repo_name
stringlengths 4
136
| issue_id
stringlengths 5
10
| text
stringlengths 37
4.84M
|
|---|---|---|
roy-lei/cpp-experiment | 1179513991 | Title: test
Question:
username_0: ### test
**attention!** _this is a test_
`#include<iostream>
using namespace std;
int main()
{
cout << "this is a test" << endl;
return 0;
}
`
[http://www.baidu.com](url) this is a url
Answers:
username_0: _let's just leave a comment_
username_0: **this is another test for the** _reply_ **function**
Status: Issue closed
|
AbirRazzak/event-request-bot | 426252049 | Title: As an end-user, I would like my user config saved
Question:
username_0: Should probably save user config locally so things like org ID, username, and phone number are saved and don't have to be typed in over and over again.
Answers:
username_0: Probably use JSON since it's easier to read from the user standpoint, should they need to go in and manually make some changes if need be. |
jlengstorf/netlify-plugin-gatsby-cache | 590362121 | Title: Issue when caching the whole repository
Question:
username_0: This plugin caches `PUBLISH_DIR` (renamed from `BUILD_DIR`) which is the "Publish directory" set in the UI or in the configuration file (`build.publish`). When unset, this defaults to the "build directory", which is (in most cases) the repository root directory.
However caching (and restoring) the whole repository has several issues:
- It caches many directories that are not related to Gatsby but take lots of space, such as `node_modules`. Those should either not be cached or be cached separately from this plugin.
- It caches directories that are not meant to restored across builds. For example `.git` (beside being big) is being restored by this plugin, which should not be the case.
- It undoes any build operations inside the repository that might have happened before this plugin starts restoring the cache, leading to conflicts with other plugins, Netlify Build or the buildbot.
In short, caching the whole repository does not seem to be a viable option.
Please note that this is only an issue when no "Publish directory" was set. When one is set, caching it and restoring it should just work.
When no "Publish directory" is set, is there any specific files or directories that we could cache instead to avoid the issues described above?
Answers:
username_1: how does a Gatsby site publish properly if the directory isn't set to `public`? wouldn't that fail?
Gatsby doesn't let you change the name of `public`, so we could do something like
```
const dirToCache = constanst.PUBLISH_DIR === 'public' ? constants.PUBLISH_DIR : path.join(constants.PUBLISH_DIR, 'public');
```
but I'm confused how a site would deploy at all without specifying where the files to deploy are?
username_0: When no "Publish directory" is specified, Netlify (with or without the Netlify Build beta) defaults to the "build directory" which (in most cases) is the repository root directory.
I am not sure whether our infrastructure defaults the "Publish directory" to `publish` when we detect Gatsby is used, I am going to check on this.
About Gatsby:
- Can you confirm the build directory is always called `public`?
- Is this `public` directory relative to `$PWD`, to the package root directory (first parent with a `package.json`) or to the repository root (first parent with a `.git` directory)?
- Could we just cache this `public` directory?
username_1: - the build directory is always called `public`
- the `public` directory is always at the root of the site, but that can be in a monorepo (e.g. at root, or at `packages/site/` or whatever)
- we have to cache both `public` and `.cache`
username_0: Thanks @username_1!
Monorepos are supported through the use of the "Base directory" UI setting (or `build.base` in `netlify.toml`). Then this is set, the plugin's current directory will be `packages/site/` (for example). Otherwise the repository root will be the plugin's current directory.
I.e. to fix this issue, we should cache `./public` and `./.cache`.
username_0: Edit: `PUBLISH_DIR` should actually work providing it is correctly set. If not correctly set, deploys will fail, so we decided to still use that constant, which means the current value is correct.
I.e. the problem is not coming from the question described above. I am doing more investigating now.
username_0: After investigating, it seems that everything is good with `netlify-plugin-gatsby-cache` :+1:
More details [here](https://github.com/netlify/build/issues/1069).
Status: Issue closed
username_2: I think `./public` and `./.cache` would be good defaults.
username_1: @username_2 I don't think the site can deploy unless `publish` is set to `public`, though, right? because otherwise you'd be deploying all the source files? let me know if your setup was different
username_2: You can set the publish directory either from Netlify's deploy settings UI or via `netlify.toml`. I had been using the former which, I think, this plugin can't easily access.
username_0: Yes @username_1 is correct. `netlify-plugin-gatsby-cache` assumes that the publish directory is set to `public`.
This is done automatically by Netlify using deploy settings UI when you start a new Site and Gatsby is detected. It can also be done manually using `build.publish` in your `netlify.toml` as you mention @username_2.
Build plugins do have access to the publish directory using `constants.PUBLISH_DIR`, which is what this plugin is using.
Based on this, the error message you saw above indicates that your publish directory was not set to `public` which is a requirement for Netlify to deploy it correctly.
username_0: Yes @username_1 is correct. `netlify-plugin-gatsby-cache` assumes that the publish directory is set to `public`.
This is done automatically by Netlify using deploy settings UI when you start a new Site and Gatsby is detected. It can also be done manually using `build.publish` in your `netlify.toml` as you mention @username_2.
Build plugins do have access to the publish directory using `constants.PUBLISH_DIR`, which is what this plugin is using.
Based on this, the error message you saw above indicates that your publish directory was not set to `public` which is a requirement for Netlify to deploy it correctly. |
tokno/vending-machine-react-electron | 146596835 | Title: Getting more done in GitHub with ZenHub
Question:
username_0: Hola! @username_0 has created a [ZenHub](http://www.zenhub.io) account for the **tokno** organization. ZenHub is the leading team collaboration and project management solution built for GitHub.
----
#### How do I use ZenHub?
To get set up with ZenHub, all you have to do is **[download the browser extension](https://www.zenhub.io?utm_source=ZHOnboarding)** and log in with your GitHub account. Once you do, you’ll get access to ZenHub’s complete feature-set immediately.
#### What can ZenHub do?
ZenHub adds a series of enhancements directly inside the GitHub UI:
- Real-time, customizable task boards for GitHub issues;
- Burndown charts, estimates, and velocity tracking based on GitHub Milestones;
- Personal to-do lists and task prioritization;
- “+1” button for GitHub issues and comments;
- Drag-and-drop file sharing;
- Time-saving shortcuts like a quick repo switcher.
### [Add ZenHub to GitHub](https://www.zenhub.io?utm_source=ZHOnboarding)
_Still curious? See [more ZenHub features](https://www.zenhub.io/features?utm_source=ZHOnboarding) or read [user reviews](https://chrome.google.com/webstore/detail/zenhub-for-github/ogcgkffhplmphkaahpmffcafajaocjbd/reviews). This issue was written by your friendly ZenHub bot, posted by request from @username_0._
 |
NYCPlanning/labs-applicantmaps | 413460752 | Title: Users want map zoom levels to reflect their area of interest
Question:
username_0: - [ ] When searching for an address or BBL, users want the map to zoom in closer to that location.
- [ ] When editing underlying zoning boundaries, the map starts out too zoomed in for them to see enough context. It should default to a lower zoom number.
Answers:
username_1: The first checkbox sounds like just make the zoom closer? Same with the second, just not as zoomed in
username_2: @username_0 @username_1 for the second ask: does this mean the circle we draw around the project area should also be increased? Or should we just zoom to something that fits inside that circle?
Status: Issue closed
|
EdenServer/community | 467180343 | Title: When losing target during WS mob plays odd animations
Question:
username_0: ### Checklist
<!--
Don't edit or delete this section, but tick the boxes after you have submitted your issue.
If there are unticked boxes a developer may not address the issue.
Make sure you comply with the checklist and then start writing in the details section below.
-->
- [x] I have searched for existing issues for issues like this one. The issue has not been posted. (Duplicate reports slow down development.)
- [x] I have provided reproducable steps. (No "as the title says" posts please. Provide reproducable steps even if it seems like a waste of time.)
- [ ] I have provided my client version in the details. (type /ver into your game window)
### Details
Developers - upon next patch you can test this out on a mob by using `!mobskill 723` while out of range (40.0).
The problem code is in `mobentity.cpp`
```cpp
if (!PTarget || targets == 0)
{
action.actiontype = ACTION_MOBABILITY_INTERRUPT;
actionList_t& actionList = action.getNewActionList();
actionList.ActionTargetID = id;
actionTarget_t& actionTarget = actionList.getNewActionTarget();
actionTarget.animation = PSkill->getID();
return;
}
``` |
Lee-Park-Bae-Project/KAKIOTALK | 614074346 | Title: 데이터베이스 관계 수정 (chat - room_participants)
Question:
username_0: @username_1 @brillante06
지금 chat table 에서 room_id, sender_id가 room_participants 의 user_id, room_id를 foreign key로 가지고 있는데
생각해보니 room_participants 의 foreign key 를 chat의 foreign key 로 가지고 있는게 이상해서요
지금 특정 방의 chat 들을 모두 가져오기 위해서는 chat.findAll(incluse: {model: User}) 같은 식으로 쿼리를 작성해야 하는데 이 쿼리 모습은 chat 이 user 와 관계를 맺고 있는 것이거든요?
이중으로 외래키 조건을 걸려면 chat table 에서 room_participants 를 가지고 있는 foreign key 하나 가지고 있는게 맞지 않을까요?
chat.room_participants_id 가 room_pariticipants 의 id 를 foreign key 로 가지고 있는 형태죠
그래서 sequelize 로 데이터를 가져올 때 chat 의 room_participants_id 를 include 하고 그 안에서 user_id, room_id 를 가져오는게 좀더 맞는 관계 설정인것 같습니다.
Answers:
username_1: 잘 이해했습니다. chat-room_participants-user를 이중으로 연결할 외래키를 갖는 것이 필요하다는 말씀이군요
username_0: 넹,
chat.room_participants_id 가 추가될거고
chat.sender_id, chat.room_id 는 삭제하면 될것 같습니다.
username_0: 수정되었습니다.
Status: Issue closed
|
home-assistant/core | 1141120832 | Title: After latest update Life360 error logs
Question:
username_0: ### The problem
After latest update now getting Life360 errors never had any issues or logs before
Logger: homeassistant.components.life360.device_tracker
Source: components/life360/device_tracker.py:176
Integration: Life360 (documentation, issues)
First occurred: 09:19:51 (1 occurrences)
Last logged: 09:19:51
get_circle_members "User Name": CommError: 400 Client Error: Bad Request for url: https://api.life360.com/v3/circles/019124cd-b300-489c-8a8c-2a8c2d76c814/members
### What version of Home Assistant Core has the issue?
## System Health version | core-2022.2.8 -- | -- installation_type | Home Assistant OS dev | false hassio | true docker | true user | root virtualenv | false python_version | 3.9.7 os_name | Linux os_version | 5.10.98 arch | x86_64 timezone | Europe/London <details><summary>Home Assistant Community Store</summary> GitHub API | ok -- | -- Github API Calls Remaining | 5000 Installed Version | 1.22.0 Stage | running Available Repositories | 977 Downloaded Repositories | 25 </details> <details><summary>Home Assistant Cloud</summary> logged_in | false -- | -- can_reach_cert_server | ok can_reach_cloud_auth | ok can_reach_cloud | ok </details> <details><summary>Home Assistant Supervisor</summary> host_os | Home Assistant OS 7.4 -- | -- update_channel | stable supervisor_version | supervisor-2022.01.1 docker_version | 20.10.9 disk_total | 30.8 GB disk_used | 16.3 GB healthy | true supported | true board | ova supervisor_api | ok version_api | ok installed_addons | Samba share (9.5.1), Check Home Assistant configuration (3.10.0), SSH & Web Terminal (10.0.2), Home Assistant Google Drive Backup (0.105.2), Studio Code Server (4.1.0), MariaDB (2.4.0), InfluxDB (4.3.0), Grafana (7.4.1), Mosquitto broker (6.0.1) </details> <details><summary>Lovelace</summary> dashboards | 3 -- | -- resources | 16 views | 75 mode | storage </details>
### What was the last working version of Home Assistant Core?
Last before this one
### What type of installation are you running?
Home Assistant Core
### Integration causing the issue
Life360
### Link to integration documentation on our website
https://www.home-assistant.io/integrations/life360
### Diagnostics information
Not avaiabe for this
### Example YAML snippet
_No response_
### Anything in the logs that might be useful for us?
```txt
Nothing in main log
```
### Additional information
_No response_
Answers:
username_1: I just tested with the latest dev version (2022.3.0.dev0), and it seems to work fine.
I haven't seen this problem myself, and I've only heard of it happening a few times. I was never able to get to the bottom of it. For some history, see https://community.home-assistant.io/t/life360-get-circle-members-commerror-400/167733.
username_2: @username_1 I am also seeing the issue.
```
get_circle_members "XYZ Family": CommError: 400 Client Error: Bad Request for url: https://api.life360.com/v3/circles/XYZ-d303-4c62-b430-b5ea351e505f/members
```
username_3: I also have same error since 2022.2.8, today after updating to 2022.2.9 it happened 5 times in first 4 hours and than error stopped now for a while. I think it will comeback, meanwhile I rebooted my phone and check the app on the phone, if the error do not occur anymore I will report back.
```txt
Logger: homeassistant.components.life360.device_tracker
Source: components/life360/device_tracker.py:176
Integration: Life360 ([documentation](https://www.home-assistant.io/integrations/life360), [issues](https://github.com/home-assistant/home-assistant/issues?q=is%3Aissue+is%3Aopen+label%3A%22integration%3A+life360%22))
First occurred: 19 februari 2022 15:18:07 (5 occurrences)
Last logged: 19 februari 2022 19:31:33
get_circle_members "User Group": CommError: 400 Client Error: Bad Request for url: https://api.life360.com/v3/circles/63c04933-ebua-8882-ad0d-712b1b235ef0/members
```
username_2: I am seeing the same. I checked all my devices and they are all connected to life360.
username_1: Hi all. Remember, the Life360 Server API is not documented and is unsupported. There's no official way to find out why this happens or what to do about it. As I said, I've never experienced it, and although others have from time to time, it doesn't seem to be a huge, consistent problem for the vast majority of users.
If anyone does discover any cause-and-effect relationship, by all means, let me know. If there's something that can be done about it, even if it's just a note in the documentation, I'd be happy to work on it.
username_0: The errors seem to be adding
Logger: homeassistant.components.life360.device_tracker
Source: components/life360/device_tracker.py:176
Integration: Life360 (documentation, issues)
First occurred: 12:52:06 (4 occurrences)
Last logged: 12:59:42
get_circles: CommError: HTTPSConnectionPool(host='api.life360.com', port=443): Max retries exceeded with url: /v3/circles.json (Caused by ReadTimeoutError("HTTPSConnectionPool(host='api.life360.com', port=443): Read timed out. (read timeout=3.05)"))
Suppressing further errors until OK: get_circles: CommError: HTTPSConnectionPool(host='api.life360.com', port=443): Max retries exceeded with url: /v3/circles.json (Caused by ReadTimeoutError("HTTPSConnectionPool(host='api.life360.com', port=443): Read timed out. (read timeout=3.05)"))
ALSO
Logger: homeassistant.components.life360.device_tracker
Source: components/life360/device_tracker.py:165
Integration: Life360 (documentation, issues)
First occurred: 12:57:52 (2 occurrences)
Last logged: 12:59:53
get_circles: OK again
username_1: @username_0 that just means your system was having network problems trying to communicate with the Life360 server. Since it constantly polls the server, it only shows a limited number of errors. Once it's able to communicate successfully with the server again, it outputs the "OK again" message (which is classified as an "error", only to make sure that it shows up in the log.) This is by design and was implemented long before HA's logging system started coalescing error messages. It's not terribly uncommon for this to happen, especially if you're having Internet issues. (You'll notice the problems persisted for about 8 minutes.) If you're using any other cloud-based services, I wouldn't be surprised if you saw other such errors in your log around the same time.
username_4: I updated yesterday from 2021.12.10 to version 2022.2.9 and also experienced issues with Life360.
Restored from backup today and all is well again
username_1: @username_4 exactly what issues did you experience? Can you provide error messages / log details? If at all possible (and this goes for anyone reporting Life360 issues), please set `logger` level to `debug` for `life360` and `homeassistant.components.life360`, then copy & paste Life360 related messages from home-assitant.log.
username_0: I no longer see it on latest release not sure it its Life360 new app release ios or HA latest version!!!!
username_0: Where do i find this i have debug on life360 but no idea where to find this
username_1: @username_0, does it ever work (i.e., do you get some updates for members in this circle), or does it constantly get errors and never work? If the errors are intermittent, how often does this happen? E.g., every once in a while, almost all the time, more on some days than others? Have you made any changes to the membership of the circle? Are you the owner of the circle?
FWIW, in order to be able to see this error (i.e., while attempting to retrieve the members of the circle) Home Assistant must have already successfully communicated to the Life360 server (to login, to get the list of circles, etc.) So, this seems to be more associated with permission problems than pure networking/communication issues.
