aakash0017's picture
Upload folder using huggingface_hub
b7731cd
# Copyright 2006-2017,2020 by Peter Cock. All rights reserved.
#
# This file is part of the Biopython distribution and governed by your
# choice of the "Biopython License Agreement" or the "BSD 3-Clause License".
# Please see the LICENSE file that should have been included as part of this
# package.
#
# This module is for reading and writing FASTA format files as SeqRecord
# objects. The code is partly inspired by earlier Biopython modules,
# Bio.Fasta.* and the now removed module Bio.SeqIO.FASTA
"""Bio.SeqIO support for the "fasta" (aka FastA or Pearson) file format.
You are expected to use this module via the Bio.SeqIO functions.
"""
import warnings
from Bio import BiopythonDeprecationWarning
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from .Interfaces import _clean
from .Interfaces import _get_seq_string
from .Interfaces import SequenceIterator
from .Interfaces import SequenceWriter
def SimpleFastaParser(handle):
"""Iterate over Fasta records as string tuples.
Arguments:
- handle - input stream opened in text mode
For each record a tuple of two strings is returned, the FASTA title
line (without the leading '>' character), and the sequence (with any
whitespace removed). The title line is not divided up into an
identifier (the first word) and comment or description.
>>> with open("Fasta/dups.fasta") as handle:
... for values in SimpleFastaParser(handle):
... print(values)
...
('alpha', 'ACGTA')
('beta', 'CGTC')
('gamma', 'CCGCC')
('alpha (again - this is a duplicate entry to test the indexing code)', 'ACGTA')
('delta', 'CGCGC')
"""
# Skip any text before the first record (e.g. blank lines, comments)
for line in handle:
if line[0] == ">":
title = line[1:].rstrip()
break
else:
# no break encountered - probably an empty file
return
# Main logic
# Note, remove trailing whitespace, and any internal spaces
# (and any embedded \r which are possible in mangled files
# when not opened in universal read lines mode)
lines = []
for line in handle:
if line[0] == ">":
yield title, "".join(lines).replace(" ", "").replace("\r", "")
lines = []
title = line[1:].rstrip()
continue
lines.append(line.rstrip())
yield title, "".join(lines).replace(" ", "").replace("\r", "")
def FastaTwoLineParser(handle):
"""Iterate over no-wrapping Fasta records as string tuples.
Arguments:
- handle - input stream opened in text mode
Functionally the same as SimpleFastaParser but with a strict
interpretation of the FASTA format as exactly two lines per
record, the greater-than-sign identifier with description,
and the sequence with no line wrapping.
Any line wrapping will raise an exception, as will excess blank
lines (other than the special case of a zero-length sequence
as the second line of a record).
Examples
--------
This file uses two lines per FASTA record:
>>> with open("Fasta/aster_no_wrap.pro") as handle:
... for title, seq in FastaTwoLineParser(handle):
... print("%s = %s..." % (title, seq[:3]))
...
gi|3298468|dbj|BAA31520.1| SAMIPF = GGH...
This equivalent file uses line wrapping:
>>> with open("Fasta/aster.pro") as handle:
... for title, seq in FastaTwoLineParser(handle):
... print("%s = %s..." % (title, seq[:3]))
...
Traceback (most recent call last):
...
ValueError: Expected FASTA record starting with '>' character. Perhaps this file is using FASTA line wrapping? Got: 'MTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANI'
"""
idx = -1 # for empty file
for idx, line in enumerate(handle):
if idx % 2 == 0: # title line
if line[0] != ">":
raise ValueError(
"Expected FASTA record starting with '>' character. "
"Perhaps this file is using FASTA line wrapping? "
f"Got: '{line}'"
)
title = line[1:].rstrip()
else: # sequence line
if line[0] == ">":
raise ValueError(
"Two '>' FASTA lines in a row. Missing sequence line "
"if this is strict two-line-per-record FASTA format. "
f"Have '>{title}' and '{line}'"
)
yield title, line.strip()
if idx == -1:
pass # empty file
elif idx % 2 == 0: # on a title line
raise ValueError(
"Missing sequence line at end of file if this is strict "
f"two-line-per-record FASTA format. Have title line '{line}'"
)
else:
assert line[0] != ">", "line[0] == '>' ; this should be impossible!"
class FastaIterator(SequenceIterator):
"""Parser for Fasta files."""
def __init__(self, source, alphabet=None, title2ids=None):
"""Iterate over Fasta records as SeqRecord objects.
