text
stringlengths
3
501
length
int64
1
100
Well on our ISA server there is a directory called C:\Program Files\Microsoft ISA Server\ISALogs that holds all the traffic it has seen passing through and details IP, Destination url/IP, date/time, type of browser etc etc.
56
electricdiary.com/chat-o-licious\n\nFrom the website:\nChat-o-licious is a proof of concept web-based chat application that uses an AJAX based browser client and a bare bones ASP.
43
Periods differ from person to person, I have some good periods and some bad, bottom line is you learn what is best for you as far as how horrible they are, for me I cannot wear tampons I find they make my cramps much worse so I wear pads.
56
Eastern Europe on the other hand is probably a lot less restrictive because everything there is done sort of like in Mexico, but the economy on the other hand is not much better, though it may be in a few years.
44
Brookline Property Management \n(617) 277-3900 \nAddress: 224 Washington St, Brookline, MA \nCountry: United States \nIndustry: Real Estate Agents and Managers \nLine of business: Real Estate Agent/Manager
54
It refers to the claim that food producers must pay an exorbitant amount to obtain the right to display a symbol on their products (usually a K or U in a circle) that indicates it is kosher or parve and that this cost is passed on to consumers through higher prices which constitute a "kosher tax
63
It went two seasons on Fox before the show was cancelled (dang shame, in my opinion)and then after some years, another channel decided to make a live action series out of it, which lasted all of two episodes.
46
Your father didn't inherit the house from probate -- someone left it to him in a will, and it has come out of probate, he now has title, and wants to convert it to cash.
42
The website explains it way better than I can, but basically the world was created by an invisible flying spaghetti monster who requires everyone to dress like pirates and all natural disasters are because of the shrinking number of pirates.
42
Considering the size of the universe, Its really not that big of an accomplishment to warrant an elaborate network of lies\n\nFor an incredibly in-depth analysis of pictures, facts and commentary please see the source link.
42
Guadalajara, in Mexico, has some quite good institutions for teaching spanish to foreings, also, great and cheap accomodations for students for summer courses, check with your school about those options.
42
I think that, as with basically every other major urban center with a large amount of immigration and close quarters, people in San Francisco, being surrouded by so many different kinds of people, tend to be more accepting of change and more accepting of various practices.
53
flash 6 allows some curious sub-domain access, while flash 7 and above allow arbitrary domains, provided an authorization file is served by the external domain.)\n\nMy opinion is that Flash is currently being grossly under-used by the Web 2.0 crowd, considering its potential.
59
There are 6 combinations\n3,5,7\n3,7,5\n5,3,7\n5,7,3\n7,5,3\n7,3,5
41
When light from the sun enters a droplet of rain, it refracts a tiny bit causing the colors of light to spread apart, the light then bounces, or reflects, off of the back of the droppled and refracts once again as it leave the dropplet on the same side it entered.
64
id just tell my landlord thats how i got rid of mine and if he's late on the rent just say\ndude listen u need 2 pay the rent i can't cover 4 u \nand then ask people 2 complain about the noise and tell him hey i have nothing against u but i can't stand 2 have sooooooooooo much noise around me
76
The concentration will be slightly higher than 1.0M\n\nThe correct procedure is to take a 1l volumetric flask and add the concentrated solution to about 800ml water, then fill up to the mark.
46
A light year is 5,865,696,000,000 miles (9,460,800,000,000 kilometers), so multiply this by 2.2 million and you have the distance in miles/kilometers.
47
Monahan & Cohen, Attorneys at Law\n\n225 West Washington Street, Suite 2300\nChicago, Illinois 60606 USA\nTelephone: (312) 419-0252\nFacsimile: (312) 419-7428\nTTY: (312) 419-7427
63
Due to the relativity of simultneity shown by Einstein, one cannot exactlt quantify the total number of stars in the universe at a given point in time, because an observer moving at a different speed and looking at that moment in time would disagree as to which stars had already exploded or not, and which stars had already formed or not.
