contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
377 | A | Maze | PROGRAMMING | 1,600 | [
"dfs and similar"
] | null | null | Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him. | The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall. | Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them. | [
"3 4 2\n#..#\n..#.\n#...\n",
"5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n"
] | [
"#.X#\nX.#.\n#...\n",
"#XXX\n#X#.\nX#..\n...#\n.#.#\n"
] | none | 500 | [
{
"input": "5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#",
"output": "#XXX\n#X#.\nX#..\n...#\n.#.#"
},
{
"input": "3 3 2\n#.#\n...\n#.#",
"output": "#X#\nX..\n#.#"
},
{
"input": "7 7 18\n#.....#\n..#.#..\n.#...#.\n...#...\n.#...#.\n..#.#..\n#.....#",
"output": "#XXXXX#\nXX#X#X.\nX#XXX#.\nXXX#...\nX#...#.\nX.#.#..\n#.....#"
},
{
"input": "1 1 0\n.",
"output": "."
},
{
"input": "2 3 1\n..#\n#..",
"output": "X.#\n#.."
},
{
"input": "2 3 1\n#..\n..#",
"output": "#.X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n..#",
"output": "...\n.#X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n#..",
"output": "...\nX#.\n#.."
},
{
"input": "5 4 4\n#..#\n....\n.##.\n....\n#..#",
"output": "#XX#\nXX..\n.##.\n....\n#..#"
},
{
"input": "5 5 2\n.#..#\n..#.#\n#....\n##.#.\n###..",
"output": "X#..#\nX.#.#\n#....\n##.#.\n###.."
},
{
"input": "4 6 3\n#.....\n#.#.#.\n.#...#\n...#.#",
"output": "#.....\n#X#.#X\nX#...#\n...#.#"
},
{
"input": "7 5 4\n.....\n.#.#.\n#...#\n.#.#.\n.#...\n..#..\n....#",
"output": "X...X\nX#.#X\n#...#\n.#.#.\n.#...\n..#..\n....#"
},
{
"input": "16 14 19\n##############\n..############\n#.############\n#..###########\n....##########\n..############\n.#############\n.#.###########\n....##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###....#......\n#...#...##.###",
"output": "##############\nXX############\n#X############\n#XX###########\nXXXX##########\nXX############\nX#############\nX#.###########\nX...##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###...X#......\n#X..#XXX##.###"
},
{
"input": "10 17 32\n######.##########\n####.#.##########\n...#....#########\n.........########\n##.......########\n........#########\n#.....###########\n#################\n#################\n#################",
"output": "######X##########\n####X#X##########\nXXX#XXXX#########\nXXXXXXXXX########\n##XXX.XXX########\nXXXX...X#########\n#XX...###########\n#################\n#################\n#################"
},
{
"input": "16 10 38\n##########\n##########\n##########\n..########\n...#######\n...#######\n...#######\n....######\n.....####.\n......###.\n......##..\n.......#..\n.........#\n.........#\n.........#\n.........#",
"output": "##########\n##########\n##########\nXX########\nXXX#######\nXXX#######\nXXX#######\nXXXX######\nXXXXX####.\nXXXXX.###.\nXXXX..##..\nXXX....#..\nXXX......#\nXX.......#\nX........#\n.........#"
},
{
"input": "15 16 19\n########.....###\n########.....###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n.....#####.#..##\n................\n.#...........###\n###.########.###\n###.########.###",
"output": "########XXXXX###\n########XXXXX###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\nXXXX.#####.#..##\nXXX.............\nX#...........###\n###.########.###\n###X########.###"
},
{
"input": "12 19 42\n.........##########\n...................\n.##.##############.\n..################.\n..#################\n..#################\n..#################\n..#################\n..#################\n..#################\n..##########.######\n.............######",
"output": "XXXXXXXXX##########\nXXXXXXXXXXXXXXXXXXX\nX##X##############X\nXX################X\nXX#################\nXX#################\nXX#################\nX.#################\nX.#################\n..#################\n..##########.######\n.............######"
},
{
"input": "3 5 1\n#...#\n..#..\n..#..",
"output": "#...#\n..#..\nX.#.."
},
{
"input": "4 5 10\n.....\n.....\n..#..\n..#..",
"output": "XXX..\nXXX..\nXX#..\nXX#.."
},
{
"input": "3 5 3\n.....\n..#..\n..#..",
"output": ".....\nX.#..\nXX#.."
