|
482 |
|
483 |
+
# with gr.Row():
|
484 |
+
# cif_3d_view = Molecule3D(label="3D Visualization of Input", reps=reps)
|
485 |
|
486 |
+
# # Prediction output
|
487 |
+
# prediction_output = gr.Textbox(label="Prediction")
|
488 |
|
489 |
+
# # Define the interaction
|
490 |
+
# cif_upload.change(is_watermarked, inputs=cif_upload, outputs=[prediction_output, cif_3d_view])
|
491 |
|
492 |
+
# # Example files
|
493 |
+
# example_files = [
|
494 |
+
# "./examples/7r6r_watermarked.cif",
|
495 |
+
# "./examples/7pzb_unwatermarked.cif"
|
496 |
+
# ]
|
497 |
|
498 |
+
# gr.Examples(examples=example_files, inputs=cif_upload)
|
499 |
|
500 |
|
501 |
|
502 |
|
503 |
|
504 |
|
505 |
+
# if __name__ == "__main__":
|
506 |
+
# demo.launch(share=True)
|