69
their are many ways for people to grab your passwords, trojan horse, and other methods, trying your username and password over a non-secure link can let people see them, so check for the small yellow pad-lock when doing personal stuff like bank data, on the right hand side, down the bottem, but again, people can steel usernames and passwords many many ways in todays world, from hardware devices to software
85
\n\nMost atoms are composed of three types of massive subatomic particles which govern their external properties:\n\n * electrons, which have a negative charge and are the least massive of the three;\n * protons, which have a positive charge and are about 1836 times more massive than electrons;
61
Once you decide to play these in public - such as in a restaurant, bar, café or telephone music-on-hold service - it becomes an additional performance of the music, which is known as a "public performance."
44
Perhaps initially, but it begins to wear off after 4 or 5 days to the point where you can live without it for a little while :-)\n\nJust answer a boat-load of questions with highly accurate answers and then hope that you keep collecting points from your answers while you are away!
60
I am sure you have also heard it in movies and usually referring to Criminals when the Police say that's his or her M.O. They are talking about the way they do something and that usually entails rituals or repeated actions.
46
this thing is definitly awesome for its price of $3400 (i got for 2900 at my local retailer)\n\nThere really arnt any cons to sharing with the runco, both your TV and computer will show up in an extremely high resolution.
54
Springfield Technical Community College, School Of Nursing\n1 Armory Sq Ste 1, Springfield, MA 01105\n(413) 755-4973\n\nBaystate Medical Center, School Of Nursing\n11 Wilbraham Rd, Springfield, MA 01109\n(413) 794-4303\n\nAmerican International College, Division of Nursing\n1000 State Street Springfield, MA 01109\nPhone: (413) 205-3519
96
\n\nregister with this site and in the General Hardware area start a topic with the same question you asked here and you will get noting but technaclity answers here and there willing to answer because they like to show there skills off to new people :) so have fun!
54
\n\nYou have to work day and night, with a lot of willing crew, a hell of a plan and no sulky workers :oD\n\nNormally in will take about 2 to 3 weeks for such project.
47
so in the eyes of majority of people around the world, (and here i am talking about people who think for themselves, not people who are easily led by popular media, which is usually pro-US anyway), americans have always been viewed as cavalier adventureres at best and murdering cowards at best, who bomb impoverished countries from heights before moving in their army.
74
Unless you've left out some important detail, she is not going to be angry about being asked out for dinner, if she says "no" accept it gracefully and just say "Maybe some other time" Her response to that will tell you if she's interested or not.
55
6 months later it was flat and only minorly discolored, 8 months later it was no longer painful to the touch and the coloration had gone, 10 months later it no longer hurt to run.
44
Further, (to mock Final Fantasy 7) the book has "a cast of thousands" which, considering most of them are not significant to warrant having names, makes their background and side stories seem trite and out of place.
47
friend,since there are some air molecules present in the flour with water,when it is dropped into oil the air inside it will expand raising the surrounding layer,puffing can be induced more by adding soda powder to wheat flour
45
Well you should believe what people is telling you because if you go on in that relationship you're having and then you see him with that girl is going to hurt you, and its better to let it go now even though it will hurt but not as much if you found out that it is true
59
\n\nMy modified xbox runs XBMC (A special dashboard or operating system) It takes a link to an RSS feed in the configuration, and on the main home screen it displays a list of news articles on the RSS feed.
46
hey girl my ex boyfriend for 1year and a month he also went out with one of my friends when they were going out he relized that he should be with me just give the guy time and maybe you to will get back together just give him space and let him relize that you are the one for him
64
It's "I'm" not "im"\n"Michael" not "mickel"\n"Jackson" not jackson"\n"your" not "ur"\n"Tito" not "tido"\n\nYou did spell the word "and" correctly.
57
I would do this because I would love to own my own home and would make sure it is medium size( nothing fancy) with lots of trees and maybe a big yard that I could let my dogs run free in.
44
just go around the others standing in line and if you bleep walking out the door then they have to check you they should only be checking the people that have large carryout items not just sacks unless the alarm goes off
44
I would dissolve the TMB at a very high concentration (100-1000 times the concentration you would like as the final) in DMSO at pH 7 and then add just a small amount of this concentrate to your sample at pH4.5.