Again, since this is an undocumented / unsupported interface, it's very difficult for me to have any idea what to do about this. I just know there are hundreds of users that don't see it, and for those that do, it's either intermittent, or seems to somehow be associated with who the circle owner is or visibility settings on individual circle members.
username_0: Hi it seems to work most of the time. I installed years ago and never changed a thing. I am owner of circle and only two in the family.
The errors are random i only have 2 entries in known.device.yaml i have no code in the config.yml So i am unable to get any debug info
username_1: I just did a bit of internet searching for common causes of HTML Error 400. Most of the causes don't seem to apply, but one might. Specifically, a corrupted DNS cache could cause this. So, one suggestion, when seeing this error, is to clear the Operating System's DNS cache. If you're running Home Assistant on Ubuntu Linux, it can be accomplished by running the following command in a terminal window:
`sudo systemd-resolve --flush-caches`
username_0: I have HA on Unraid running from a linux VM
username_1: Well, I'm not familiar with that. The point is, flush the DNS cache that HA is (indirectly) using. I guess you'll have to figure out how to do that on your system if you want to see if this solves your problem. Although, it seems your problem somehow solves itself after a while. You've got to wonder why it comes back again later. I don't know if this is ultimately causing the intermittent errors on your system. It was just an idea of maybe how to narrow it down.
I'm not sure there's much else I can do. I'll let you decide whether or not to leave this issue open.
username_0: close it i will re open if anything new comes back or open a new one
username_0: what version you got i have not seen any recent releases in HA
Status: Issue closed
username_1: Once again, these "CommError: 400 Client Error: Bad Request for url: ..." errors seem to come and go, but no easy way to know why. Latest idea is that it could be related to out-of-date DNS cache entries. If this is the case, theoretically flushing the OS's DNS cache could solve the problem. However, it seems, after a while, the errors just go away by themselves (maybe after the out-of-date DNS cache entries get replaced in the normal course of operation???)
For now, closing the incident because it does not seem to happen very often, and so far, there doesn't appear to be anything that can be done about it. |
department-of-veterans-affairs/va.gov-team | 960714930 | Title: Create Copay Balance Card Component
Question:
username_0: ## Issue Description
Create a copay balance card component as shown in the [mocks](https://preview.uxpin.com/16e8675a9898914d5615d6ea2d23e310b7d8dfaa#/pages/140669280/simulate/sitemap?mode=i)
---
## Tasks
- [ ] Create a copay balance card component
## Acceptance Criteria
- [ ] Copay balance card component should render according to mocks
---
## How to configure this issue
- [ ] **Attached to a Milestone** (when will this be completed?)
- [ ] **Attached to an Epic** (what body of work is this a part of?)
- [ ] **Labeled with Team** (`product support`, `analytics-insights`, `operations`, `service-design`, `tools-be`, `tools-fe`)
- [ ] **Labeled with Practice Area** (`backend`, `frontend`, `devops`, `design`, `research`, `product`, `ia`, `qa`, `analytics`, `contact center`, `research`, `accessibility`, `content`)
- [ ] **Labeled with Type** (`bug`, `request`, `discovery`, `documentation`, etc.)<issue_closed>
Status: Issue closed |
sequiturs/bookshelf-advanced-serialization | 245419746 | Title: Allow incomplete specification of context designations for a given table, with sane defaults
Question:
username_0: If `contextDesignator` does not return a designation, we could default to:
- for `ensureRelationsLoaded`, an empty array
- for `contextSpecificVisibleProperties`, the visible properties determined by the role
Currently, if the caller uses context designations in their specification of `ensureRelationsLoaded` or `contextSpecificVisibleProperties`, those context designations must be complete in the sense of covering all possible models with the given table name (otherwise an error is thrown, cf. https://github.com/sequiturs/bookshelf-advanced-serialization/blob/94afe9432f32550336b336f2058a53a29ac1a4b9/lib/index.js#L429, https://github.com/sequiturs/bookshelf-advanced-serialization/blob/94afe9432f32550336b336f2058a53a29ac1a4b9/lib/index.js#L501). |
microsoft/PowerToys | 1174464288 | Title: clipboard history paste failed after setting keyborad mapper
Question:
username_0: ### Microsoft PowerToys version
0.56.2
### Running as admin
- [X] Yes
### Area(s) with issue?
Keyboard Manager
### Steps to reproduce
1. Map `left ctrl` to `capslock` and `caps lock` to `left ctrl`
2. When I hit `win + v`, it shows all my clipboard histories.
3. When I hit one of my clipboard histories, it just show a `v`
### ✔️ Expected Behavior
Paste clipboard history correctyly instead of a `V`.
### ❌ Actual Behavior
When I hit one of my clipboard histories, it just show a `v`
### Other Software
Windows 11
Answers:
username_1: /dup #14556 |
shieldproject/shield | 997432603 | Title: [NEW]
Question:
username_0: <!--
Thank you for suggesting an idea to make SHIELD better.
Please fill in as much of the template below as you can.
More information will make it easier for the SHIELD team to
assess, validate, and ultimately accept your feature request!
-->
**Is your feature request related to a problem? Please describe.**
Please describe the problem you are trying to solve.
**Describe the solution you'd like**
Please describe the desired behavior.
**Describe alternatives you've considered**
Please describe alternative solutions or features you have
considered.<issue_closed>
Status: Issue closed |
SOMAS2020/SOMAS2020 | 773725309 | Title: Add common pool contribution methods in Client
Answers:
username_1: Should this be an event that the clients can respond to or should it just be a method they can call at any time?
I think it should be an event since that is how we have done basically everything until now.
Status: Issue closed
|
josefnpat/roguecraft-squadron | 253362568 | Title: Destroy Black Holes + Growing Black Holes
Question:
username_0: Black Holes should grow when they absorb an object.
If an area has a very large explosion it could create a black hole. (Maybe like a planet explodes? IDK)
Black holes can be slowly dissolved with matter paste. The paste must only hit the outside the black hole and will slowly build up on the rim of the black hole until it stops rotating and starts to fade out.
Answers:
username_1: Please put this in the backlog or make this into an actionable ticket |
jef/streetmerchant | 872053493 | Title: None of the selections i entered are respected, and it tells me my version of typescript is incompatible--PLEASE HELP!!!
Question:
username_0: ＳＴＲＥＥＴＭＥＲＣＨＡＮＴ
3.5.0
[1:55:20 AM] info :: ℹ selected series: 3060, 3060ti, 3070, 3080, 3090, rx6700xt, rx6800, rx6800xt, rx6900xt, ryzen5600, ryzen5800, ryzen5900, ryzen5950, sf, sonyps5c, sonyps5de, xboxss, xboxsx
[1:55:20 AM] info :: ℹ selected stores: amazon, bestbuy>
## Steps to Reproduce
<!-- Provide a link to a live example, or an unambiguous set of steps to reproduce this bug. -->
<!-- Include code to reproduce, if relevant -->
## Environment
- OS:
<windows 10 64bit>
<summary>dotenv</summary>
```dotenv
# Place your dotenv within these backticks. Be sure to remove any secrets/passwords.
```
</details>
## Logs
<!-- Provide a brief log -->
Status: Issue closed
Answers:
username_0: The Dotenv and Dotenv-example files were in the streetmerchant-main folder, but once i moved them to the git/streetmerchant folder, all of my applied conditions were respected! |
symfony/symfony | 391781316 | Title: Debug toolbar, in combination with doctrine breaks serialization
Question:
username_0: **Symfony version(s) affected**: >= 2.8
**Description**
This issue was already reported in https://github.com/symfony/symfony/issues/27901. But closed by the reporter.
We are using a querybuilder in to create a query which is passed to a call to doctrine's `CreateNativeQuery` method. Since the query builder implements a to string method this works perfectly in production mode without the debug toolbar.
When the debug toolbar is enabled symfony tries to serialize the `sql` index in the `Symfony\Bridge\Doctrine\DataCollector\DoctrineDataCollector` But in case of an non serializable object this will break the execution.
**How to reproduce**
Code block below will trigger the error when used in a controller.
```
$queryBuilder = $this->entityManager->getConnection()->createQueryBuilder();
$queryBuilder->select('id')->from('table');
$this->entityManager->createNativeQuery($queryBuilder, $rsm);
$query->getArrayResult();
```
**Possible Solution**
In `Symfony\Bridge\Doctrine\DataCollector\DoctrineDataCollector` the `sanitizeQuery` method needs a simple extra cast to fix this issue.
```
private function sanitizeQuery($connectionName, $query)
{
$query['sql'] = (string)$query['sql'];
```
We do agree that the code above is not the most usual code to write. But since doctrine allows it we would expect it to work in combination with the symfony bridge package.
Answers:
username_1: So, is DBAL passing the QueryBuilder object to its logger, while the documented type is `string` ? That would be a bug in DBAL itself.
username_0: Could be a true story, although the `DoctrineDataCollector` in symfony is trying to serialize something that is not a string, which results in to very hard to track errors.
I will make a PR for doctrine to fix this issue. in the end it is just about missing type hints, which didn't exist a the moment of writing. I would personally filter the results that are added to the profiler as well. You expect a string. So force it to be one :-).
Status: Issue closed
username_0: Doctrine won't fix this issue by now. It will be resolved in the future with stricter typehints. From a user point of view it would be nice to have a more descriptive error here but we will fix this issue on our side. |
NJCA88/dotify | 367869258 | Title: Proposal
Question:
username_0: # Wiki Page Home
- [ ] Is the first page you see upon entering the wiki
- [ ] Contains a welcome message
- [ ] Contains a link/placeholder for a link to the live page
- [ ] All links in the right sidebar should contain each wiki page and link to the correct page
- [ ] Correctly formatted
- [ ] each wiki page is listed in bullet points
- [ ] all links route the correct page
## Comments
+ Great work overall on the proposal :) Let's create wiki pages on the [wiki tab](https://github.com/username_1/dotify/wiki).
---
# MVP List
- [x] Should have 7 MVPs.
- [x] 3 of those are User Auth, Heroku, and Production README.
- [ ] The other 4 are from the [MVP List](https://github.com/appacademy/curriculum/blob/master/full-stack-project/proposal/mvp-list.md) or they have clarified them with you
- [ ] Contains a description sentence of the app
- [ ] At least one CRUD feature, which states what CRUD operations are planned (creation, reading, updating, deletion)
- [ ] Estimates how long it will take the code each MVP
- [ ] Correctly formatted
- [ ] MVPs are listed in an ordered list
- [ ] Each MVP is broken down into bullet points
## Comments
+ Let's specify on the MVP 3 to users can play songs and create a playlist CRUD cycle. (users wont upload songs but they will create, read, update, delete play list of pre-existing songs).
+ Lets also swap MVP 5 and MVP 6. Let's get continuous player before search!
---
# Database Schema
- [ ] Contains correct datatypes
- [ ] Contains appropriate constraints/details
- [ ] primary key
- [ ] not null
- [ ] unique
- [ ] indexed
- [ ] foreign key
- [ ] Contains bullet points after the table that state which foreign keys will reference to which table, or references to the associations which will be made
- [ ] Correctly formatted
- [ ] schema is written in a table format
- [ ] the table's name are `back_ticked`
- [ ] the table header column names are bolded
- [ ] columns names are lowercased and snaked_cased and `back_ticked`
## Comments
---
# Sample State
- [ ] State shape is flat!
- [ ] State's keys are camelCased
- [ ] All keys within the values in the state are accessible in the schema
- [ ] Correctly formatted
- [ ] Sample state is rendered with triple backticks, and the language ` ```javascript...``` `). This will display the state as a code block instead of a giant line of text
[Truncated]
# Backend Routes
- [ ] Contains the following sections: HTML, API Endpoints(Backend)
- [ ] Each route has a description
- [ ] API Endpoint routes contains wildcard variables written in `snake_case`
- [ ] Routes does not contain [superfluous routes](https://github.com/appacademy/curriculum/blob/master/rails/readings/routing-part-ii.md)
- [ ] Have API routes that will allow the front end to get all info it needs and does not have unneeded routes:
+ probably doesn't need a `GET likes` api endpoint because that info comes through the post show
## Comments
---
# Frontend Routes
- [ ] Frontend routes contains wildcard variables written in `camelCase`
- [ ] Correctly formatted
- [ ] Routes are displayed with `inline coding text` (backticks)
## Comments
Answers:
username_0: Hey Chris :) Overall, great start into your proposal!
I've only looked over everything but routes.
Please format your docs to look like the wiki pages from [blue bird](https://github.com/appacademy/bluebird/wiki) and then i'll be able to look over your routes!
username_1: Formatting for routes / MVP list is done, so routes should be ready for review. Made the recommended switch to MVP. Will finish this up right after A06. Would do now but my train is about to arrive in SF!
username_0: For the Schema, for Spotify, albums have genres. Not songs! We can add the genre_id to the `Album` tables and remove it from the `Song` tables.
Status: Issue closed
|
terminusdb/terminusdb | 999282332 | Title: Access management to various objects
Question:
username_0: I think it will be great if we have access restrictions to various data in the future if we have multiple access to data products in a Team. There may be sensitive data that should have to restrict access to only certain types of roles.
Status: Issue closed
Answers:
username_1: We have an interface for setting authorisation by data product. |
3YOURMIND/django-migration-linter | 397836931 | Title: don't assume git_root is the django_path
Question:
username_0: My django project is allocated in a subdirectory of a git repo like: ``xpbx/xpbx`` so after c6df7e53a0abd0e74b7dfa107c0dbb6de474f5ff I get this error:
```
DJANGO_SETTINGS_MODULE=xpbx.test django-migration-linter --no-cache $(pwd)/xpbx origin/2.4.1
(customers, 0010_auto_20181026_1330)... Traceback (most recent call last):
File "/home/vseva/Env/xpbx/bin/django-migration-linter", line 11, in <module>
sys.exit(_main())
File "/home/vseva/Env/xpbx/lib/python3.6/site-packages/django_migration_linter/migration_linter.py", line 341, in _main
linter.lint_all_migrations(git_commit_id=args.commit_id)
File "/home/vseva/Env/xpbx/lib/python3.6/site-packages/django_migration_linter/migration_linter.py", line 145, in lint_all_migrations
self.lint_migration(m)
File "/home/vseva/Env/xpbx/lib/python3.6/site-packages/django_migration_linter/migration_linter.py", line 81, in lint_migration
md5hash = self.old_cache.md5(migration.abs_path)
File "/home/vseva/Env/xpbx/lib/python3.6/site-packages/django_migration_linter/cache.py", line 47, in md5
with open(path, "rb") as f:
FileNotFoundError: [Errno 2] No such file or directory: '/home/vseva/Foehn/xpbx/xpbx/xpbx/customers/migrations/0010_auto_20181026_1330.py'
```
Answers:
username_1: @username_0 Thanks for the PR :)
Is #39 also fixing your issue?
Status: Issue closed
username_2: Hi @username_0
Thanks a lot for the PR. I'm reopening this to be sure that your issue is fixed.
Can you test your project with the latest version of the linter that lives on `master` currently.
If it is not fixed, could you describe your issue a bit more precisely so we can work on it :)
Cheers,
David
Status: Issue closed
|
Mikescher/AlephNote | 358418576 | Title: [Feature request] Notes encryption via GPG
Question:
username_0: Apologies if this has already been covered before, I couldn't find anything on it. I don't know how many people would use this functionality or if it's really necessary for a note program, just something I know I'd use.
## Current behavior:
Although notes may be shared securely with sync sources, the notes themselves are saved remotely in an unencrypted format. As AlephNote is becoming part of my everyday usage, someone gaining access to some data inside could be harmful. Available security additions are free, compatibly licensed, and widely-used.
## Requested behavior:
Encrypt notes locally and remotely, only displaying as decrypted when a password is entered. Not all notes would need to be encrypted (e.g. for unimportant info / note sharing) and could be marked as such under the keywords, similar to denoting markdown status. For simplicity, would use a single, master password for all included notes prompted on start / on opening. Declining password entry would just show the GPG-encrypted text.
**Encryption format note**: I'm suggesting GPG as a widely-held standard whose information can be decrypted by other programs, meaning that you don't have to use AlephNote at all endpoints to view the data contained.
As the program supports both symmetric (password) and asymmetric (key-based), I'd recommend adding password-only support and then move to key support later. The GPG key capability isn't the focus, but a standardized, tested encryption. Key management is non-simple and primarily for communication e.g. to send to a group, you GPG uses multiple keys to encrypt, which isn't necessary with a note program.
Answers:
username_1: Yeah I already had something like this on my [roadmap](https://github.com/username_1/AlephNote/blob/master/README.md). But now that there's an issue perhaps I will find motivation to work on it :D
My plan for this feature is mostly what you outlined above:
- Mark some (or all) notes as encrypted
- Encrypted notes are saved encrypted locally and on the remote site
- Only show encrypted notes after a password is inserted
- Support different encryption algorithms
I'm not sure why you took GPG as an example. Encryption and decryption would be both on the client side, so I think a public/private-key system would'nt be needed.