Arguments:
- source - input stream opened in text mode, or a path to a file
- alphabet - optional alphabet, not used. Leave as None.
- title2ids (DEPRECATED) - A function that, when given the title of
the FASTA file (without the beginning >), will return the id, name
and description (in that order) for the record as a tuple of strings.
If this is not given, then the entire title line will be used
as the description, and the first word as the id and name.
By default this will act like calling Bio.SeqIO.parse(handle, "fasta")
with no custom handling of the title lines:
>>> with open("Fasta/dups.fasta") as handle:
... for record in FastaIterator(handle):
... print(record.id)
...
alpha
beta
gamma
alpha
delta
However, you can supply a title2ids function to alter this (DEPRECATED):
>>> def take_upper(title):
... return title.split(None, 1)[0].upper(), "", title
>>> with open("Fasta/dups.fasta") as handle:
... for record in FastaIterator(handle, title2ids=take_upper):
... print(record.id)
...
ALPHA
BETA
GAMMA
ALPHA
DELTA
Instead of title2ids, please use a generator function to modify the
records:
>>> def modify_records(records):
... for record in records:
... record.id = record.id.upper()
... yield record
...
>>> with open('Fasta/dups.fasta') as handle:
... for record in modify_records(FastaIterator(handle)):
... print(record.id)
...
ALPHA
BETA
GAMMA
ALPHA
DELTA
"""
if alphabet is not None:
raise ValueError("The alphabet argument is no longer supported")
if title2ids is not None:
warnings.warn(
"The title2ids argument is deprecated. Instead, please use a "
"generator function to modify records returned by the parser. "
"For example, to change the record IDs to uppercase, and "
"delete the description attribute, use\n"
"\n"
">>> def modify_records(records):\n"
"... for record in records:\n"
"... record.id = record.id.upper()\n"
"... del record.description\n"
"... yield record\n"
"...\n"
">>> with open('Fasta/dups.fasta') as handle:\n"
"... for record in modify_records(FastaIterator(handle)):\n"
"... print(record)\n"
"\n",
BiopythonDeprecationWarning,
)
self.title2ids = title2ids
super().__init__(source, mode="t", fmt="Fasta")
def parse(self, handle):
"""Start parsing the file, and return a SeqRecord generator."""
records = self.iterate(handle)
return records
def iterate(self, handle):
"""Parse the file and generate SeqRecord objects."""
title2ids = self.title2ids
if title2ids:
for title, sequence in SimpleFastaParser(handle):
id, name, descr = title2ids(title)
yield SeqRecord(Seq(sequence), id=id, name=name, description=descr)
else:
for title, sequence in SimpleFastaParser(handle):
try:
first_word = title.split(None, 1)[0]
except IndexError:
assert not title, repr(title)
# Should we use SeqRecord default for no ID?
first_word = ""
yield SeqRecord(
Seq(sequence), id=first_word, name=first_word, description=title
)
class FastaTwoLineIterator(SequenceIterator):
"""Parser for Fasta files with exactly two lines per record."""
def __init__(self, source):
"""Iterate over two-line Fasta records (as SeqRecord objects).
Arguments:
- source - input stream opened in text mode, or a path to a file
This uses a strict interpretation of the FASTA as requiring
exactly two lines per record (no line wrapping).
Only the default title to ID/name/description parsing offered
by the relaxed FASTA parser is offered.
"""
super().__init__(source, mode="t", fmt="FASTA")
def parse(self, handle):
"""Start parsing the file, and return a SeqRecord generator."""
records = self.iterate(handle)
return records
def iterate(self, handle):
"""Parse the file and generate SeqRecord objects."""
for title, sequence in FastaTwoLineParser(handle):
try:
first_word = title.split(None, 1)[0]
except IndexError:
assert not title, repr(title)
# Should we use SeqRecord default for no ID?
first_word = ""
yield SeqRecord(
Seq(sequence), id=first_word, name=first_word, description=title
)
class FastaWriter(SequenceWriter):
"""Class to write Fasta format files (OBSOLETE).
Please use the ``as_fasta`` function instead, or the top level
``Bio.SeqIO.write()`` function instead using ``format="fasta"``.
"""
def __init__(self, target, wrap=60, record2title=None):
"""Create a Fasta writer (OBSOLETE).