53
A series of decrees or ordinances set forth by Charles X of France in July 1830 (and his chief minister Jules Armand du Polignac.) They did such things as attempt greater controls on the press, deprive three-quarters of French voters of the right to vote, dissolve PArliament, and call for a new election (with the new electorate.)\n\nReaction: the July Revolution.
84
More than likely, a virus or spam email sent by another person is using your address as a return address, which will result in you getting a failed email message even though you may have not originated the email.
42
\n\nIf you wear a condom you reduce your risk of ALL STD's some to the point where it is almost impossible to contract them, But there are still some it is possible to get, such as genital herpes, genital warts and public lice (crabs).
55
United states with the help of germans :)\n\nRobert Oppenheimer, David Bohm, Leo Szilard, Eugene Wigner, Otto Frisch, Rudolf Peierls, Felix Bloch, Niels Bohr, Emilio Segre, James Franck, Enrico Fermi, Klaus Fuchs and Edward Teller
70
Stretch marks that are new and still red have up to an 80% chance of decreasing with Retin A. Stretch marks that are already white and are old will not go away - they are scars.
41
The hour was originally defined in ancient civilisations (including those of Egypt, Sumeria, India and China) as either one twelfth of the time between sunrise and sunset or one twenty-fourth of a full day.
45
If she is nasty to you just turn the other cheek, and explain to your children that you are going for your m-i-l and not take anything that your sister in law says to you to heart.
41
\n\nKrungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.
69
IT pros : 12" \nS/w developers : 15" (widescreen)\ngraphic artists : 17" (widescreen)\nPower users: 14.1"
41
Further some of the answers are easily available on the net - for such people the best answer is just a link or even more punishing - copying & pasting it so that they are forced to read it!
41
Nowadays, it is very common for people to go9 back to college after working for awhile, and it with the way technology is always changing, it would not hurt to get a few classes in to update yourself.
44
Considering the focus of early civilization on astronomy, it almost certainly was a planetary alignment, or possibly Jupiter in retrograde motion, which moves extremely fast and in a definite direction, and for the approximate length of time of the wise men's journey.
49
MgO(s)+ CO2(g) (dolomite calcining)\n (Fe,Si)(s) + MgO(s) ↔ Fe(s) + SiO2(s) + Mg(g)\n CaO + SiO2 → CaSiO3\n\nThe Pidgeon process is a batch process in which finely powdered calcined dolomite and ferrosilicon are mixed, briquetted, and charged retorts of made of nickel-chrome-steel alloy.
99
It is used in manufacturing \nAmphetamine \nPrenylamine \nPargyline \nEstramustine \nChlorophacinone & Diphacinone (rodenticides)
43
\n\nB-If she totally ignore's u and get's really nervous around u and seem's to want to get out as soon as possible as to not embarrass herself then she probably like's u.
41
\nClick "OK" \nIf you want to disable the feature entirely so none of your searches are saved, do the following: \n\nClick on the Pencil menu \nSelect "Toolbar Options" \nClick "Remember Recent Searches" so that there is not a checkmark in the box next to it \nClick "OK"
71
\nIf you use th eports collection update :\ncd /usr/ports/net/samba3;\nmake install clean\n\nor with packages :\npkg_add -r samba3\n\nThen I strongly suggest that you follow the instructions from the FreebSD handbook you can find at :\nhttp://www.
66
75.1 % of respondents said they were White and no other race\n12.3 % are of Black or African-American descent\n12.5 % Hispanics - who may belong to any race \n3.6 % of respondents are Asian
49
\n\nSunrise (Murnau)\nThe General (Buster Keaton)\nCity Lights (Charlie Chaplin)\nUn Chien Andalou (Luis Bunuel)\nThe Man with the Movie Camera (Vertov)
48
Solar Sails, along with fusion motors, Bussard ramjets, antimatter drives, and Von Neumann machines are the various technologies being research as possible ways to further our manned and robotic exploration of space outside of our own solar system.