I thought more like using an symmetrical algorithm like AES (and perhaps Blowfish, Cast, Twofish, etc in the future).
I did something *similar* in the past: ([PassPad](https://github.com/username_1/Passpad)), an encrypted notepad, perhaps I can reuse a bit of code from it
username_0: My understanding is that GPG supports both symmetrical algorithms as well as public key ones. See: https://www.tutonics.com/2012/11/gpg-encryption-guide-part-4-symmetric.html
Obviously if you know of an open, actively developed, and cross-platform decryption solution (I'm not sure what PassPad used) that would obviously suffice over GPG.
Thanks!
username_0: Another reference: https://evpo.net/encryptpad/ uses password-based GPG encryption. Unlike AlephNote, it doesn't support sync and doesn't look like that's on the roadmap.
username_0: Just a note that it is also possible to use encoding that's not exactly bulletproof, provided there's a clear note about it's status. There are a host of basic text encoding functions that would work fine for 90% of your users, foiling over-the-shoulder or casual attackers (e.g. your parents or a jealous partner). |
andOTP/andOTP | 896780923 | Title: [Thumbnail] Pleroma
Question:
username_0: <!-- Please fill in **all the information below** to help speed up the process! -->
**Name**: Pleroma
**Website**: Pleroma.social
**Link to SVG or EPS image**: https://git.pleroma.social/pleroma/pleroma/-/blob/develop/priv/static/static/logo.svg |
youzan/vant | 1043062008 | Title: 【阿里云/腾讯云】双11爆款优惠特价服务器
Question:
username_0: ### 设备 / 浏览器
ios
### Vant 版本
2.12.31
### Vue 版本
3.2.21
### 重现链接
<a href="https://www.aliyun.com/minisite/goods?taskPkg=1111ydsrwb&pkgSid=5985&userCode=wbqjs7bw" target="_blank">https://www.aliyun.com/minisite/goods?taskPkg=1111ydsrwb&pkgSid=5985&userCode=wbqjs7bw</a>
### 描述问题
【阿里云】双11爆款优惠特价服务器
1核2G1M 180元/3年
2核2G5M 58元/1年
2核4G5M 600元/3年
4核8G5M 1500/3年
活动地址：
https://www.aliyun.com/minisite/goods?taskPkg=1111ydsrwb&pkgSid=5985&userCode=wbqjs7bw
【腾讯云】双11爆款优惠特价服务器
1核2G5M 50G云盘，50元/1年
2核4G8M 80G云盘，74元/1年
2核4G3M 50G云盘，968元/3年（16:00开抢）
4核8G5M 50G云盘，818元/1年（19:00开抢）
活动地址：
https://curl.qcloud.com/mMBBtBDp<issue_closed>
Status: Issue closed |
HackPack/HackUnit | 203004981 | Title: Support for hhvm-autoload
Question:
username_0: Would be great to add support for: https://github.com/fredemmott/hhvm-autoload
It seems like you could test for that as well as `composer.json`?
Answers:
username_1: A `--bootstrap=vendor/hh_autoload.php` flag would be nice, similar to PHPUnit?
username_2: I would certainly welcome a PR!
>
username_1: Here's basic hhvm/autoload support as an immediate solution: #54
I also stumbled across this warning: #55
Can certainly look to flesh out the command line arguments when I get some time
Status: Issue closed
username_2: This is implemented in version 1.1.0. |
kata-containers/ksm-throttler | 316850288 | Title: Implement standard signal and crash handling behaviour
Question:
username_0: Add standard signal handling behaviour:
- backtrace on internal error or fatal signal and exit.
- core dump on internal error or fatal signal if debug enabled.
- backtrace on `SIGUSR1` if debug enabled but continue to run.
For example, see:
- https://github.com/clearcontainers/runtime/pull/1054
- https://github.com/kata-containers/runtime/pull/244
Answers:
username_0: Branch needs an update since it's blocked on #40 landing.
Status: Issue closed
|
LucasBassetti/react-simple-chatbot | 250376689 | Title: Full size not auto scrollable on mobile ?
Question:
username_0: Hello Lucas!
Thanks for your amazing react chatbot!
I tried to put a 100vh heigh on mobile to display the chatbot window but when a new component is rendered, there is no auto scrolling :(
Any solution ?
Best,
Florian
Answers:
username_1: Hi @username_0, Thanks for like it!
Can you provide more details (OS, browser, ...) that you using?
Here is working normally (safari and chrome, iOS)
Status: Issue closed
username_1: Hi, I will close this issue but feel free to keep the conversation. |
jlippold/tweakCompatible | 301659921 | Title: `TapController` working on iOS 11.0.2
Question:
username_0: ```
{
"packageId": "com.skylerk99.tapcontroller",
"action": "working",
"userInfo": {
"arch32": false,
"packageId": "com.skylerk99.tapcontroller",
"deviceId": "iPad6,11",
"url": "http://cydia.saurik.com/package/com.skylerk99.tapcontroller/",
"iOSVersion": "11.0.2",
"packageVersionIndexed": false,
"packageName": "TapController",
"category": "Tweaks",
"repository": "Skylerk99",
"name": "TapController",
"packageIndexed": true,
"packageStatusExplaination": "A matching version of this tweak for this iOS version could not be found. Please submit a review if you choose to install.",
"id": "com.skylerk99.tapcontroller",
"commercial": false,
"packageInstalled": true,
"tweakCompatVersion": "0.0.6",
"shortDescription": "Tap to control default video player like youtube.",
"latest": "0.0.4",
"author": "<NAME>",
"packageStatus": "Unknown"
},
"base64": "<KEY>",
"chosenStatus": "working",
"notes": ""
}
```<issue_closed>
Status: Issue closed |
Bioconductor/UniProt.ws | 1046956068 | Title: Mapping error
Question:
username_0: Getting mapping data for 1 ... and ACC
error while trying to retrieve data in chunk 1:
no results after 5 attempts; please try again later
continuing to try
Error in `colnames<-`(`*tmp*`, value = `*vtmp*`) :
##########
Answers:
username_1: 'data.frame': 2 obs. of 4 variables:
$ ENTREZ_GENE: chr "22627" "22629"
$ PDB : chr NA "5YQG"
$ HGNC : chr NA NA
$ SEQUENCE : chr "MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPA"| __truncated__ "MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKN"| __truncated__
```
So if you have further concerns please contact the UniProt administrators and ask them whether
there are updated web service endpoints that have better performance. If you get useful information please
reopen the issue.
Status: Issue closed
|
CartoDB/cartodb | 106539954 | Title: Invite users to your organization modal
Question:
username_0: Implement the modal from #4882. Take into account group support is not needed yet and will be done at #5504.
Backend support has begun at `4882-Invite_users_to_your_organization`, so you can branch from there and use already working migration and POST request to test this. Example request can be found at `spec/requests/carto/api/invitations_controller_spec.rb`.
cc @username_1
Answers:
username_1: The dialog is done, should I close the ticket?
Status: Issue closed
username_1: Changes are here.
https://github.com/CartoDB/cartodb/commits/4882-Invite_users_to_your_organization
username_0: Thanks! |
trufflesuite/ganache | 746769237 | Title: Windows Ganache GUI not taking updates from Truffle running on WSL2
Question:
username_0: I have added truffle workspace to Ganache as usual. But now when I do a simple `truffle develop` followed by `migrate` inside the truffle shell, Ganache says that the contracts are deployed, but it doesn't pickup changes to the wallet balances.
My `truffle-config.js` files has only one change:
```js
compilers: {
solc: {
version: "native",
},
},
```
I am running truffle inside WSL2, whereas ganache gui is installed natively in windows.
Below is the balance reported by Truffle shell:
```cmd
truffle(develop)> web3.eth.getBalance(accounts[0])
'99934183260000000000'
truffle(develop)> accounts[0]
'<KEY>'
```
Where that same account `<KEY>` in Ganache shows balance full 100 Eth:
Answers:
username_1: You might need to add
```
networks: {
development: {
host: "127.0.0.1",
port: 9545,
network_id: "*"
}
}
```
to your truffle config.
username_0: I Have tried this, but it does not work
username_1: Are you running `truffle console --network development` to connect to the running Ganache UI instance?
username_0: Yes, I am doing exactly the same. The usual steps. It works when I have both truffle and ganache working natively in windows, but when truffle is inside wsl2, ganache cannot connect to it
username_1: This sounds like it is a Truffle issue. I'll transfer this issue to the truffle repo. |
netzbegruenung/green-spider | 312780884 | Title: Decodierung bestimmter IDN-URLs funktioniert nicht
Question:
username_0: Die folgenden URLs werden in der webapp nicht decodiert:
- `http://xn--grne-milk-r9a.de/` - sollte als `http://grüne-milk.de/` angezeigt werden
- `http://xn--grne-much-r9a.de/` - sollte als `http://grüne-much.de/` angezeigt werden
Answers:
username_0: Ich kann die Ursache nicht finden. Ein direkter Test mit der verwendeten Library (punycode.js) zeigt, dass das Decodieren der beiden URLs durchaus funktioniert.
Status: Issue closed
|
VATSIM-UK/UK-Sector-File | 1162410193 | Title: Use two-digit numerical naming to ensure correct ordering
Question:
username_0: # What are the suggested changes?
When editing/checking the sector file in EuroScope, it's often difficult to find sectors and lines that use single digit numbers (i.e. 1-9). Instead, if we ensure that all 'numbers' are at least two digits - i.e. 01, 02, 03, etc. - then this should be made easier.
# Files to be changed (if known)
This might not be all the files...
Ownership/*
Sectors/Lines - *.txt
[Airports](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports)/[EGGW](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports/EGGW)/Sector.txt
[Airports](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports)/[EGSS](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports/EGSS)/Sector.txt
[Airports](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports)/[EGLF](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports/EGLF)/Sector.txt
[Airports](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports)/[EGLC](https://github.com/VATSIM-UK/UK-Sector-File/tree/main/Airports/EGLC)/Sector.txt<issue_closed>
Status: Issue closed |
imbhargav5/rooks | 808904663 | Title: [use-navigator-language] listen to languagechange event
Question:
username_0: **Is your feature request related to a problem? Please describe.**
I looked at the source code of that hook and it doesn't listen to language change.
**Describe the solution you'd like**
Listen to language change.
**Describe alternatives you've considered**
I wrote my own hook.
```js
function useLanguage() {
const [language, setLanguage] = useState(navigator.language);
useEffect(() => {
function handleLanguageChange() {
setLanguage(navigator.language);
}
window.addEventListener("languagechange", handleLanguageChange);
return () => {
window.removeEventListener("languagechange", handleLanguageChange);
};
});
return language;
}
```
**Additional context**
I know that this event never actually fires unless you go to browser language settings and change something, but since it exists why not to use it.
Answers:
username_1: Hey that's a really great idea :) would you like to implement it in the library?
username_0: Sure. I will do that when I find the time
username_2: ```
function useLanguage() {
const [language, setLanguage] = useState( () => {
if(typeof navigator !== "undefined"){
return navigator.language
} else{
return null // or any default
}
} );
useEffect(() => {
function handleLanguageChange() {
setLanguage(navigator.language);
}
window.addEventListener("languagechange", handleLanguageChange);
return () => {
window.removeEventListener("languagechange", handleLanguageChange);
};
});
return language;
}
```
Everything from @username_0 looks good. I think we should just check if navigator exists in the useState initialiser like so. What do you think @username_1 ?
username_1: Yep that looks good :)
username_2: Just created a PR @username_0. Please let me know what you think!
username_0: @username_2 Looks good, thanks!
Status: Issue closed
|
lucazanrosso/Anguriara | 117697016 | Title: Modify addToBackStack in MainActivity
Status: Issue closed
Question:
username_0: Overriding onBackPressed method and introducting popBackStack, now the back function works correctly, but it's just a little slower than before.
Answers:
username_0: Overriding onBackPressed method and introducting popBackStack, now the back function works correctly, but it's just a little slower than before.
username_0: Improved onBackPressed method. Now the back function works fast. |
LPGhatguy/roblox-lua-promise | 446258935 | Title: Failures from Promise.all cannot be caught
Question:
username_0: Normally, Lua errors or explicit rejections can be caught:
```
return Promise.new(function(resolve, reject)
reject("Test")
end)
:catch(function(err)
print("Caught", err)
end)
```
but if using Promise.all, the rejection is never caught:
```
return Promise.all({function(resolve, reject)
reject("Test")
end})
:catch(function(err)
print("Caught", err)
end)
```<issue_closed>
Status: Issue closed |
OrchardCMS/OrchardCore | 489733043 | Title: Should Content Author be set during CreatingAsync?
Question:
username_0: When creating content during a workflow, the Author property of a ContentItem is not set properly. which leads to the "By" field being blank in the ContentItem list.
https://github.com/OrchardCMS/OrchardCore/blob/dev/src/OrchardCore/OrchardCore.ContentManagement/Handlers/ContentsHandler.cs#L30&L45 |
FloKnapp/faulancer | 194897201 | Title: Http\Request::isPost should return true for post requests
Question:
username_0: http://stackoverflow.com/questions/409351/post-vs-serverrequest-method-post
A post request does not necessarily have `$_POST` filled.
The same issue is valid for `Http\Request::isGet`
Answers:
username_1: Was fixed in commit https://github.com/username_1/faulancer/commit/8e44c197cec510462dc1810b33df9dd2a1b9f528
Status: Issue closed
|
Swinject/SwinjectStoryboard | 751614259 | Title: SwinjectStoryboard resolves a new instance of View Controller without dependencies
Question:
username_0: I have found an issue with SwinjectStoryboard, I am trying to create two instances of the same view controller: I.E. Here are my dependencies:
```
container.register(MyViewModeling.self) { r in
MyViewModel(someDependency)
}
container.storyboardInitCompleted(MyVC.self) { r, c in
c.viewModel = r.resolve(MyViewModeling.self)!
}
```
Here is an example of how I resolve my instances:
```
let myVcs = [0,1].map { _ in storyboard.instantiateViewController(withIdentifier: MyVC.Self) }
```
The issue is that the second instance of MyVC created, doesn't contain a viewModel. Meaning I don't go through the dependency injection process(invoke).
I started investigating, and as it turns out from what I see in SwinjectStoryboard source code, when I get to the actual resolve method, I hit the entry.storage.instance(inGraph: currentObjectGraph), which does find an entry for my VC, and instead of invoking dependency injection, it just returns the VC that I have already instantiated.
Answers:
username_0: Anyone?
username_1: Give this a try perhaps.
```
container.storyboardInitCompleted(MyVC.self) { r, c in
c.viewModel = r.resolve(MyViewModeling.self)!
}.inObjectScope(.transient)
```
https://github.com/Swinject/Swinject/blob/master/Documentation/ObjectScopes.md |
winwinwiki/winwin-frontend | 449512153 | Title: View History - Organization Chart
Question:
username_0: Expected: Changes made in the Organization Chart should be documented in the View History section. For the MVP, any change/update made in the Organization Chart should be documented in View History. Ideally, each potential change in Organization Chart (creation, deletion, edit) should be precisely documented in View History.
Answers:
username_1: @username_0 According to the discussions we had, in **Organization Chart** we have **create** and **edit** operations only.
username_0: @username_1 Yes, according to our discussion those are the operations within Organization Chart. This issue is in reference to View History. We would like changes made in Organization Chart to be recorded on the View History page. For the MVP, any change (create/edit) should be recorded on the View History page.
username_1: @username_0 @username_3 Whenever a child organization is created, it's history is logged in associated to it's immediate parent organization.
username_0: @username_1 This issue is not resolved.
Here is what we want: When a change is made to **Egg**, it should be recorded in the View History of **This node has dragging disabled**. The View History is a log of changes made within a given organization. **Egg** is a child organization (although not a direct child) of **This node has dragging disabled**, therefore it is within the given organization of **This node has dragging disabled**, so any Org Chart change made to **Egg** should be recorded in **This node had dragging disabled**.
username_2: Hi @username_3 ,
username_3: @username_2 - what does the invalid label mean?
username_3: @username_1 -- now that we are saving root parent for each org this should be feasible. Adding back to To-Do.
username_0: This issue has been resolved
Status: Issue closed
|
scorelab/Go-social | 1160423100 | Title: Solution for `Invalid regular expression` in Go-social
Question:
username_0: I was getting
`error Invalid regular expression: /(.\fixtures.|node_modules[]react[]dist[].|website\node_modules.|heapCapture\bundle.js|.\tests.)$/: Unterminated character class. Run CLI with --verbose flag for more details`
after upgrading dependencies to #133 ,To solve this issue,
navigate to `\node_modules\metro-config\src\defaults\blacklist.js` and upgrade
`var sharedBlacklist = [
/node_modules[/\\]react[/\\]dist[/\\].*/,
/website\/node_modules\/.*/,
/heapCapture\/bundle\.js/,
/.*\/__tests__\/.*/
];`
To
`var sharedBlacklist = [
/node_modules[\/\\]react[\/\\]dist[\/\\].*/,
/website\/node_modules\/.*/,
/heapCapture\/bundle\.js/,
/.*\/__tests__\/.*/
];
`
for solving this issue. |
pchampin/gereco | 58048820 | Title: Alternative pushState for external links
Question:
username_0: In cases where the visited URL can not be pushed with ``pushState``, an alternative URL should may be pushed instead (e.g. ``consoleURL#visitedURL``).