},
{
"input": "3 5 1\n#....\n..#..\n..###",
"output": "#....\n..#.X\n..###"
},
{
"input": "4 5 1\n.....\n.##..\n..#..\n..###",
"output": ".....\n.##..\n..#.X\n..###"
},
{
"input": "3 5 2\n..#..\n..#..\n....#",
"output": "X.#..\nX.#..\n....#"
},
{
"input": "10 10 1\n##########\n##......##\n#..#..#..#\n#..####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########",
"output": "##########\n##......##\n#..#..#..#\n#X.####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########"
},
{
"input": "10 10 3\n..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######..\n.#######..\n.####..###\n.......###",
"output": "..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######X.\n.#######XX\n.####..###\n.......###"
},
{
"input": "5 7 10\n..#....\n..#.#..\n.##.#..\n..#.#..\n....#..",
"output": "XX#....\nXX#.#..\nX##.#..\nXX#.#..\nXXX.#.."
},
{
"input": "5 7 10\n..#....\n..#.##.\n.##.##.\n..#.#..\n....#..",
"output": "XX#....\nXX#.##.\nX##.##.\nXX#.#..\nXXX.#.."
},
{
"input": "10 10 1\n##########\n##..##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########",
"output": "##########\n##.X##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########"
},
{
"input": "4 5 1\n.....\n.###.\n..#..\n..#..",
"output": ".....\n.###.\n..#..\n.X#.."
},
{
"input": "2 5 2\n###..\n###..",
"output": "###X.\n###X."
},
{
"input": "2 5 3\n.....\n..#..",
"output": "X....\nXX#.."
},
{
"input": "12 12 3\n############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######..#\n#.#######..#\n#.####..####\n#.......####\n############",
"output": "############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######X.#\n#.#######XX#\n#.####..####\n#.......####\n############"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n#####",
"output": ".....\n.##.X\n..###\n..###\n#####"
},
{
"input": "4 4 1\n....\n.#..\n..##\n..##",
"output": "....\n.#.X\n..##\n..##"
},
{
"input": "5 5 1\n....#\n.##..\n.##..\n...##\n...##",
"output": "....#\n.##..\n.##.X\n...##\n...##"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n..###",
"output": ".....\n.##.X\n..###\n..###\n..###"
},
{
"input": "4 5 1\n#....\n#.#..\n..###\n..###",
"output": "#....\n#.#.X\n..###\n..###"
},
{
"input": "4 4 3\n....\n.#..\n..##\n..##",
"output": "...X\n.#XX\n..##\n..##"
},
{
"input": "4 7 6\n.......\n....#..\n.##.#..\n....#..",
"output": "X......\nX...#..\nX##.#..\nXXX.#.."
},
{
"input": "8 8 7\n........\n.##.....\n.#######\n..######\n..######\n..######\n..######\n..######",
"output": ".....XXX\n.##.XXXX\n.#######\n..######\n..######\n..######\n..######\n..######"
}
] | 1,696,014,785 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 10 | 280 | 3,174,400 | def main():
n, m, k = (int(value) for value in input().split(' '))
array = [list(input()) for _ in range(n)]
for i in range(n):
for j in range(m):
if k > 0:
if array[i][j] == '.':
array[i][j] = 'X'
k -= 1
else:
for i in range(n):
for j in range(m):
print(array[i][j], end='')
print()
return
if __name__ == "__main__":
main() | Title: Maze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall.
Output Specification:
Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them.