Arguments:
- target - Output stream opened in text mode, or a path to a file.
- wrap - Optional line length used to wrap sequence lines.
Defaults to wrapping the sequence at 60 characters
Use zero (or None) for no wrapping, giving a single
long line for the sequence.
- record2title - Optional function to return the text to be
used for the title line of each record. By default
a combination of the record.id and record.description
is used. If the record.description starts with the
record.id, then just the record.description is used.
You can either use::
handle = open(filename, "w")
writer = FastaWriter(handle)
writer.write_file(myRecords)
handle.close()
Or, follow the sequential file writer system, for example::
handle = open(filename, "w")
writer = FastaWriter(handle)
writer.write_header() # does nothing for Fasta files
...
Multiple writer.write_record() and/or writer.write_records() calls
...
writer.write_footer() # does nothing for Fasta files
handle.close()
"""
super().__init__(target)
if wrap:
if wrap < 1:
raise ValueError
self.wrap = wrap
self.record2title = record2title
def write_record(self, record):
"""Write a single Fasta record to the file."""
if self.record2title:
title = self.clean(self.record2title(record))
else:
id = self.clean(record.id)
description = self.clean(record.description)
if description and description.split(None, 1)[0] == id:
# The description includes the id at the start
title = description
elif description:
title = f"{id} {description}"
else:
title = id
assert "\n" not in title
assert "\r" not in title
self.handle.write(f">{title}\n")
data = _get_seq_string(record) # Catches sequence being None
assert "\n" not in data
assert "\r" not in data
if self.wrap:
for i in range(0, len(data), self.wrap):
self.handle.write(data[i : i + self.wrap] + "\n")
else:
self.handle.write(data + "\n")
class FastaTwoLineWriter(FastaWriter):
"""Class to write 2-line per record Fasta format files (OBSOLETE).
This means we write the sequence information without line
wrapping, and will always write a blank line for an empty
sequence.
Please use the ``as_fasta_2line`` function instead, or the top level
``Bio.SeqIO.write()`` function instead using ``format="fasta"``.
"""
def __init__(self, handle, record2title=None):
"""Create a 2-line per record Fasta writer (OBSOLETE).
Arguments:
- handle - Handle to an output file, e.g. as returned
by open(filename, "w")
- record2title - Optional function to return the text to be
used for the title line of each record. By default
a combination of the record.id and record.description
is used. If the record.description starts with the
record.id, then just the record.description is used.
You can either use::
handle = open(filename, "w")
writer = FastaWriter(handle)
writer.write_file(myRecords)
handle.close()
Or, follow the sequential file writer system, for example::
handle = open(filename, "w")
writer = FastaWriter(handle)
writer.write_header() # does nothing for Fasta files
...
Multiple writer.write_record() and/or writer.write_records() calls
...
writer.write_footer() # does nothing for Fasta files
handle.close()
"""
super().__init__(handle, wrap=None, record2title=record2title)
def as_fasta(record):
"""Turn a SeqRecord into a FASTA formatted string.
This is used internally by the SeqRecord's .format("fasta")
method and by the SeqIO.write(..., ..., "fasta") function.
"""
id = _clean(record.id)
description = _clean(record.description)
if description and description.split(None, 1)[0] == id:
# The description includes the id at the start
title = description
elif description:
title = f"{id} {description}"
else:
title = id
assert "\n" not in title
assert "\r" not in title
lines = [f">{title}\n"]
data = _get_seq_string(record) # Catches sequence being None
assert "\n" not in data
assert "\r" not in data
for i in range(0, len(data), 60):
lines.append(data[i : i + 60] + "\n")
return "".join(lines)
def as_fasta_2line(record):
"""Turn a SeqRecord into a two-line FASTA formatted string.
This is used internally by the SeqRecord's .format("fasta-2line")
method and by the SeqIO.write(..., ..., "fasta-2line") function.
"""
id = _clean(record.id)
description = _clean(record.description)
if description and description.split(None, 1)[0] == id:
# The description includes the id at the start
title = description
elif description:
title = f"{id} {description}"
else:
title = id
assert "\n" not in title
assert "\r" not in title
data = _get_seq_string(record) # Catches sequence being None
assert "\n" not in data
assert "\r" not in data
return f">{title}\n{data}\n"
if __name__ == "__main__":
from Bio._utils import run_doctest
run_doctest(verbose=0)