Of course, this implies that such alternative URLs are correctly loaded.
Answers:
username_0: Fixed by 4da6e8c33d901200181ad226bae54a751df813ce
Status: Issue closed
|
LuckSiege/PictureSelector | 789547477 | Title: 华为android10系统， media.getOriginalPath()返回的是null
Question:
username_0: PictureSelector.create(this)
.openGallery(PictureMimeType.ofAll())
.imageEngine(GlideEngine.createGlideEngine())
.maxSelectNum(1)// 最大图片选择数量
.minSelectNum(1)// 最小选择数量
.maxVideoSelectNum(1)
.imageSpanCount(4)// 每行显示个数
.isReturnEmpty(false)// 未选择数据时点击按钮是否可以返回
.closeAndroidQChangeWH(true)//如果图片有旋转角度则对换宽高,默认为true
.closeAndroidQChangeVideoWH(!SdkVersionUtils.checkedAndroid_Q())
.isPreviewImage(true)// 是否可预览图片
.isPreviewVideo(true)
.forResult(object:OnResultCallbackListener<LocalMedia>{
override fun onResult(result: MutableList<LocalMedia>?) {
result?.let {
for (media in it) {
Log.i("test", "原图路径:" + media.originalPath);
}
}
}
override fun onCancel() {
//
}
})
Answers:
username_1: 
Android10加个这两个，获取最好用下面的方式
Status: Issue closed
username_3: 没有作用 |
saltstack/salt | 326999753 | Title: ini.options_present - long time duration
Question:
username_0: Hi, I've noticed that as a result of the salt upgrade, the state is running longer with the same configuration.
The salt 2018 version is extremely long.
One processor core is 100% charged with the salt process.
Have you also observed such a phenomenon?
Is this the correct behavior?
================================
ID: openstack_nova
Function: ini.options_present
Name: /etc/nova/nova.conf
Result: True
Comment: Changes take effect
Started: 13:31:16.845943
Duration: 64707.647 ms
Changes:
salt-call grains.get saltversion
local:
2016.11.9
=======================================
ID: openstack_nova
Function: ini.options_present
Name: /etc/nova/nova.conf
Result: True
Comment: No anomaly detected
Started: 11:19:03.331468
Duration: 158318.573 ms
Changes:
salt-call grains.get saltversion
local:
2017.7.5
============================
ID: openstack_nova
Function: ini.options_present
Name: /etc/nova/nova.conf
Result: True
Comment: No anomaly detected
Started: 12:47:33.581740
Duration: 856533.31 ms
Changes:
salt-call grains.get saltversion
local:
2018.3.0
Answers:
username_1: @username_0 Thanks for the report. This definitely does not sound like it should be the expected situation when using `init.options_present`.
username_2: I've performed some debugging and it looks that time is wasted in function https://github.com/saltstack/salt/blob/develop/salt/modules/ini_manage.py#L81:
```
inifile = _Ini.get_ini_file(file_name, separator=separator)
```
Because of the loop in refresh() method in class _Section https://github.com/saltstack/salt/blob/develop/salt/modules/ini_manage.py#L269.
I have investigated that most time is used for commented lines. Maybe the solution is to skip lines with '#' at the beginning ? In our case nova.conf has `8042` commented out or empty lines and just 130 proper lines.
username_2: How to reproduce:
1. curl -o /etc/nova.conf https://docs.openstack.org/nova/latest/_downloads/nova.conf.sample
2. create /srv/salt/test.sls:
```
openstack_nova:
ini:
- name: /etc/nova.conf
- options_present
- sections:
DEFAULT:
rpc_backend: rabbit
my_ip: example
use_neutron: true
linuxnet_interface_driver: nova.network.linux_net.LinuxOVSInterfaceDriver
firewall_driver: nova.virt.firewall.NoopFirewallDriver
verbose: True
debug: false
vcpu_pin_set: example
resume_guests_state_on_host_boot: true
multi_instance_display_name_template: "%(name)s%(count)s"
reserved_host_memory_mb: 12048
reserved_host_disk_mb: 18192
cpu_allocation_ratio: 116.0
disk_allocation_ratio: 2.3
ram_allocation_ratio: 4.5
resize_confirm_window: 36000
api:
auth_strategy: keystone
placement:
os_region_name: example
project_domain_name: example
user_domain_name: example
project_name: example
auth_url: http://example:35357/v3
auth_type: example
username: example
os_interface: internal
oslo_messaging_rabbit:
rabbit_retry_interval: 1
rabbit_retry_backoff: 2
rabbit_max_retries: 0
rabbit_ha_queues: false
rabbit_port: 5672
rabbit_userid: nova
rabbit_virtual_host: /
amqp_durable_queues: false
oslo_concurrency:
lock_path: /var/lib/nova/tmp
keystone_authtoken:
auth_uri: http://example:5000
auth_url: http://example:35357
auth_plugin: password
project_domain_id: default
user_domain_id: default
project_name: services
username: nova
libvirt:
virt_type: example
live_migration_progress_timeout: 0
snapshot_image_format: qcow2
[Truncated]
novncproxy_base_url: https://example:6080/vnc_auto.html
vncserver_listen: 0.0.0.0
vncserver_proxyclient_address: example
enabled: true
workarounds:
disable_libvirt_livesnapshot: false
```
3. salt-call --local state.sls test -l debug
Result:
```
----------
ID: openstack_nova
Function: ini.options_present
Name: /etc/nova.conf
Result: True
Comment: Changes take effect
Started: 12:00:02.649629
Duration: 570166.998 ms
``` |
cassproject/cass-editor | 319044265 | Title: Enable triggering the "add" button functionality from the parent window via postMessage
Question:
username_0: This will let the editor's parent page trigger the add functionality so that the "add" button can appear outside of the CASS editor but still function exactly as it does now.
Answers:
username_1: @username_0 Which add button are you referring to specifically?
username_0: The add button that appears next to the "select all" button when the editor has enabled selecting competencies. Clicking the button causes the editor to send a postMessage to the parent window containing data for the selected competencies.
username_2: @username_1 It's the add/select button along with the checkboxes that is shown in response to `select=Add` being passed into the URL parameters.
I would recommend if `select` is added as a URL parameter without any value, that the select functionality is enabled, but the select/add button isn't shown.
username_1: Got it, thanks.
username_3: Wasn't working when we tried this @username_1
username_1: @username_0 Adding `select` as a query parameter without a value will hide the add button, and the message {"message":"select"} will trigger the add functionality.
username_2: Please create a demo page that demonstrates this that @username_3 can access.
username_2: Demo page is now at
demos/add-button.html
username_2: Merged. Ready to test.
username_3: This does not seem to be working for me. I have competencies selected, but the add button (demo button) is not doing anything
username_4: I added an alert so you don't have to go into the developer tools to see the contents of the postMessage.
username_3: This seems to be working. Feel free to reopen if additional issues are found.
Status: Issue closed
|
godotengine/godot | 1043081233 | Title: Vulkan Validation: (via RendererCanvasCull::render_canvas) vkCmdDrawIndexed: Hazard READ_AFTER_WRITE for VkImageView
Question:
username_0: ### Godot version
Godot Engine v4.0.dev.calinou.795cd2eb3 ([`795cd2eb3`](https://github.com/godotengine/godot/commits/795cd2eb3))
### System information
Linux, Elementary OS 5.1, Intel(R) HD Graphics 4400 (HSW GT2), Vulkan API 1.2.182
### Issue description
```
ERROR: VALIDATION - Message Id Number: 1287084845 | Message Id Name: SYNC-HAZARD-READ_AFTER_WRITE
Validation Error: [ SYNC-HAZARD-READ_AFTER_WRITE ] Object 0: handle = 0xba98ae0000002ace, type = VK_OBJECT_TYPE_IMAGE_VIEW; | MessageID = 0x4cb75b2d | vkCmdDrawIndexed: Hazard READ_AFTER_WRITE for VkImageView 0xba98ae0000002ace[], in VkCommandBuffer 0x55555f9d0520[], and VkPipeline 0xd74bd40000003597[], VkDescriptorSet 0x59c86700000035c5[], type: VK_DESCRIPTOR_TYPE_SAMPLED_IMAGE, imageLayout: VK_IMAGE_LAYOUT_SHADER_READ_ONLY_OPTIMAL, binding #0, index 0. Access info (usage: SYNC_FRAGMENT_SHADER_SHADER_STORAGE_READ, prior_usage: SYNC_IMAGE_LAYOUT_TRANSITION, write_barriers: 0, command: vkCmdEndRenderPass, seq_no: 941, reset_no: 41).
Objects - 1
Object[0] - VK_OBJECT_TYPE_IMAGE_VIEW, Handle -5001056071171691826
at: _debug_messenger_callback (drivers/vulkan/vulkan_context.cpp:157)
```
```
#0 VulkanContext::_debug_messenger_callback (messageSeverity=VK_DEBUG_UTILS_MESSAGE_SEVERITY_ERROR_BIT_EXT, messageType=0x2, pCallbackData=0x7fffffffb750, pUserData=0x55555f0317b0) at drivers/vulkan/vulkan_context.cpp:53
#1 0x00007fffe93ff5de in debug_log_msg (layer_prefix=0x7fffe9a10799 "Validation", text_vuid=<optimized out>, message=<optimized out>, objects=..., msg_flags=<optimizedout>, debug_data=<optimized out>) at /root/sdk-build/1.2.182.0/source/Vulkan-ValidationLayers/layers/vk_layer_logging.h:475
#2 LogMsgLocked (debug_data=<optimized out>, msg_flags=msg_flags@entry=0x8, objects=..., vuid_text="SYNC-HAZARD-READ_AFTER_WRITE", err_msg=<optimized out>) at /root/sdk-build/1.2.182.0/source/Vulkan-ValidationLayers/layers/vk_layer_logging.h:735
#3 0x00007fffe9461bc7 in ValidationObject::LogError<VkImageView_T*> (this=0x55555f968790, src_object=<optimized out>, vuid_text="SYNC-HAZARD-READ_AFTER_WRITE", format=0x7fffe9c18d38 "%s: Hazard %s for %s, in %s, and %s, %s, type: %s, imageLayout: %s, binding #%u, index %u. Access info %s.") at /root/sdk-build/1.2.182.0/source/Vulkan-ValidationLayers/layers/generated/chassis.h:3310
#4 0x00007fffe97529ad in CommandBufferAccessContext::ValidateDispatchDrawDescriptorSet (this=this@entry=0x555562aa39e0, pipelineBindPoint=pipelineBindPoint@entry=VK_PIPELINE_BIND_POINT_GRAPHICS, func_name=func_name@entry=0x7fffe9a11f29 "vkCmdDrawIndexed") at /root/sdk-build/1.2.182.0/source/Vulkan-ValidationLayers/layers/synchronization_validation.cpp:1835
#5 0x00007fffe9754148 in SyncValidator::PreCallValidateCmdDrawIndexed (this=<optimized out>, commandBuffer=<optimized out>, indexCount=0x6, instanceCount=<optimized out>, firstIndex=0x0, vertexOffset=<optimized out>, firstInstance=0x0) at /root/sdk-build/1.2.182.0/source/Vulkan-ValidationLayers/layers/synchronization_validation.cpp:4078
#6 0x00007fffe929760d in vulkan_layer_chassis::CmdDrawIndexed (commandBuffer=<optimized out>, indexCount=<optimized out>, instanceCount=<optimized out>, firstIndex=<optimized out>, vertexOffset=0x0, firstInstance=0x0) at /root/sdk-build/1.2.182.0/source/Vulkan-ValidationLayers/layers/generated/chassis.cpp:3031
#7 0x00005555587a0ba0 in RenderingDeviceVulkan::draw_list_draw (this=0x55555f7b0090, p_list=0x800000000000000, p_use_indices=0x1, p_instances=0x1, p_procedural_vertices=0x0) at drivers/vulkan/rendering_device_vulkan.cpp:7468
#8 0x000055555ae3ae37 in RendererCanvasRenderRD::_render_item (this=0x7fffe4290020, p_draw_list=0x800000000000000, p_render_target=..., p_item=0x55556b550f40, p_framebuffer_format=0x5, p_canvas_transform_inverse=..., current_clip=@0x7fffffffc5e8: 0x55556b550bf0, p_lights=0x0, p_pipeline_variants=0x7fffe4290140) at servers/rendering/renderer_rd/renderer_canvas_render_rd.cpp:570
#9 0x000055555ae3e4ce in RendererCanvasRenderRD::_render_items (this=0x7fffe4290020, p_to_render_target=..., p_item_count=0x50, p_canvas_transform_inverse=..., p_lights=0x0, p_to_backbuffer=0x0) at servers/rendering/renderer_rd/renderer_canvas_render_rd.cpp:1117
#10 0x000055555ae40159 in RendererCanvasRenderRD::canvas_render_items (this=0x7fffe4290020, p_to_render_target=..., p_item_list=0x555564f98690, p_modulate=..., p_light_list=0x0, p_directional_light_list=0x0, p_canvas_transform=..., p_default_filter=RenderingServer::CANVAS_ITEM_TEXTURE_FILTER_LINEAR, p_default_repeat=RenderingServer::CANVAS_ITEM_TEXTURE_REPEAT_DISABLED, p_snap_2d_vertices_to_pixel=0x0, r_sdf_used=@0x7fffffffca28: 0x0) at servers/rendering/renderer_rd/renderer_canvas_render_rd.cpp:1466
#11 0x000055555adc19a1 in RendererCanvasCull::_render_canvas_item_tree (this=0x55555fa52110, p_to_render_target=..., p_child_items=0x55557a3ca5c0, p_child_item_count=0xf, p_canvas_item=0x0, p_transform=..., p_clip_rect=..., p_modulate=..., p_lights=0x0, p_directional_lights=0x0, p_default_filter=RenderingServer::CANVAS_ITEM_TEXTURE_FILTER_LINEAR, p_default_repeat=RenderingServer::CANVAS_ITEM_TEXTURE_REPEAT_DISABLED, p_snap_2d_vertices_to_pixel=0x0) at servers/rendering/renderer_canvas_cull.cpp:72
#12 0x000055555adc2a9b in RendererCanvasCull::render_canvas (this=0x55555fa52110, p_render_target=..., p_canvas=0x555564e06850, p_transform=..., p_lights=0x0, p_directional_lights=0x0, p_clip_rect=..., p_default_filter=RenderingServer::CANVAS_ITEM_TEXTURE_FILTER_LINEAR, p_default_repeat=RenderingServer::CANVAS_ITEM_TEXTURE_REPEAT_DISABLED, p_snap_2d_transforms_to_pixel=0x0, p_snap_2d_vertices_to_pixel=0x0) at servers/rendering/renderer_canvas_cull.cpp:359
#13 0x000055555ae11e40 in RendererViewport::_draw_viewport (this=0x55555fa72300, p_viewport=0x555564e668f0) at servers/rendering/renderer_viewport.cpp:457
#14 0x000055555ae12af4 in RendererViewport::draw_viewports (this=0x55555fa72300) at servers/rendering/renderer_viewport.cpp:608
#15 0x000055555aa65b7e in RenderingServerDefault::_draw (this=0x55555fa3cfa0, p_swap_buffers=0x1, frame_step=6.7999999999999998) at servers/rendering/rendering_server_default.cpp:97
#16 0x000055555aa678ac in RenderingServerDefault::draw (this=0x55555fa3cfa0, p_swap_buffers=0x1, frame_step=6.7999999999999998) at servers/rendering/rendering_server_default.cpp:379
#17 0x00005555576d8ce2 in Main::iteration () at main/main.cpp:2666
#18 0x00005555576928b6 in OS_LinuxBSD::run (this=0x7fffffffd540) at platform/linuxbsd/os_linuxbsd.cpp:342
#19 0x000055555768eded in main (argc=0x7, argv=0x7fffffffda38) at platform/linuxbsd/godot_linuxbsd.cpp:58
```
### Steps to reproduce
[vulk-previews-issue-repro-bb.zip](https://github.com/godotengine/godot/files/7465344/vulk-previews-issue-repro-bb.zip)
### Minimal reproduction project
_No response_ |
martinResearch/MatlabAutoDiff | 928149852 | Title: diff
Question:
username_0: diff not coded into autodiff class. specifically, along a third dimension.
Answers:
username_1: This is fixed now , I generalized diff to nd arrays. see
https://github.com/username_1/MatlabAutoDiff/blob/05600dfb08134c55065e7001aa8deee2be2e34db/src/AutoDiff_tests.m#L83
Thanks for the feedback
username_1: @username_0 , does that solve your problem ?