Demo Input:
['3 4 2\n#..#\n..#.\n#...\n', '5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n']
Demo Output:
['#.X#\nX.#.\n#...\n', '#XXX\n#X#.\nX#..\n...#\n.#.#\n']
Note:
none | ```python
def main():
n, m, k = (int(value) for value in input().split(' '))
array = [list(input()) for _ in range(n)]
for i in range(n):
for j in range(m):
if k > 0:
if array[i][j] == '.':
array[i][j] = 'X'
k -= 1
else:
for i in range(n):
for j in range(m):
print(array[i][j], end='')
print()
return
if __name__ == "__main__":
main()
``` | 0 |
|
743 | C | Vladik and fractions | PROGRAMMING | 1,500 | [
"brute force",
"constructive algorithms",
"math",
"number theory"
] | null | null | Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1. | The single line contains single integer *n* (1<=≤<=*n*<=≤<=104). | If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them. | [
"3\n",
"7\n"
] | [
"2 7 42\n",
"7 8 56\n"
] | none | 1,250 | [
{
"input": "3",
"output": "2 7 42"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "2",
"output": "2 3 6"
},
{
"input": "5",
"output": "5 6 30"
},
{
"input": "4",
"output": "4 5 20"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "82",
"output": "82 83 6806"
},
{
"input": "56",
"output": "56 57 3192"
},
{
"input": "30",
"output": "30 31 930"
},
{
"input": "79",
"output": "79 80 6320"
},
{
"input": "28",
"output": "28 29 812"
},
{
"input": "4116",
"output": "4116 4117 16945572"
},
{
"input": "1",
"output": "-1"
},
{
"input": "6491",
"output": "6491 6492 42139572"
},
{
"input": "8865",
"output": "8865 8866 78597090"
},
{
"input": "1239",
"output": "1239 1240 1536360"
},
{
"input": "3614",
"output": "3614 3615 13064610"
},
{
"input": "5988",
"output": "5988 5989 35862132"
},
{
"input": "8363",
"output": "8363 8364 69948132"
},
{
"input": "737",
"output": "737 738 543906"
},
{
"input": "3112",
"output": "3112 3113 9687656"
},
{
"input": "9562",
"output": "9562 9563 91441406"
},
{
"input": "1936",
"output": "1936 1937 3750032"
},
{
"input": "4311",
"output": "4311 4312 18589032"
},
{
"input": "6685",
"output": "6685 6686 44695910"
},
{
"input": "9060",
"output": "9060 9061 82092660"
},
{
"input": "1434",
"output": "1434 1435 2057790"
},
{
"input": "3809",
"output": "3809 3810 14512290"
},
{
"input": "6183",
"output": "6183 6184 38235672"
},
{
"input": "8558",
"output": "8558 8559 73247922"
},
{
"input": "932",
"output": "932 933 869556"
},
{
"input": "7274",
"output": "7274 7275 52918350"
},
{
"input": "9648",
"output": "9648 9649 93093552"
},
{
"input": "2023",
"output": "2023 2024 4094552"
},
{
"input": "4397",
"output": "4397 4398 19338006"
},
{
"input": "6772",
"output": "6772 6773 45866756"
},
{
"input": "9146",
"output": "9146 9147 83658462"
},
{
"input": "1521",
"output": "1521 1522 2314962"
},
{
"input": "4938",
"output": "4938 4939 24388782"
},
{
"input": "6143",
"output": "6143 6144 37742592"
},
{
"input": "6230",
"output": "6230 6231 38819130"
},
{
"input": "10000",
"output": "10000 10001 100010000"
},
{
"input": "1",
"output": "-1"
},
{
"input": "101",
"output": "101 102 10302"
},
{
"input": "9999",
"output": "9999 10000 99990000"
},
{
"input": "512",
"output": "512 513 262656"
},
{
"input": "511",
"output": "511 512 261632"
},
{
"input": "513",
"output": "513 514 263682"
},
{
"input": "9973",
"output": "9973 9974 99470702"
},
{
"input": "9972",
"output": "9972 9973 99450756"
},
{
"input": "9974",
"output": "9974 9975 99490650"
},
{
"input": "9409",
"output": "9409 9410 88538690"
},
{
"input": "9408",
"output": "9408 9409 88519872"
},
{
"input": "9410",
"output": "9410 9411 88557510"
},
{
"input": "719",
"output": "719 720 517680"
},
{
"input": "720",
"output": "720 721 519120"
},
{
"input": "721",
"output": "721 722 520562"
},
{
"input": "9796",
"output": "9796 9797 95971412"
},
{
"input": "9797",
"output": "9797 9798 95991006"
},
{
"input": "9798",
"output": "9798 9799 96010602"
},
{
"input": "4999",
"output": "4999 5000 24995000"
},
{
"input": "9998",
"output": "9998 9999 99970002"
}
] | 1,626,499,105 | 2,147,483,647 | PyPy 3 | OK | TESTS | 62 | 109 | 20,172,800 | # link: https://codeforces.com/problemset/problem/743/C
for _ in range(1):
n = int(input())
ans = -1
if n != 1:
a = n
b = n + 1
c = b * a
if a!=b and b!=c and a!=c:
print(a,b,c)
else: print(ans)
else:
print(ans) | Title: Vladik and fractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
Input Specification:
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
Output Specification:
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '7\n']
Demo Output:
['2 7 42\n', '7 8 56\n']
Note:
none | ```python
# link: https://codeforces.com/problemset/problem/743/C
for _ in range(1):
n = int(input())
ans = -1
if n != 1:
a = n
b = n + 1
c = b * a
if a!=b and b!=c and a!=c:
print(a,b,c)
else: print(ans)
else:
print(ans)
``` | 3 |
|
401 | A | Vanya and Cards | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value.
Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero?