49
Be warned though, you might find it too interesting and get too curious like me and end up being a physics major just to get some questions answered, and more do get answered the farther you go in physics haha.
43
Other ways to improve sperm count and quality:\n\n- avoid the use of spas or jacuzzis, or immersing the male organs in hot water\n- avoid driving a car for a long time\n- avoid riding a bicycle for a long time\n- have a healthy diet\n- exercise
61
According to what I understand about Scientology (not an immense amount, but enough to have an opinion - ;-)), the Scientologist does not believe that we are ultimately material beings, therefore, anything that is happening to us physically is not really happening, it is an illusion.
54
A lobster may live in a tank indefinitely provided it has the correct diet, the nitrate levels in the water are controlled and corrected, as well as the level(s) of ammonia, nitrite, pH, salinity, calcium, alkalinity, iodine
52
In order to trigger the explosion of the gun powder, you do need an oxidizer to initiate the chemical reaction, but most gun ammunition comes with its own oxidizer built in so therefore, the gun can fire even without oxygen.
46
For your safety, your friend safety and for everyone else driving that night I would suggest for either one of you to be the designated driver or to stay in a local motel and get home little late in the morning!
43
htm It covers various aspects of starting and running a daycare center including the demand for daycare centers, how to start this business, shoestring strategies, how to operate a daycare center, tips on caring for the children, income potential, how to manage your daycare, marketing your business and other additional income potential.
61
After New York Giants manager John McGraw told reporters that Philadelphia manufacturer Benjamin Shibe, who owned the controlling interest in the new team, had a “white elephant on his hands," Mack defiantly adopted the white elephant as the team mascot, though over the years the elephant has appeared in several different colors (currently forest green).
65
\n\nAs for connecting countries themselves, there is/was (not sure if it is still in use but I think it is) something called the TransAtlantic Cable which originally carried the ability for telephone service overseas.
43
i.e in the US to send an sms to a verizon subscriber it needs to go phone#@vtext.com and tmobile goes to tmomail.net You can see some more at http://cellphones.
43
\n\nRay Kurzweil is a well-known predictor of technology trends and suggests that the technology to 'move' a person from their brain to an electronic replica will happen in the not-so-distant future.
43
You should be able to call the hospital that you went to and talk to a financial counseler, and explain to them your hardship and moe than likely they will give you assistance and write the bill off.
43
This is used to map where in the body metabolism is occuring by having a person take in small amounts of radioactive sugar (by injection), and then seeing where in the body sugar is being uptaken the most, by looking at the release of positrons by the decay of the radioactive label on the sugar.
62
No even if you have connections then its pretty hard because everyone wants to be in the show bisness and it involves alot of talent even if you have connections they wont reccomend you to any one if you dont have talent.
47
\n\n(2) View the page source code and search for the keyword ‘googleplayer‘\n\n(3) Copy and paste the videoUrl parameter (all of the characters after the keyword ‘videoUrl=’)\n\n(4) Press Ctrl-L to go to URL location bar.
61
\n\nYou should get "Viva La Woman" by Cibo Matto first\n\nThen try out these:\n\nPuffy AmiYumi "Nice"\nShonen Knife "Let's Knife"\nBuffalo Daughter "New Rock"\n\nThese are what you are looking for and all are great.
66
\n\nBy the way, pay attention to units: 56kbps = 56 kiloBITS per second = 7 kiloBYTES per second (7 kBps), theoretical maximum speed of dial-up.
43
\n\nIf you need software, check out free or shareware programs on download.com for software that will help you assemble the frames of your animation, like the trial version of Ulead GIF Animator 5.0 (which is supposedly pretty easy to use).
52
\n\nA less well-known requirement is that you must be a resident of a particular single *state* 3 months before applying for citizenship -- I'm not sure what state residency means -- it may be as simple as having a particular driver's license.
51
From the Orientation section of Modify Page Layout dialog box, select Portrait (sounds like it got switched to Landscape by accident in your case)\n\nSteps above are summarized from page 38 of Adobe Acrobat PDF document listed in Sources section of this Answer.