Status: Issue closed
|
Tarmil/FSharp.SystemTextJson | 647011701 | Title: Unwrapping single-field single-case discriminated union.
Question:
username_0: Hello, thansk for the awsome library.
Is it possible to just serialzie the value of the field in case of single case du?
```FSharp
type Foo = Foo of value:int
```
So `{| Prop1 = Foo 1; Prop2 = Foo 2 |}` is serialized as `{ prop1: 1, prop2: 2 }`
Answers:
username_1: #67 related |
ClickHouse/ClickHouse | 1040946791 | Title: Not summarizing values when using `_Key` in SummingMergeTree
Question:
username_0: **Describe the unexpected behaviour**
When using `_Key` in a nested column using the SummingMergeTree Engine, the values do not get summarized when Merge occurred.
**How to reproduce**
```
Connected to ClickHouse server version 20.7.2 revision 54437.
:) CREATE TABLE testing (Id Int32, OrderMap Nested (device UInt32, orders Float32), DeviceMap Nested(device UInt32,cod_transaction_Key Int16,amount Float32,units Int32)) ENGINE=SummingMergeTree() ORDER BY Id
CREATE TABLE testing
(
`Id` Int32,
`OrderMap` Nested(device UInt32, orders Float32),
`DeviceMap` Nested(device UInt32, cod_transaction_Key Int16, amount Float32, units Int32)
)
ENGINE = SummingMergeTree
ORDER BY Id
Query id: 17eb2d79-579f-413f-b729-a8a2322c8119
Ok.
0 rows in set. Elapsed: 0.005 sec.
username_0-XPS-15-9500 :) INSERT INTO testing VALUES (1, [1,1,1], [1,2,1], [1,1,1], [1,0,1], [3,1,5], [1,2,3])
INSERT INTO testing VALUES
Query id: d428968b-e958-4847-b315-7dc2be62fecb
Ok.
1 rows in set. Elapsed: 0.005 sec.
username_0-XPS-15-9500 :) SELECT * FROM testing
SELECT *
FROM testing
Query id: 38141206-3a2e-40c3-8e16-c8bfaffced46
┌─Id─┬─OrderMap.device─┬─OrderMap.orders─┬─DeviceMap.device─┬─DeviceMap.cod_transaction_Key─┬─DeviceMap.amount─┬─DeviceMap.units─┐
│ 1 │ [1,1,1] │ [1,2,1] │ [1,1,1] │ [1,0,1] │ [3,1,5] │ [1,2,3] │
└────┴─────────────────┴─────────────────┴──────────────────┴───────────────────────────────┴──────────────────┴─────────────────┘
1 rows in set. Elapsed: 0.002 sec.
:) OPTIMIZE TABLE testing FINAL
OPTIMIZE TABLE testing FINAL
Query id: 01e3d7b2-31ca-40e3-9b02-6c33decd9380
Ok.
0 rows in set. Elapsed: 0.016 sec.
username_0-XPS-15-9500 :) SELECT * FROM testing
[Truncated]
1 rows in set. Elapsed: 0.005 sec.
```
**Expected behavior**
I expect that device and cod_transaction_Key becomes the primary key and aggregated according to them
```
:) SELECT * FROM testing
SELECT *
FROM testing
Query id: 348cde95-da24-4d28-92d6-8cf6eb398fa3
┌─Id─┬─OrderMap.device─┬─OrderMap.orders─┬─DeviceMap.device─┬─DeviceMap.cod_transaction_Key─┬─DeviceMap.amount─┬─DeviceMap.units─┐
│ 1 │ [1] │ [4] │ [1,1] │ [1,0] │ [8,1] │ [4,2] │
└────┴─────────────────┴─────────────────┴──────────────────┴───────────────────────────────┴──────────────────┴─────────────────┘
```
Answers:
username_1: Yes, it seems column names are matter.
```
CREATE TABLE testing
(
`Id` Int32,
`OrderMap` Nested(device UInt32, orders Float32),
`DeviceMap` Nested(device UInt32, a Int16, b Float32, c Int32)
)
ENGINE = SummingMergeTree
ORDER BY Id;
INSERT INTO testing VALUES (1, [1,1,1], [1,2,1], [1,1,1], [1,0,1], [3,1,5], [1,2,3])'
SELECT *
FROM testing
Query id: 8b4fa341-920a-4806-800d-59d0380d62dc
┌─Id─┬─OrderMap.device─┬─OrderMap.orders─┬─DeviceMap.device─┬─DeviceMap.a─┬─DeviceMap.b─┬─DeviceMap.c─┐
│ 1 │ [1] │ [4] │ [1] │ [2] │ [9] │ [6] │
└────┴─────────────────┴─────────────────┴──────────────────┴─────────────┴─────────────┴─────────────┘
```
it should be documented or fixed
username_1: You cannot use combined key (device, cod_transaction_Key), nested summing in SummingMergeTree does not support it.
username_0: Checking the source code, we were expecting that using the keyword _Key would trigger a composite keys behaviour.
username_1: it uses sumMap function under the hood, and sumMap does not supports combined keys and tuple keys
https://clickhouse.com/docs/en/sql-reference/aggregate-functions/reference/summap/
```
SELECT sumMap((key1, key2), value)
FROM
(
SELECT
[1] AS key1,
[2] AS key2,
[11] AS value
)
Query id: 4a12364c-74eb-415e-acfb-1cd6f5344609
0 rows in set. Elapsed: 0.001 sec.
Received exception from server (version 21.9.1):
Code: 43. DB::Exception: Received from localhost:9000. DB::Exception: First argument for function sumMap must be an array, not Tuple(Array(UInt8), Array(UInt8)). (ILLEGAL_TYPE_OF_ARGUMENT)
```
username_1: As a workaround you can use Hash functions or simple multiplication (transform UInt32 + Int16 to UInt64)
`device UInt32, cod_transaction_Key Int16` -> `device * 4294967295 + cod_transaction_Key`
Status: Issue closed
|
crystal-lang/crystal | 1028341838 | Title: Upgrade `Regex` engine
Question:
username_0: ## Discussion
- What aspect of the language would you like to see improved?
An updated `Regex` engine.
- What are the reasons?
Crystal currently uses `PCRE1` as its engine. This library is now EOL and released its final release a few months ago. See https://www.pcre.org/original/changelog.txt. Because of this, we are no longer getting new bug fixes and/or features.
- Optionally add one (or more) proposals to improve the current situation.
1. Upgrade to `PCRE2`, which is [mostly](https://wiki.php.net/rfc/pcre2-migration#backward_incompatible_changes) backwards compatible.
2. Migrate to some other engine, such as `RE2` or `Oniguruma`
Some discussion related to this happened in https://github.com/crystal-lang/crystal/issues/8199. However, having a higher level discussion on which route we want to go would be better taking _all_ things into consideration, outside of that one particular issue.
Answers:
username_1: It is important to keep the semantics of `Regex` consistent. Regular exception literals are part of Crystal code, and like any other part of the standard library, we should try not to break them.
Thus we probably have to go with PCRE2. Switching to a completely different engine would create more dissonance. I don't think any potential functional or performance benefits could make up for that.
Even with PCRE2 there are a couple minor breaking changes compared to PCRE1. But that's probably acceptable or rather unavoidable unless someone keeps up maintenance of the legacy version.
Bindings for alternative engines can be provided as third party libraries.
username_2: While I agree with @username_1 , for the future, when we can accept more breaking changes in a major release, another option is to look at [`Onigmo`](https://github.com/k-takata/Onigmo), which is a fork of `Oniguruma`, and is the engine used by Ruby 2+. Having the same engine as Ruby would keep some more of that consistency between the 2 languages that makes the transition from one to other so nice.
username_3: As far as I know, the major benefit of Onigmo is supporting some encodings other than UTF-8, like Shift_JIS/EUC-JP, which, in Crystal's case, is not important at all. For instance, I'm not sure if Onigmo is faster than PCRE.
So I think there's not a lot of incentive (as far as I see it) to move to another Regex engine...
username_1: Even if some alternative is more performant or has some nice additional features, it would be hard to overcome the consistency factor. We're talking about the default implementation of the standard library. If we change that, it will undoubtedly break something.
If you need a faster engine ore some nice additional feature, you're always free to use a custom Regex implementation. It just won't work with regex literals (unless fooling around with stdlib).
username_0: I guess another question in this regard is should we use the standard implementation of it? They also have https://www.pcre.org/original/doc/html/pcrejit.html#SEC11, which would be more performant, but would require all of the supported platforms support it. https://www.pcre.org/original/doc/html/pcrejit.html#TOC1. Possibly could have it be behind a flag or something one way or the other.
username_4: PCRE is known for shitty performance (for a majority of cases), and Oniguruma (+ Onigmo as its fork) beats it to the ground, so I guess it would be worth looking into a potential change.
See for reference:
- https://stackoverflow.com/questions/11996988/how-good-is-oniguruma-compared-to-other-cross-platform-regexp-libraries
- http://lh3lh3.users.sourceforge.net/reb.shtml
username_0: @username_4 I'd be curious to see some more modern benchmarks as both of those are almost a decade old. Plus with #3852, It's likely it'll perform much better than it was before.
username_1: Performance optimization is a *subordinate goal.* If I want something really fast, I write a dedicate algorithm in Crystal instead of employing a regex engine. If I need to use regex for whatever reasons, I can alwasy use a custom implementation that fits my needs best.
I think the *primary metric* for taking any alternative implementation into serious consideration is how much it deviates from PCRE.
PCRE2 is mostly backwards compatible, except for a couple minor changes. That's most likely the best we can get anyways.
Not sure about Onigmo/Onigurama. But I can't recall big issues with Ruby's switch, so maybe it's not a huge deal. |
yenihayat/redmine-theme-yh | 423004497 | Title: issues priority colors incorrect
Question:
username_0: Hi,
My issues with priority High is shown as green. Inspecting the element shows this is "#wrapper tr.priority-3 td.priority". I went in settings and change the priority sequence in admin panel, but the priority number always show as 3, even after refresh and restart redmine.
How can I make Priority high shows red? |
Rapptz/discord.py | 430485695 | Title: Dark mode docs (w/ option for light still)
Question:
username_0: ### The Problem
The docs burn my eyes due to the light theme used.
### The Ideal Solution
A dark theme with a toggle for users that oddly prefer to have a light theme for the docs
### The Current Solution
Using some jank stylus themes that are rather broken.
### Summary
Dark mode theme for the docs w/ option to use light theme still.
Answers:
username_1: first world problems
username_2: https://discord.js.org/#/docs
They made good docs, with _turn off the lights_ option and other tiny features, check it, I haven't seen better documentation
_P. S. I haven't worked with discord.js_
username_1: this is a preference, not an issue, therefore shouldn't be a github issue
username_0: @username_1 The docs are on this GitHub repo and this is a pretty valid issue to raise as theming is configured through the docs source. Equally, if you had a legitimate issue with the naming convention of some methods within the library, an issue would be the correct way to raise it.
username_3: This seems to be a common request for whatever reason so here are the issues with it as I see it:
1. Making a dark theme on my end takes considerably more effort than making a dark theme on your end using Stylish since I have to modify CSS spread across 3 different files and hope I can get Sphinx to play nice
2. Even if you get a decent theme going, Firefox does not allow styling of the scrollbar without resorting to JavaScript which will bloat up the documentation even more.
3. If I were to add a dark theme, which takes time and effort, I would also have to store the preference somewhere using cookies which I also do not like doing and do it via JavaScript to toggle etc.
4. For a vast majority of the population and in many of the sites all around the world, white background on black text is the preferred solution for actually reading text. It is also an accessibility concern for those who have contrast issues. In similar vain, [studies have shown](https://www.ncbi.nlm.nih.gov/pubmed/25141597) that positive display polarity have several advantages so making dark theme the only option would be a bad idea.
username_4: 1. I think is just a matter of tinkering a bit. Stylus is easy mode but that shouldn't mean it's not worth the slight amount of effort.
2. The docs right now are 1.3mb. Adding https://github.com/Grsmto/simplebar (for example) would add a whopping 32kb.
3. Why is this a bad thing, how else would it happen.
4. This is indeed just an argument against ONLY dark mode, not against trying to implement a toggle.
username_5: Honestly all this reminds me of is [this](https://images.app.goo.gl/NfCdeQ4fPXSkHWPY6)
username_6: I would recommend this, because I don't really have extensions for my browser.
username_7: There's actually a [`@media` query to match against the user's preferred color scheme](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme), however support is quite limited right now.
Status: Issue closed
username_3: This has been implemented in the v1.6 rewrite of the documentation. |
UbiquityRobotics/magni_robot | 408611943 | Title: Do all navigation in base_footprint frame
Question:
username_0: This is the more correct frame, and is level with the ground plane.
Things that need to change:
- Odometery Publishing
- Fiducial Slam
- Move basic
Answers:
username_0: @Polonium19 mentions that this is important for implementing the Gazebo model, because base_link has to be a child of base_footprint in order for odometry to work in gazebo
Status: Issue closed
|
szczys/RecipeBrowser | 659354835 | Title: Add search feature
Question:
username_0: This should be simple to implement with the db call, but displaying the results is a bit more difficult.
* Add nav drawer entry for search
* Use action view in toolbar for entry (will turn home icon into back icon)
* Put RecyclerView in a special mode when search action is open
* Use back action to return category spinner and recyclerView |
couchbaselabs/couchbase-rs | 391336356 | Title: Is there a missing 'lcb_n1p_free' call in 'query_n1ql'?
Question:
username_0: `lcb_n1p_new` is called [here](https://github.com/couchbaselabs/couchbase-rs/blob/master/couchbase/src/bucket.rs#L304) to create a new instance of `lcb_N1QLPARAMS`. An associated call to `lcb_n1p_free` is not called however... was this intentional?
Answers:
username_1: @username_0 thanks for reporting this.. the new code on master (which will become 1.0.0-alpha.1) includes the destroy calls properly!
Status: Issue closed
|
FreemapSlovakia/mapsforge-v5 | 524879526 | Title: Renderovať landuse=orchard
Question:
username_0: Ovocné sady sa nerenderujú. Možno renderovať podobne ako trávnaté plochy s ikonkami jabĺčka a hrušky.
Answers:
username_0: Prikladám príklad oblasti https://www.freemap.sk/?map=17/48.996156/17.807497&layers=X
username_1: Už sa renderujú (aj vinice) od dnešnej v1.2.3
username_0: Neviem či by sa dala použiť grafika odtiaľto https://www.flaticon.com/free-icon/fruit_919341?term=apple%20pear&page=1&position=17
Otázka či by stačilo spomenúť autorov len niekde v credits
username_0: Aha super |
webpack/webpack.js.org | 299704049 | Title: Create Google Summer of Docs Page
Question:
username_0: - [x ] Check the current issues to ensure you aren't creating a duplicate.
- [ x] Consider making small typo fixes and such directly as pull requests.
- [ x] For the voting application, go to https://github.com/webpack-contrib/voting-app.
- [ x] For loader/plugin docs, consider opening an issue in the corresponding repository.
- [ x] No existing issue? Go ahead and open a new one.
- __Remove these instructions from your PR as they are for your eyes only.__
Webpack is participating in Google Summer of Code. It would be nice to create a page at webpack.js.org with the proposals from this [page](https://docs.google.com/document/d/17snmViHEAM3vhj6bf0nH0-i0so_rQf4PeK5OuCrXcV8/edit)
Answers:
username_1: @username_0 that page looks pretty well thought out so whenever you think it's pretty much ready to go just submit a PR to add it to the __Contribute__ section (`/src/contribute`) of the site. Then I would recommend treating that page as the source of truth for it (instead of the google doc) and you/others can submit more PRs as things change.
Status: Issue closed
|
biolab/orange-hugo | 722169838 | Title: Loading your data: correct redirect
Question:
username_0: Doesn't work:
https://orange-visual-programming.readthedocs.io/loading-your-data/index.html
Works:
https://orange3.readthedocs.io/en/latest/loading-your-data/index.html
Should we rewrite LYD to pure hugo (make it a page) and add:
- CSV File Import section
- Edit Domain section
- file loaders (Corpus, Import Documents, Import Images, Multifile...?)<issue_closed>
Status: Issue closed |
orientechnologies/orientdb | 316794619 | Title: .toJSON omits commas in object Arrays.
Question:
username_0: ### OrientDB Version: 2.2.28
### Java Version: 1.8.0_161
### OS: windows
## Expected behavior
toJSON on embedded properties should export compliant JSON. array of objects should be comma separated.
```
`[
{
"a": "b"
},
{
"c": "d",
"e": "f"
},
{
"g": {
"h": "i"
}
}
]
```
should export as is.`
## Actual behavior
.toJSON don't insert commas in-between array elements
`[{"@type":"d","@version":0,"a":"b"}{"@type":"d","@version":0,"c":"d","e":"f"}{"@type":"d","@version":0,"g":{"h":"i"}}] `
## Steps to reproduce
`insert into testclass content {"testcol":[{"a":"b"},{"c":"d","e":"f"},{"g":{"h":"i"}}]}`
`select testcol.toJSON()`
Status: Issue closed
Answers:
username_1: Hi @username_0
Thank you very much for reporting, I just pushed a fix, next hotfix release will solve this problem
Thanks
Luigi |
netgusto/nodebook | 360918409 | Title: Replace VT100 color codes in output?
Question:
username_0: Exemple:
```
const chalk = require('chalk');
console.log(chalk.green('Hello, World!'));
```
Should it be displayed in green, or `[32mHello, World![39m` ?
Answers:
username_0: https://www.npmjs.com/package/ansi-to-html
Status: Issue closed
username_0: Done. |
juliendargelos/BetterSched2 | 178147000 | Title: [Mobile] Modification des options impossible
Question:
username_0: Impossibilité de cliquer sur les options (ex : Filière, Année, Semaine...) sur mobile
Appareil : LG Nexus 5 (sous Android Marshmallow 6.0.1)
Answers:
username_1: **Pistes:**
-----
- **Les différents preventDefault répartis sur les évènements touch**: Tests avec désactivation de JS
- **Le bug déjà constaté sur iOS et Mac OS**: La relation for/id ne semble pas être interprétée par webkit. À tester sur d'autres moteurs d'exécution.
username_1: Le problème est-il toujours présent ?
username_0: Non, il a disparu sur tous mes appareils !
Status: Issue closed
|
aws-amplify/amplify-js | 479085974 | Title: Using generated schema in custom schema.graphql
Question:
username_0: ** Which Category is your question related to? **
Amplify API, Schema.graphql
** What AWS Services are you utilizing? **
AppSync, Dynamo
** Provide additional details e.g. code snippets **
I've created a custom model in schema.graphql, and created a custom query on top of the ones generated by default. I want to use some of the generated schema in my query, particularly Model{Name}FilterInput and ModelSortDirection. Using them as query parameters without having them in the file causes errors. Is there a way to import them or reference them from the generated schema in build/schema.grapql for usage in schema.grapql? |
dotnet/llilc | 120933440 | Title: tailcall_v4\hijacking unexpected result
Question:
username_0: Test
- JIT\Methodical\tailcall_v4\hijacking\hijacking.cmd
gets False result when expecting True.
Answers:
username_1: Yep, it fails.
I think it may be related to not doing a required tail call, but not 100% sure. Will come back to this later.
Status: Issue closed
|
nicksenger/statix | 713173849 | Title: images
Question:
username_0: 
 |
rebuy-de/aws-nuke | 490219490 | Title: APIGatewayVpcLink should have Name filter
Question:
username_0: APIGatewayVpcLink doesn't support tags in AWS. For now, there is no meaningful way of filtering this resource type so I think it would be very beneficial if we could filter it by its `Name` property.
Answers:
username_1: Fixed with #540
Status: Issue closed
|
HiP-App/HiP-Mobile | 169914209 | Title: Slide out menu selected item
Question:
username_0: The slide out menu has a highlighted item. This item doesn't correspond always the displayed content. This could lead to confusion. Make the highlighted entry always show the currently displayed content.<issue_closed>
Status: Issue closed |
Ungaminga/elder-scrolls-legends-tracker | 249363882 | Title: ESLTracker crashes on start
Question:
username_0: Win10 Enterprise build 10.0.14393, Intel HD 3000 Graphics with driver 9.17.10.4229. When attempting to launch ESLTracker from C:\ESLTracker, it crashes. Crash can be reproduced reliably. Contents of crash file:
APP VERSION: "1.6.1+5.Branch.master.Sha.8bb59f107a99c4332d0246b29a898611715bfb46"
System.NullReferenceException: Object reference not set to an instance of an object.
at ESLTracker.Utils.DeckFileReader.DeckFileReader..ctor()
at ESLTracker.DataModel.Tracker..ctor(ITrackerFactory trackerFactory)
at ESLTracker.Utils.FileManager.LoadDatabase(Boolean throwDataFileException)
at ESLTracker.App.CheckDataFile()
at ESLTracker.App.Application_Startup(Object sender, StartupEventArgs e)
at System.Windows.Application.OnStartup(StartupEventArgs e)
at System.Windows.Application.<.ctor>b__1_0(Object unused)
at System.Windows.Threading.ExceptionWrapper.InternalRealCall(Delegate callback, Object args, Int32 numArgs)
at System.Windows.Threading.ExceptionWrapper.TryCatchWhen(Object source, Delegate callback, Object args, Int32 numArgs, Delegate catchHandler)
at System.Windows.Threading.DispatcherOperation.InvokeImpl()
at System.Windows.Threading.DispatcherOperation.InvokeInSecurityContext(Object state)
at System.Threading.ExecutionContext.RunInternal(ExecutionContext executionContext, ContextCallback callback, Object state, Boolean preserveSyncCtx)
at System.Threading.ExecutionContext.Run(ExecutionContext executionContext, ContextCallback callback, Object state, Boolean preserveSyncCtx)
at System.Threading.ExecutionContext.Run(ExecutionContext executionContext, ContextCallback callback, Object state)
at MS.Internal.CulturePreservingExecutionContext.Run(CulturePreservingExecutionContext executionContext, ContextCallback callback, Object state)
at System.Windows.Threading.DispatcherOperation.Invoke()
at System.Windows.Threading.Dispatcher.ProcessQueue()
at System.Windows.Threading.Dispatcher.WndProcHook(IntPtr hwnd, Int32 msg, IntPtr wParam, IntPtr lParam, Boolean& handled)
at MS.Win32.HwndWrapper.WndProc(IntPtr hwnd, Int32 msg, IntPtr wParam, IntPtr lParam, Boolean& handled)
at MS.Win32.HwndSubclass.DispatcherCallbackOperation(Object o)
at System.Windows.Threading.ExceptionWrapper.InternalRealCall(Delegate callback, Object args, Int32 numArgs)
at System.Windows.Threading.ExceptionWrapper.TryCatchWhen(Object source, Delegate callback, Object args, Int32 numArgs, Delegate catchHandler)
at System.Windows.Threading.Dispatcher.LegacyInvokeImpl(DispatcherPriority priority, TimeSpan timeout, Delegate method, Object args, Int32 numArgs)
at MS.Win32.HwndSubclass.SubclassWndProc(IntPtr hwnd, Int32 msg, IntPtr wParam, IntPtr lParam)
at MS.Win32.UnsafeNativeMethods.DispatchMessage(MSG& msg)
at System.Windows.Threading.Dispatcher.PushFrameImpl(DispatcherFrame frame)
at System.Windows.Threading.Dispatcher.PushFrame(DispatcherFrame frame)
at System.Windows.Application.RunDispatcher(Object ignore)
at System.Windows.Application.RunInternal(Window window)
at System.Windows.Application.Run(Window window)
at ESLTracker.App.Main() |
rust-lang/rust | 42696616 | Title: LLVM abort with indexing of byte string literal in static
Question:
username_0: ```rust
#![allow(dead_code)]
const X: &'static [u8] = b"1";
static Y: u8 = X[0];
fn main() {}
```
```
rustc: /build/rust-git/src/rust/src/llvm/include/llvm/Support/Casting.h:237: typename llvm::cast_retty<X, Y*>::ret_type llvm::cast(Y*) [with X = llvm::GlobalVariable; Y = llvm::Value; typename llvm::cast_retty<X, Y*>::ret_type = llvm::GlobalVariable*]: Assertion `isa<X>(Val) && "cast<Ty>() argument of incompatible type!"' failed.
Aborted
playpen: application terminated with error code 134
```
Changing the `b"1"` to e.g. `&[1]` works fine.
Answers:
username_1: Still seeing this, but `bytes!()` is gone now :(
username_0: This seems to be related to `b"..."` being a DST, that seemingly isn't being handled correctly, cc @nick29581. I think it would be fixed by https://github.com/rust-lang/rust/issues/18465 but both @alexcrichton and I have met problems with implementing that.
username_2: This works fine now.
This issue may be closed.
username_3: Closed by #22838 (which even included a test :-) )
Status: Issue closed
|
uber-go/cadence-client | 235321589 | Title: sleep facility for activities
Question:
username_0: We need a sleep API that would sleep on real clock in normal case, but sleep on mock clock in unit test environment, something like:
cadence.ActivitySleep(ctx context.Context, d time.Duration)
then, in activity code, instead of:
time.Sleep(d)
it should do:
cadence.ActivitySleep(ctx, d)
this way, ActivitySleep would sleep on real clock in normal case, but sleep on mock clock on unit tests. |
open-policy-agent/gatekeeper | 1056645211 | Title: gktest output is not in lexicographic order
Question:
username_0: As I run `gator test ./...` in the [gatekeeper library](https://github.com/open-policy-agent/gatekeeper-library), I'm seeing output like the following:
```bash
❯ gator test ./...
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/pod-security-policy/host-filesystem/suite.yaml 0.098s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/general/allowedrepos/suite.yaml 0.137s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/general/block-endpoint-edit-default-role/suite.yaml 0.134s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/general/block-nodeport-services/suite.yaml 0.085s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/pod-security-policy/capabilities/suite.yaml 0.095s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/pod-security-policy/forbidden-sysctls/suite.yaml 0.091s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/general/containerlimits/suite.yaml 0.160s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/pod-security-policy/allow-privilege-escalation/suite.yaml 0.141s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/pod-security-policy/apparmor/suite.yaml 0.134s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/pod-security-policy/flexvolume-drivers/suite.yaml 0.136s
ok usr/local/google/home/juliankatz/go/src/github.com/open-policy-agent/gatekeeper-library/library/pod-security-policy/fsgroup/suite.yaml 0.088s
PASS
```
As you'll see, the order of the output is confusing. The output from the `pod-security-policy` folder is mixed in with that of the `general` folder. This makes it harder to visually compare the output vs. my filesystem.
Status: Issue closed
Answers:
username_1: Duplicate: #1641 |
JTorrus/Styles_PHP | 313694781 | Title: Shorthand propierties
Question:
username_0: https://github.com/JTorrus/Styles_PHP/blob/5ba50c93e6ff0c60db1f50a87e8dc4dff3d343bc/css/Estil.css#L4
**Shorthand** propierties allows the definition of some css rules in same line. http://librosweb.es/libro/css_avanzado/capitulo_1/propiedades_shorthand.html |
SYSU-RCDD/SA-SPR | 430122841 | Title: any chance to publish this algorithm ?
Question:
username_0: Hello,
Can you provide the algorithm ?
Specially the way you generate the embedding ?
BR,
Guillaume
Answers:
username_1: Hi all,
I am also very interested on this paper. It would be very helpful to have the implementation of the embedding mechanism published.
Regards,
Virginia |
WAVM/WAVM | 529821815 | Title: Memory growth errors
Question:
username_0: I'm having trouble diagnosing and potentially recovering from failures of [`Runtime::growMemory`](https://github.com/WAVM/WAVM/blob/master/Lib/Runtime/Memory.cpp#L192). Currently it returns `false` on multiple error conditions, and if it fails before setting `oldNumPages` this uninitialized value can confuse things further. I can't find a convenient way to check the failure condition without writing similar checks to the function itself.
Would it be ok to go back to having an integer return value with some predefined error codes? If you'd like to keep the boolean return value then could an `errno`-like integer be useful to interrogate if the user wishes?
Cheers
Answers:
username_1: I think it would be best for `Runtime::growMemory` to return an enum that encodes whether the operation succeeded, or the specific condition that caused it to fail.
Status: Issue closed
username_0: Ah amazing, thanks Andrew! |
lhotse-speech/lhotse | 1071176438 | Title: Ignore_id with encodings
Question:
username_0: I'm no sure if this is an issue, but creating one just in case:
Our plan with the encodings is to save them as byte arrays.
I just want to make sure this doesn't cause an issue with the ignore_id, assuming we
use a negative value for positions that correspond to padding. (I assume such things happen
when collating the batch).
It might be necessary to convert to a different integer type at some point, e.g. to long,
which we'll eventually need in any case for indexing purposes.
Answers:
username_1: Since `custom_collate_field` returns a tuple of `(collated_tensors, collated_tensor_lengths)`, it should be OK to ignore the padding values completely by using the length tensor e.g. to construct a mask, or replace with a different value later after casting to a larger dtype. Would that solve the issue?
username_1: See: https://github.com/lhotse-speech/lhotse/blob/master/lhotse/dataset/collation.py#L266
username_0: I think it would be best to detect cases where the padding value does not fit in the dtype (e.g. if dtype is unsigned, e.g. torch.uint8), and promote to a type that will fit the padding value. In fact I think it would be reasonable to just promote all integer types that are not torch.long, to torch.long, since that is the type that can be used in torch indexing.
username_1: See https://github.com/lhotse-speech/lhotse/pull/507
Status: Issue closed
|
editorconfig/editorconfig-defaults | 579933583 | Title: Publish this as an API
Question:
username_0: I just wanted to chime in that it would be great to be able to query this like its done for `.gitignore` https://docs.gitignore.io/install/command-line.
Is this on the roadmap? I would be happy to contribute to that |
allure-framework/allure-rspec | 164509394 | Title: How to add desciption in report
Question:
username_0: We have it name as test_case. I want to add description for the "it" block.
http://ci.qatools.ru/job/allure-core_master-deploy/lastSuccessfulBuild/Allure_report/
Answers:
username_1: @username_0 It would be better if you could provide the example code, you're using.
username_0: it "testcase title is here" do |e|
e.step "Step 1" do
end
end
I want like this
This is my output image
username_0: In junit have the annotations for description ( @description ), But in ruby it doesn't have.
Status: Issue closed
|
flatpak/flatpak.github.io | 271124251 | Title: FAQ contradicts itself about systemd ties
Question:
username_0: The answers to these two questions contradict each other.
Is Flatpak tied to systemd?
==
No. Versions of flatpak 0.6.10 relied on systemd for cgroups setup, but this is no longer required.
Can Flatpak be used on servers too?
==
Flatpak is designed to run inside a desktop session and relies on certain session services, such as a dbus session bus and a systemd --user instance.
Answers:
username_1: Fixed by 73087f04bc5904a94354df6cde0d259b772a45b9
Status: Issue closed
|
microsoft/accessibility-insights-windows | 599023402 | Title: [Feature Request] Persist my UIA event selection during a AIWin session
Question:
username_0: Say I make a careful custom selection for UIA event reporting, and then get a bunch of events reported by AIWin as desired. I then stop event reporting to do a bit of live inspection of the UI. I then return to the event selection UI and have to make my careful selection again. Could AIWin remember my previous choice, at least during a single session?
Answers:
username_1: Hi @username_0, we just wanted to confirm that you are aware of the ability to save a custom list of events and properties to listen to with the "My Events" section of the event configuration. The list of events you select with My Events will persist across different event recording sessions, unlike your checkbox selections. Does this feature meet your needs for event selection persistence, or is it missing something important? |
w3c/csswg-drafts | 214872780 | Title: [css-values] note counter-intuitive interpretation of unitless 0 inside calc()
Question:
username_0: I would argue that interpreting `0` as being of type `dimension<length>` would be valid, and would be more in line with developer expectations. However, this was [discussed in 2010](https://lists.w3.org/Archives/Public/www-style/2010Dec/0479.html) with @username_1 agreeing the `0` should cause a parse error. That's fine, but it would be helpful if the fact that `0` is never treated as a dimension inside `calc()` were explicitly noted in the spec (which was also agreed upon in that discussion).
Answers:
username_1: I've gone ahead and added a note about this in 1024dc3.
Status: Issue closed
|
burakgozutok/CS240 | 210764648 | Title: about week 2 - 3 homework
Question:
username_0: Hi,
First of all good job you well coded. The only thing all just i want from you is put all files to in a folder that called, for example week 2 - 3, and upload that folder to github so that your works will be more organized in order to reach<issue_closed>
Status: Issue closed |
coolmodi/SpellCalc | 825814403 | Title: Elvui Spellbook no tooltips
Question:
username_0: Spellcalc is no longer showing tooltips in the spell book when using an ElvUI version greater than 1.36
Specifically it looks like the commit 6978250c ActionBars Revamp is what breaks it.
Answers:
username_1: ElvUI spellbook tooltips are now working in 0.8.3
Status: Issue closed
|
dotnet/docs | 665806291 | Title: Add a page for dotnet-gcdump
Question:
username_0: https://devblogs.microsoft.com/dotnet/collecting-and-analyzing-memory-dumps/
---
#### Document Details
⚠ *Do not edit this section. It is required for docs.microsoft.com ➟ GitHub issue linking.*
* ID: 9a269a64-0a27-27d3-a509-47b9a0d114bf
* Version Independent ID: 49ff97ff-b39a-5ae8-e4b8-81a4f8eab50c
* Content: [dotnet-dump - .NET Core](https://docs.microsoft.com/en-us/dotnet/core/diagnostics/dotnet-dump)
* Content Source: [docs/core/diagnostics/dotnet-dump.md](https://github.com/dotnet/docs/blob/master/docs/core/diagnostics/dotnet-dump.md)
* Product: **dotnet-core**
* GitHub Login: @sdmaclea
* Microsoft Alias: **stmaclea**
Answers:
username_1: Duplicate of #18935
Status: Issue closed
|
jdhartley/terminal-for-fitbit | 839717168 | Title: Feature - larger font
Question:
username_0: Some of us older people (born in negative or low time_t values) are starting to need reading glasses.