50
You seem to be happy when you are talking to guys in general, not just when you are talking to your boyfriend, so that would lead me to believe that you are lonely when you are on your own.
42
\n\nAslan - Yeshua (Jesus)\nThe Kids - Christians\nEdmond - redeamed prideful sinner\nWhite Witch - Satan\nThe Altar - The Law of Sin and Death\nNarnia - The World under the curse of sin\nPeter's sword - The Word of God\nPeter's shield - Faith\n\nBTW - A great movie and fantastic portrayal of the White Witch by Tilda Swinton!
89
\n\nAssessments may be done by visual inspection or a more quantifiable measure, like the size of necrotic lesions (e.g. on leaves) or reduction of yield (for agrocultural crops).
44
Your question about a multiplicity of Big Bangfs is a good one: perhaps the biggest cosmological debate about the nature of the universe is whether the universe will expand forever, or whether it will ultimately contract again into a state similar to just prior to the Big Bang.
54
crt (big) monitors are sharper then lcd (flat screen) but lcd do save space , power, and less heat to,watch the warranty on flat screen they dont last a long as crt do
41
But in terms of Human Development Index and life standard of the people, Kerala is much ahead of most other states in India, and, in fact, in certain development indices it is on a par with some of the developed countries.
46
\n\nUntil recently, the path of least resistance has been to run a pretty intuitive needs analysis, lock yourself in room for a few days, and come back with a functional, if not fully populated, demonstration site that thay can take to higher management.
51
The Turkish Emancipation was a period of internal and external conflict in which Kemal Ataturk, war hero from WWI, overcame the old regime and introduced a western, laicist government to the Turkish state.
45
\n\nThe First Provincial Council of Westminster urged that its members should be used in both Sunday and day-schools, but while Sunday-schools are plentiful, the confraternity is only sparsely established in England.
44
(Y-y1) = m(X-x1)\non point (4,7) => Y-7 = m(X-4) (I)\non point (2,5) => Y-5 = m(X-2) (II)\n\n(I&II) ==> m = 1
61
\nTo enhance recreational fishing and sport diving opportunities in coastal waters, and to increase the amount of productive hard-bottom habitat available overall, man can participate (with significant help from nature) in the creation of additional man-made, or "artificial" reefs.
51
\n\nFirst, calculate the molality of the the solution\n\nMolality = moles of solute per kiograms of solven\n\n\n2.0 moles of NaCl / 1 kg solvent = 2.0\n\nDT=Kb * m\n= [.
61
It reflects better on you if you go to them first, and they are usually more willing to work things out if they know what is coming, and they have programs for most situations, such as deferring interest on a mortgage loan, or lowering the minimum payment.
53
once your child is born talk to your baby often and in an adult manner (no baby talk) play classical music and teach it another language if you stay consistant with this for years you will have a toddler who can probaly play an instrument or read and write or do math.
57
How can you love me so much as to give your only begotten Son to suffer and die to redeam my lost soul--then turn around and pardon all my sins, give me an inheritance I do not deserve, and top it all off with a joy unspeakable while I sit here and type this on my 50th birthday?
69
Depending on the volume of compressible air within, the weight and density of the ball material, the density of the water and the pressure on the ball, it will first keep wanting to go up until it is compressed so far that there is an equilibrium, i.e. nothing happens.
57
You also could possibly write a letter to the manager or director of the government offices, while sending a copy to your congressman, alderman, commisioner, or what have you, clearly indicating exactly what it is that you think should be done.
51
Their policy though is to charge a restocking fee: "Restocking Fees: Unless the product is defective or the return is a direct result of a Dell error, a restocking fee of 15% may be charged on hardware, accessories, peripherals, parts and unopened software still in its/their sealed package, and on software that has not been downloaded if the software is delivered electronically."
79
S, Statistically most names start with S.\nS for Satyam,\nS for Shivam\nS for Sundram\nS for Secret\nS for Scary\nS for Social\nS for Simple\nS for Siesta\nS for Software\nS for Sexy\nS for Shivani
62