One thing that might be helpful would be combining a few stats on one line and making the font bigger.
Dropping units / battery bar / tz offset / year / maybe making hostname optimally 'fb' would enable some of the data to be combined and allow for a larger font.
The data could be selectable like a separate option - heart+batt in addition to the two separate items.
Or you could have a two column toggle
Answers:
username_1: Hi @username_0, thanks for this idea! I have found myself moving my watch comically close to my face on occasion... but never thought to fix the underlying issue!
I have started playing with a new `[Large] Source Code Pro` font setting that takes the font from 22pt to 30pt. When using a Large font, I have started trimming info so everything fits
<img width="1503" alt="Screen Shot 2021-04-04 at 1 15 53 PM" src="https://user-images.githubusercontent.com/405538/113520440-edd04c80-9547-11eb-8f1f-a3445e22c5a5.png">
There is some more work to do for the heart rate, and I do like your idea of creating merged items. I will explore that. I would also include the other fonts in Large varieties.
I'd love to some feedback from you at this point; let me know if this direction seems promising!
username_0: This looks good. Another challenge for older eyes is contrast ... specifically the red and purples are hard to ready. Maybe a toggle for B&W (or better yet, black and green retro).
username_0: in this case zerocool is the user name (that's selectable?)
that's also another potential toggle that even eagle eyed folks might want.
e.g. change username field to prompt field. Today you can change username but it adds @sense or @versa right?
Might make more sense to allow the user to modify PS1 (everything before the $) and then you don't have to have logic tied to font selection changing the prompt. |
litsec/swedish-eid-shibboleth-base | 397761728 | Title: Fix reported vulnerabilities in Jackson databind 2.9.7
Question:
username_0: See https://github.com/litsec/swedish-eid-shibboleth-base/network/alert/dependency-bom/pom.xml/com.fasterxml.jackson.core:jackson-databind/open.
Status: Issue closed
Answers:
username_0: Fixed in PR https://github.com/litsec/swedish-eid-shibboleth-base/pull/50. |
godotengine/godot | 369911286 | Title: get_tree().quit() not doing anything in web exports
Question:
username_0: **Godot version:**
3.0.3 (but I have seen this also with Tanks of Freedom, which is a 2.1.x-based project)
**OS/device including version:**
Win 7 x64
**Issue description:**
If you have a game exported to web that uses get_tree().quit to, well, quit, it will do nothing in a web export. Functions that should run on QUIT_NOTIFICATIONS will not run and the game will stay in browser, still active...
**Steps to reproduce:**
https://tof.p1x.in/html5/
wait for game to load, click quit game (top right of screen)
**Minimal reproduction project:**
Do you really want one for such a reproducible issue as this?
Answers:
username_1: By the way, after call to get_tree().quit collision detection is not working any longer...but that's irrelevant since the whole game should not work any longer in the first place...
username_2: I'm using 3.1.1 and having the same issue. Is there a resolution or workaround?
username_3: Try calling the the `window.close()` function in Javascript.
Godot has a Javascript singleton to execute Javascript:
https://docs.godotengine.org/en/3.1/classes/class_javascript.html
username_4: Here's what I tried:
```
func _on_Quit_pressed():
if OS.has_feature('JavaScript'):
JavaScript.eval("window.close()")
get_tree().quit()
```
That throws the following in Firefox's dev console:
`Scripts may not close windows that were not opened by script.`
Has anyone found a workaround?
username_5: @username_4 According to [this Stack Overflow question](https://stackoverflow.com/questions/2076299/how-to-close-current-tab-in-a-browser-window), this can be worked around by using a `<button>` element (which needs to be part of the DOM first). This is probably difficult to integrate in a WebAssembly-based engine.
username_4: Got it. I'm more interested in allowing the game to be stopped, than in
closing the window. Wasn't sure if there was a lower-level function
other than `get_tree().quit()` I might try.
Thanks.
username_4: Could it have to do with this in platform/javascript/detect.py?:
```
# TODO: Reevaluate usage of this setting now that engine.js manages engine runtime.
env.Append(LINKFLAGS=['-s', 'NO_EXIT_RUNTIME=1'])
```
From https://emscripten.org/docs/getting_started/FAQ.html:
"By default Emscripten sets EXIT_RUNTIME=0, which means that we don’t include code to shut down the runtime. That means that when main() exits, we don’t flush the stdio streams, or call the destructors of global C++ objects, or call atexit callbacks. This lets us emit smaller code by default, and is normally what you want on the web: even though main() exited, you may have something asynchronous happening later that you want to execute.
In some cases, though, you may want a more “commandline” experience, where we do shut down the runtime when main() exits. You can build with -s EXIT_RUNTIME=1, and then we will call atexits and so forth."
What would re-evaluating usage of this setting look like? Just changing it and seeing if exiting works? Or is there more to it?
Status: Issue closed
username_6: Fixed in `master` by #38587 (and in `3.2` by #39604). |
microsoft/Microsoft-Win32-Content-Prep-Tool | 559646270 | Title: Linux executable?
Question:
username_0: Any chance of getting this tool for Linux? I'd like to do the wrapping on a Linux server.
Answers:
username_1: I was able to successfully run the tool on a Debian server using Wine and Mono. I'm seriously thinking of creating a cloud-based web app that offers a clean GUI for easily packaging win32 apps for Intune.
username_1: Unfortunately, I'll have to cancel my plans to create an Intune packager web app, as it is not allowed by the license terms (clause 4e).
username_0: Didn't even think of wine, that's a great idea! Will check it out myself :+1:
username_2: @username_1 @username_0
We’ve decided to open source the Intune application packaging and publishing component of our Microsoft 365 Management Suite which has the same functionality as this tool. You can find the repository here: https://github.com/simeoncloud/IntuneAppBuilder. It is written in dotnet core (3.1) and is cross platform. |
HelgeSverre/Brreg | 374876238 | Title: Use Brreg in controller
Question:
username_0: Is it possible to use this in a controller?
Answers:
username_1: This seems to work for me both in controller and tinker command line on Laravel 5.7:
```PHP
# Include the class.
use HelgeSverre\Brreg\BrregService;
# In a controller method.
$brreg = app()->make(BrregService::class);
$data = $brreg->getCompanyData('996888460');
```
Might be a better way to instantiate the service, but I'm not too familiar with the service container injection magic.
username_0: Great, thanks!
Status: Issue closed
|
peterdesmet/movebank2gbif | 210837523 | Title: Choosing variables to include in GBIF
Question:
username_0: The Movebank contains ~200 data attributes that describe events (stored in the data file, 1 row per tag+timestamp), animals, tags, or deployments (stored in the reference data file, 1 row per deployment). Many of these attributes are used only rarely. The mapping at https://github.com/peterdesmet/movebank2gbif/blob/master/mapping.md now includes the most common/important of these attributes (considering that these will be going to a biodiversity database). I might think of a few more that should be added as we go on, but for the rest I recommend referring to the complete dataset by DOI in informationWithheld. |
open-telemetry/opentelemetry-python | 796264082 | Title: Move opencensus exporter and prometheus exporter to contrib
Question:
username_0: The [otlp](https://github.com/open-telemetry/opentelemetry-specification/blob/main/specification/protocol/exporter.md), [jaeger](https://github.com/open-telemetry/opentelemetry-specification/blob/main/specification/trace/sdk_exporters/jaeger.md) and [zipkin](https://github.com/open-telemetry/opentelemetry-specification/blob/main/specification/trace/sdk_exporters/zipkin.md) exporters are all properly defined in the specs, will be marked as stable and in turn be part of our 1.0.0 release. With that being said, the opencensus and prometheus exporters will not be. We should move these exporters out of the main repo into contrib so we do not include them as part of the release. Also the push based [prometheus](https://github.com/open-telemetry/opentelemetry-python-contrib/tree/master/exporter/opentelemetry-exporter-prometheus-remote-write) exporter already exists in the contrib repo so it makes sense to put them together in one place.<issue_closed>
Status: Issue closed |
Automattic/node-canvas | 1104161690 | Title: Error relocating /usr/lib/libpangoft2-1.0.so.0: FcWeightFromOpenType: symbol not found
Question:
username_0: Hi,
I met one issue that show an error "Error relocating /usr/lib/libpangoft2-1.0.so.0: FcWeightFromOpenType: symbol not found".
My node v12.22.9 is running on Docker. And the canvas is v2.8.0. I installed the latest Pango and Cairo by apk.
Is there something I missed? Any ideas for this error?
Thank you in advance. |
chrisedg87/flutter_rounded_loading_button | 639729579 | Title: Change border radius
Question:
username_0: Any plans on adding an option to specify the border radius of the button?
Answers:
username_1: Sure, I'll look into this in the next release.
username_1: Are we thinking we want the border radius to animate? As in transition to the circular loading spinner, or remain as a rounded rectangle?
username_1: [Linked](https://github.com/username_1/flutter_rounded_loading_button/tree/border-radius)
username_0: I think it makes the most sense to transition to a circle for the loader. That seems to keep the spirit of the package and would look good, while giving more control over the initial button state look.
username_1: Done. Fixed in v1.0.9.
Status: Issue closed
|
processing/processing-android | 53036702 | Title: get() method doesn't work
Question:
username_0: For example if I execute following code:
```processing
String sketchRenderer() {
return P3D;
}
void setup() {
}
void draw() {
translate(width / 2, height / 2);
box(100);
if (mousePressed) {
color pixelColor = get(mouseX, mouseY);
}
}
```
And if I touch the display I get this error and the app exits :-(
```
FATAL EXCEPTION: GLThread 1165
Process: processing.test.sketch_141229b, PID: 13162
java.lang.RuntimeException: GL function glReadBuffer() is not available on this hardware (or driver) Read http://wiki.processing.org/w/OpenGL_Issues for help.
at processing.opengl.PGLES.readBuffer(Unknown Source)
at processing.opengl.PGraphicsOpenGL.beginPixelsOp(Unknown Source)
at processing.opengl.PGraphicsOpenGL.readPixels(Unknown Source)
at processing.opengl.PGraphicsOpenGL.loadPixels(Unknown Source)
at processing.opengl.PGraphicsOpenGL.get(Unknown Source)
at processing.core.PApplet.get(Unknown Source)
at processing.test.sketch_141229b.sketch_141229b.draw(sketch_141229b.java:31)
at processing.core.PApplet.handleDraw(Unknown Source)
at processing.opengl.PGLES$AndroidRenderer.onDrawFrame(Unknown Source)
at android.opengl.GLSurfaceView$GLThread.guardedRun(GLSurfaceView.java:1531)
at android.opengl.GLSurfaceView$GLThread.run(GLSurfaceView.java:1248)
```
If I try to do the same operation on a PGraphics I get this NullPointerException:
```
FATAL EXCEPTION: GLThread 1168
Process: processing.test.sketch_141229b, PID: 15113
java.lang.NullPointerException
at processing.opengl.PGraphicsOpenGL.beginPixelsOp(Unknown Source)
at processing.opengl.PGraphicsOpenGL.readPixels(Unknown Source)
at processing.opengl.PGraphicsOpenGL.loadPixels(Unknown Source)
at processing.opengl.PGraphicsOpenGL.initCache(Unknown Source)
at processing.opengl.PGraphicsOpenGL.getTexture(Unknown Source)
at processing.opengl.PGraphicsOpenGL$TexCache.getTexture(Unknown Source)
at processing.opengl.PGraphicsOpenGL.flushPolys(Unknown Source)
at processing.opengl.PGraphicsOpenGL.flush(Unknown Source)
at processing.opengl.PGraphicsOpenGL.endDraw(Unknown Source)
at processing.core.PApplet.handleDraw(Unknown Source)
at processing.opengl.PGLES$AndroidRenderer.onDrawFrame(Unknown Source)
at android.opengl.GLSurfaceView$GLThread.guardedRun(GLSurfaceView.java:1531)
at android.opengl.GLSurfaceView$GLThread.run(GLSurfaceView.java:1248)
```
Answers:
username_1: This error is fixed now.
Also, we have updated how `size()` works.
Have a look here how size() is transformed during the preprocessing stage - https://github.com/processing/processing-android/wiki#Screen_Orientation_and_the_size_command |
keithmcnulty/wikifacts | 638334447 | Title: Functions require an English Language locale
Question:
username_0: If your locale is not English, these functions will fail. To fix this
on a Mac/Linux
```
Sys.setlocale("LC_TIME", "en_GB.UTF-8")
```
on Windows:
```
Sys.setlocale("LC_TIME", "English")
```
Answers:
username_0: I believe this can be addressed by changing the locale back and forth within the function: so
```
locale <- Sys.getlocale("LC_TIME")
if (.Platform$OS.type == "windows") {
Sys.setlocale("LC_TIME", "English")
} else {
Sys.setlocale("LC_TIME", "en_US.UTF-8")
}
```
Then after pulling:
```
Sys.setlocale(locale)
```
Status: Issue closed
username_0: If your locale is not English, these functions will fail. To fix this
on a Mac/Linux
```
Sys.setlocale("LC_TIME", "en_GB.UTF-8")
```
or
```
Sys.setlocale("LC_TIME", "en_US.UTF-8")
```
on Windows:
```
Sys.setlocale("LC_TIME", "English")
```
Status: Issue closed
|
Egorka96/med-org-portal | 654240458 | Title: Отправка рег данных пользователя на email
Question:
username_0: Было бы удобно, если при создании пользователя, на указанный email было бы отправлено письмо типа "Вы зареганы в личном кабинете, Ваши учетные данные ..."
Answers:
username_0: Сейчас создание пользователя портала происходит по такому сценарию: менеджер МЦ заводит пользователя через интерфейс Пользователи, копирует логин/пароль и отправляет на email (или еще как-то) представителю организации-заказчика инфу с доступом к порталу.
Было бы прикольно на этапе создания пользователя, если по пользователю указан email, портал бы предлагал отправить письмо на указанный email с примерно таким содержимым:
```
Вам была создана учетная запись в личном кабинете медцентра "<название медцентра>".
Адрес личного кабинета - <url портала>.
Логин -
Пароль -
```
username_0: TODO:
1. добавить в модель User поле "need_change_password". Boolean по--умолчанию, true
2. сделать мидлвару, которая будет проверять у пользователь флаг need_change_password. Если он True, то редирект на вьюху обязательного смены пароля (из п.3)
3. сделать вьюху наподобие джанговской вьюхи смены пароля (PasswordChangeView), только чтобы в форме были только поля про новый пароль. После смены пароля, ставить у пользователя значение флага need_change_password = False
Status: Issue closed
|
sopel-irc/sopel | 223208982 | Title: [find] Upgrade s/ubstitution/editing/ to accept any delimiter, like sed
Question:
username_0: Sometimes it's just tricky to use `/` as the delimiter when correcting one's own mistake, like in a URL. The `find.py` module could use regex backreferences to allow the use of any character (except `\` and newlines) as a delimiter, to make life a bit easier.
Answers:
username_0: I'm still going to do this, but not between now and the release of 7.0. The patch won't break the current `/`-based usage, so there's no reason to rush it when there are more pressing things to finish up.
username_1: If you don't have time for this in 7.1, it's OK, I think it's fine to do that in Sopel 8.
username_0: Well, with #1993 merged, the ambitious full implementation of this idea can get knocked out of 7.1. |
kubernetes/kubernetes | 708322255 | Title: Graduate scheduler framework to GA
Question:
username_0: The scheduler framework has been in development since 1.16. It was marked as alpha, but strictly speaking, the framework is not a feature that implements a new user-facing behavior, it is more of a restructuring of the scheduler's code base to allow developers more flexibility to add new functionality.
Since k/k isn't a library and doesn't offer any guarantees around the stability of the apis, and since the framework itself is still under `k/k/pkg/scheduler`, I propose the following:
1) Mark the framework KEP as implemented.
2) Move the interfaces out of the `pkg/scheduler/framework/v1alpha1` to pkg/scheduler/framework.
3) In the future, move the framework interfaces out to the staging repo, and versioning will follow k8s versions.
/sig scheduling
/cc @Huang-Wei @username_3 @username_1
Answers:
username_1: I agree with 1 and 3, but should we drop the versioning for the framework? It's probably unlikely that it will be drastically changed but maybe changing to `pkg/scheduler/framework/v1` would also signify the promotion to GA more?
I'm fine with doing it as proposed, just want to bring that possibility up
username_0: I am not sure what purpose that serves if we want to link the api version with k8s version.
username_2: I think we should also expose `internal/cache` package or provider helper to test the customize scheduling framework plugin.
https://github.com/kubernetes/kubernetes/blob/db9f1e91d977c45fe7df8e1e1bd415a3292995e1/pkg/scheduler/framework/plugins/noderesources/least_allocated_test.go#L289
username_3: But we already have an interface for it. Maybe we can provide a `testing` package with an implementation of the interface, but the cache itself should remain internal.
username_2: Yes, provide helper function is also an option.
Status: Issue closed
username_0: https://github.com/kubernetes/enhancements/pull/2054 |
kalexmills/github-vet-tests-dec2020 | 758493597 | Title: raylax/imx: router/message_router.go; 10 LoC
Question:
username_0: [Click here to see the code in its original context.](https://github.com/raylax/imx/blob/16e6e62e4d2f91cdeefb016d9ae4ec8c7b2a8c8f/router/message_router.go#L89-L98)
<details>
<summary>Click here to show the 10 line(s) of Go which triggered the analyzer.</summary>
```go
for endpoint, targetIds := range targetMap {
rpcClient := client.GetRpcClient(nodeMap[endpoint])
service := rpcClient.MessageService()
go func() {
_, err := service.Route(context.Background(), &pb.MessageRequest{TargetIds: targetIds, Message: message})
if err != nil {
log.Printf("failed to route message, error:%s", err)
}
}()
}
```
</details>
Leave a reaction on this issue to contribute to the project by classifying this instance as a **Bug** :-1:, **Mitigated** :+1:, or **Desirable Behavior** :rocket:
See the descriptions of the classifications [here](https://github.com/github-vet/rangeclosure-findings#how-can-i-help) for more information.
commit ID: <PASSWORD> |
BakeItHappen/version1 | 753379355 | Title: Finish Software Design Specification (User's Manual)
Question:
username_0: SDS: https://docs.google.com/document/d/1Skk1t2MMpEldER8xeQS63nTs3Pq4EplQdQ-quw5pZik/edit
Reference: https://canvas.humboldt.edu/courses/46023/files/2332859?module_item_id=846544
Reference File attached in case URL does not work
[UserManual_CalNote.pdf](https://github.com/BakeItHappen/version1/files/5615549/UserManual_CalNote.pdf)
Answers:
username_0: Completed everything exception 1.3 Security |
wmixvideo/nfe | 192596409 | Title: Web Service de Distribuição de DF-e
Question:
username_0: Alguém está trabalhando/desenvolvendo o Web Service de Distribuição de DF-e?
https://www.nfe.fazenda.gov.br/portal/exibirArquivo.aspx?conteudo=2Z%20kcHOdpHs=
Caso não estejam, pretendo criar em breve para que os citados nos documentos fiscais possam ter ciência dos documentos emitidos e facilitar a manifestação.
Answers:
username_0: Não confundir com MDF-e
username_1: Olá @username_0.
Creio que ninguém esteja trabalhando nisso ainda, visto que ninguém se manifestou.
Se puderes criar, será excelente!
username_2: @username_0, início algo?
Este webservice descontinuará outros: Data de desativação dos Web Services NfeConsultaDest e NFeDownloadNF: 02/05/2017
username_0: @username_2 @username_1 estava pretendendo desenvolver em 2017, pois eu estava precisando de férias depois de 16 anos sem parar. Vida de programador!
Vou tentar desenvolver alguma coisa antes que seja descontinuado.
No momento usamos o Manifestador de NF-e da Sefaz https://www.nfe.fazenda.gov.br/portal/listaConteudo.aspx?tipoConteudo=AxaPNP1BtFk=
username_1: Excelente @username_0!
Aproveite bem suas merecidas férias!
Até 2017!
username_2: @username_0, boas férias!!!
@username_1, pode assinar pra mim? não tenho permissão
username_1: També nao consegui assinar. Pelo visto somente consigo assinar pra quem cria o ticket ou pra alguém da equipe wmixvideo. Vou dar uma pesquisada mais a fundo nisso.
username_2: @username_1, cria um branch pra eu fazer um PR da parte que já escrevi.
Eu criei o Stub com Axis (mantendo a compatibilidade java 7) porém também criei os objects automatizados com xjc a partir dos XSDs. Isto traz uma grande agilidade de desenvolvimento mas "foge" ao padrão de criar nomes de campos diferenciados para os atributos dos objetos. Fiquei em dúvida sobre como vocês criaram os objetos (que fazem parse pra XML) anteriores, foi digitando mesmo? Podemos utilizar os nomes dos atributos conforme consta nos XSDs para "aproveitar" as ferramentas de automatização?
username_3: Conte comigo! Pra o MDF
username_2: @username_3, ótimo! Mas esta issue é do DFe, o MDF-e é na issue 211. Você tem interesse em qual delas?
username_1: @username_2 no passado, tivemos uma experiencia muito ruim com os geradores de codigo. Eles geravam classes duplicadas e ficava uma bagunça pra manter e evoluir. Isso motivou o uso do Simple e da escrita das classes na mão. Assim, quando uma atualização saia, incluiamos aquele campo e tudo ficava ok.
Com isso, aproveitamos pra gerar nomes de campos mais amigáveis, para que ficasse fácil para o desenvolvedor ler o codigo e entender, sem ter que estar com o manual na mão.
Essa foi a premissa básica da criação deste projeto e acho que devemos mantê-la.
Você está com alguma dificuldade de gerar as classes usando o Simple?
Att
username_2: @username_1, temos dois tipos de classes que podem ser gerados automaticamente:
1 - Stubs;
2 - Objetos que serão "parseados" pra XML;
1 - Os Stubs eu gerei com o plugin do maven axis2-wsdl2code-maven-plugin na versão 1.6.4 e deu certinho.
2 - Já os novos objetos eu gerei com o xjc do JAXB e também deu tudo certinho. Realmente algumas classes são duplicadas pois eu gerei XSD por XSD, mas só exclui as duplicações no final e adicionei o extends em algumas. E a geração já criou JavaDocs muito úteis como exemplo:
O seguinte fragmento do esquema especifica o conteúdo esperado contido dentro desta classe.
```
<complexType>
<complexContent>
<restriction base="{http://www.w3.org/2001/XMLSchema}anyType">
<sequence>
<element name="tpAmb" type="{http://www.portalfiscal.inf.br/nfe}TAmb"/>
<element name="verAplic" type="{http://www.portalfiscal.inf.br/nfe}TVerAplic"/>
<element name="cStat" type="{http://www.portalfiscal.inf.br/nfe}TStat"/>
<element name="xMotivo" type="{http://www.portalfiscal.inf.br/nfe}TMotivo"/>
<element name="dhResp" type="{http://www.portalfiscal.inf.br/nfe}TDateTimeUTC"/>
<element name="ultNSU" type="{http://www.portalfiscal.inf.br/nfe}TNSU"/>
<element name="maxNSU" type="{http://www.portalfiscal.inf.br/nfe}TNSU"/>
<element name="loteDistDFeInt" minOccurs="0">
<complexType>
<complexContent>
<restriction base="{http://www.w3.org/2001/XMLSchema}anyType">
<sequence maxOccurs="50">
<element name="docZip">
<complexType>
<simpleContent>
<extension base="<http://www.w3.org/2001/XMLSchema>base64Binary">
<attribute name="NSU" use="required" type="{http://www.portalfiscal.inf.br/nfe}TNSU" />
<attribute name="schema" use="required" type="{http://www.w3.org/2001/XMLSchema}string" />
</extension>
</simpleContent>
</complexType>
</element>
</sequence>
</restriction>
</complexContent>
</complexType>
</element>
</sequence>
<attribute name="versao" use="required" type="{http://www.portalfiscal.inf.br/nfe}TVerDistDFe" />
</restriction>
</complexContent>
</complexType>
```
Acho que desenvolver pro ambiente fiscal sem o Manual é meio improvável e particularmente não vejo problema em manter os nomes originais, no meu caso até facilita pois o nosso norte é a documentação oficial.
Neste [commit](https://github.com/username_2/nfe/commit/c0b88cc033273f51253079244be541ae3c684124) tem o Web Service de Distribuição funcionando (digamos que é uma versão base ainda sem os testes ou melhorias) pra você avaliar os pontos negativos antes de submeter um PR.
Manter um código não automatizado requer uma maior demanda de mão de obra, principalmente em momentos de mudança de layout ou implantação de novos serviços.
username_1: Dá trabalho sim, mas apenas na primeira vez. A manutenção fica bem mais simples, uma vez que a cada versao teremos que lembrar de sair apagando classes duplicadas. Passamos por isso desde a primeira versão da NFe e pra nós foi um inferno.
Outra coisa que temos que prezar é a padronização. Mudar para geração automática, além dos problemas reportados acima, ainda implicaria em regerar tudo novamente e criar wrappers para depreciação dos metodos antigos, para nao quebrar a compatibilidade (por padrao, em uma troca de versao marcamos como depreciados e na outra removermos, para facilitar a migração para os desenvolvedores).
username_2: @username_1, eu fiz vários outros testes e as classes duplicadas são geradas quando não configuramos direito o gerador de objetos. Os Stubs também foram gerados automaticamente e nem por isso optou-se por escrever Stubs "na mão".
Mas acho que utilizar o gerador ou escrever na mão não é a questão a ser discutida, a questão é se pretendemos remover ao máximo as dependências. Se este for um princípio do projeto (acho que li isto em algum post, deveria até ir pro README) remover o Simple Framework também tem que estar nos planos (mesmo que com baixa prioridade) e passar a utilizar javax.xml.bind.annotation será o caminho natural.
Consegui implementar aqui sem o Simple e sem o Axis e o projeto fica praticamente sem dependências (o próprio Joda tem que ser removido também...)
Sobre ter nomes amigáveis, embora eu não concorde muito porque "quebra" a compatibilidade com a documentação, acho que é uma questão muito de ponto de vista.
Bom, mas minha dúvida é: remover dependências é um princípio do Projeto? Neste caso o Axis, o Simple e Joda podem ser alvos de substituição por tecnologias nativas da JDK?
username_1: Absolutamente @username_2!
Este projeto foi concebido na troca da primeira para a segunda versão da NFe e muita coisa mudou de lá pra cá. Se conseguirmos usar somente o JDK padrão e funcionar ok, acho que devemos buscar isso!
Sobre os nomes amigáveis, podemos alterar sim, sem problema algum, se facilitar pra nós desenvolvedores, é absolutamente algo a ser implementado! O princípio da biblioteca é justamente facilitar (e fazer as coisas de forma bem feitas).
O que você acha de implementarmos, para essa nova versão da NFe (4.0), como você sugeriu, sem dependências externas? Você acha viável? Eu não uso geradores de código desde a versão 1.0 da NFe, é um ponto a ser testado. Se você acha viável, acho que poderiamos usar o branch 3.0 (ou até renomeá-lo para 4.0 e seguir junto com a versão da NFe) e iniciarmos os testes, pode ser?
username_2: Excelente @username_1, "sem dependências externas" acredito que não até porque nos testes que eu fiz precisei ainda do apache.commons e algumas outras (mas pouquíssimas), acredito que podemos reduzir quase totalmente o uso de dependências externas sim e já pra estão versão 3.0.
Com relação a alterar para 4.0 eu não concordo e faço é outra sugestão (eita que estou sugerindo d+ já ;) ), acho que deveríamos alterar o nome do projeto de nfe para dfe ou sped pois no momento que incorporar algo do CT-e (já tem um PR) ou do MDF-e (já tem uma issue) nós sairemos totalmente do projeto NF-e para outros projetos do grupo do SPED e o nome perderá o sentido pela abrangência dada.
Com relação a facilitar para o desenvolvedor eu pensei que poderia ser uma estratégia (quando os nomes amigáveis forem retirados) incluirmos no javadoc do atributo a descrição e observação que tem na documentação oficial, seria muito mais útil que o nome amigável e aí não precisaríamos escrever o código olhando para o Manual pois ele já estaria disponível.
Com relação aos geradores de código de objetos eles seriam utilizados somente para o bootstrap do objeto continuaríamos mantendo na mão os javadocs ou especificidades. Numa alteração de versão de layout geraríamos novamente mas só pra pegar os trechos novos / alterados para colar nos objetos já gerados.
username_2: Este serviço foi adicionado ao branch 3.0, alguém poderia fazer testes de consumo?
@username_0
username_4: Realizei os testes aqui utilizando sua Branch, porém não funcionou corretamente:
**Teste:**
```
RetDistDFeInt consultaDocumentoFiscal = new WSFacade(conf).consultaDocumentoFiscal("05405941000200", "", "0", NFUnidadeFederativa.MG);
String motivo = consultaDocumentoFiscal.getXMotivo();
System.out.printf("Motivo: %s\n", motivo);
```
**Saída:**
`Motivo: Rejeicao: Falha no esquema xml`
Status: Issue closed
|
WarEmu/WarBugs | 157511823 | Title: Lair of Silveroak
Question:
username_0: Dropped 2 Bulwark of the silvered Oak for engi class too like #6552
We cant put it on Auction House or Trade them because it says it is bound to player but it shouldnt.It should be Bound on Equip.
Source : http://warhammeronline.wikia.com/wiki/Silveroak
Answers:
username_1: Closing for the same reason as #6552.
Status: Issue closed
|
spring-cloud/spring-cloud-sleuth | 142888061 | Title: Programmatic Sampler does not stop Zipkin Span reports
Question:
username_0: I have a setup where I only want to trace incoming requests with a specific query parameter set (i.e. zipkin=true), which means that I've implemented my custom Sampler.
Now, even though the Sampler returns false, I still see requests to my Zipkin server (POST's to /v1/spans/) as my application creates outbound calls.
To me it seems that all Spans gets reported to Zipkin when originating from a RestTemplate, even though I've tried to disable them. Should I need to override the org.springframework.cloud.sleuth.instrument.web.TraceFilter as well as it seems like this filter is responsible for starting the spans?
My deps...
dependencyManagement {
imports {
mavenBom "org.springframework.cloud:spring-cloud-starter-parent:Brixton.M3"
mavenBom 'org.springframework.cloud:spring-cloud-sleuth:1.0.0.M5'
}
}
compile 'org.springframework.cloud:spring-cloud-sleuth-zipkin'
compile 'org.springframework.cloud:spring-cloud-starter-sleuth'
Answers:
username_0: I have reproduced my issue in https://github.com/username_0/zipkin-issue-always-reports
username_1: Can you check against latest snapshot?
username_0: Still the same using:
compile('org.springframework.cloud:spring-cloud-starter-sleuth:1.0.0.BUILD-SNAPSHOT')
compile('org.springframework.cloud:spring-cloud-starter-zipkin:1.0.0.BUILD-SNAPSHOT')
Are they the correct ones? And am I correct that this is a bug, meaning that the intention is to never report if the Span says "no"?
username_1: If you use this one - `compile('org.springframework.cloud:spring-cloud-starter-zipkin:1.0.0.BUILD-SNAPSHOT')` then you don't need Sleuth.
The idea is that this particular span will not be sent to zipkin. However all the tracing information will get passed. We want you to for example be able to see for a particular trace-id all the logs in Kibana or sth like that.
username_0: So you're saying is that by design traces "always" gets reported to Zipkin irregardless of your Sampler decision?
This will generate quite a lot of unnecessary traffic and seems unintuitive.
Say that you're using the default percentage based Sampler. It will still send a lot of requests to your Zipkin server and is probably not what the user expects.
Is there any configuration you could use to shut off reporting completely? Theoretically I could do the same check in a custom zipkinreporter that wraps the default http one, but that seems both risky (say I've switched thread by now and dont have the RequestContext) and unnecessary since I want to make the decision as fast as possible.
username_1: No - it will not send them to Zipkin but it will propagate the headers between applications.
username_0: Ok, so then you consider the issue as a bug as the ZipkinSpanReporter actually gets called from ZipkinSpanListener.serverSend()?
Just to clarify, I'm seeing the behaviour that the traces do get reported to Zipkin even though my Sampler returns false.
username_1: So yeah most likely sth's wrong. I think we should call `ZipkinSpanReporter` only if the span has the `exportable` flag. CC @dsyer @adriancole
username_0: Ok, great. I'd guess that the problem is a missing check for isExportable() in ZipkinSpanListener.serverSend(...).
username_1: Yeah - my bad. https://github.com/spring-cloud/spring-cloud-sleuth/blob/master/spring-cloud-sleuth-stream/src/main/java/org/springframework/cloud/sleuth/stream/StreamSpanReporter.java#L73 Here it's done properly. I'll file a fix in a second.
Status: Issue closed
|
rancher/rancher | 571474425 | Title: Validate oldest and latest versions supported for GKE , EKS and AKS
Question:
username_0: Validate oldest and latest versions supported for GKE , EKS and AKS.
As part of validation , deploy each of the supported version and run automated validation runs.
Answers:
username_1: Validated the following k8s versions:
GKE `v1.15.7-gke.23` and `v1.15.9-gke.9`
AKS `v1.15.5` and `v1.15.7`
EKS `v1.14`
Status: Issue closed
Status: Issue closed
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.