You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*. | The first line contains two integers: *n* (1<=≤<=*n*<=≤<=1000) — the number of found cards and *x* (1<=≤<=*x*<=≤<=1000) — the maximum absolute value of the number on a card. The second line contains *n* space-separated integers — the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value. | Print a single number — the answer to the problem. | [
"3 2\n-1 1 2\n",
"2 3\n-2 -2\n"
] | [
"1\n",
"2\n"
] | In the first sample, Vanya needs to find a single card with number -2.
In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value. | 500 | [
{
"input": "3 2\n-1 1 2",
"output": "1"
},
{
"input": "2 3\n-2 -2",
"output": "2"
},
{
"input": "4 4\n1 2 3 4",
"output": "3"
},
{
"input": "2 2\n-1 -1",
"output": "1"
},
{
"input": "15 5\n-2 -1 2 -4 -3 4 -4 -2 -2 2 -2 -1 1 -4 -2",
"output": "4"
},
{
"input": "15 16\n-15 -5 -15 -14 -8 15 -15 -12 -5 -3 5 -7 3 8 -15",
"output": "6"
},
{
"input": "1 4\n-3",
"output": "1"
},
{
"input": "10 7\n6 4 6 6 -3 4 -1 2 3 3",
"output": "5"
},
{
"input": "2 1\n1 -1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "8 13\n-11 -1 -11 12 -2 -2 -10 -11",
"output": "3"
},
{
"input": "16 11\n3 -7 7 -9 -2 -3 -4 -2 -6 8 10 7 1 4 6 7",
"output": "2"
},
{
"input": "67 15\n-2 -2 6 -4 -7 4 3 13 -9 -4 11 -7 -6 -11 1 11 -1 11 14 10 -8 7 5 11 -13 1 -1 7 -14 9 -11 -11 13 -4 12 -11 -8 -5 -11 6 10 -2 6 9 9 6 -11 -2 7 -10 -1 9 -8 -5 1 -7 -2 3 -1 -13 -6 -9 -8 10 13 -3 9",
"output": "1"
},
{
"input": "123 222\n44 -190 -188 -185 -55 17 190 176 157 176 -24 -113 -54 -61 -53 53 -77 68 -12 -114 -217 163 -122 37 -37 20 -108 17 -140 -210 218 19 -89 54 18 197 111 -150 -36 -131 -172 36 67 16 -202 72 169 -137 -34 -122 137 -72 196 -17 -104 180 -102 96 -69 -184 21 -15 217 -61 175 -221 62 173 -93 -106 122 -135 58 7 -110 -108 156 -141 -102 -50 29 -204 -46 -76 101 -33 -190 99 52 -197 175 -71 161 -140 155 10 189 -217 -97 -170 183 -88 83 -149 157 -208 154 -3 77 90 74 165 198 -181 -166 -4 -200 -89 -200 131 100 -61 -149",
"output": "8"
},
{
"input": "130 142\n58 -50 43 -126 84 -92 -108 -92 57 127 12 -135 -49 89 141 -112 -31 47 75 -19 80 81 -5 17 10 4 -26 68 -102 -10 7 -62 -135 -123 -16 55 -72 -97 -34 21 21 137 130 97 40 -18 110 -52 73 52 85 103 -134 -107 88 30 66 97 126 82 13 125 127 -87 81 22 45 102 13 95 4 10 -35 39 -43 -112 -5 14 -46 19 61 -44 -116 137 -116 -80 -39 92 -75 29 -65 -15 5 -108 -114 -129 -5 52 -21 118 -41 35 -62 -125 130 -95 -11 -75 19 108 108 127 141 2 -130 54 96 -81 -102 140 -58 -102 132 50 -126 82 6 45 -114 -42",
"output": "5"
},
{
"input": "7 12\n2 5 -1 -4 -7 4 3",
"output": "1"
},
{
"input": "57 53\n-49 7 -41 7 38 -51 -23 8 45 1 -24 26 37 28 -31 -40 38 25 -32 -47 -3 20 -40 -32 -44 -36 5 33 -16 -5 28 10 -22 3 -10 -51 -32 -51 27 -50 -22 -12 41 3 15 24 30 -12 -34 -15 -29 38 -10 -35 -9 6 -51",
"output": "8"
},
{
"input": "93 273\n-268 -170 -163 19 -69 18 -244 35 -34 125 -224 -48 179 -247 127 -150 271 -49 -102 201 84 -151 -70 -46 -16 216 240 127 3 218 -209 223 -227 -201 228 -8 203 46 -100 -207 126 255 40 -58 -217 93 172 -97 23 183 102 -92 -157 -117 173 47 144 -235 -227 -62 -128 13 -151 158 110 -116 68 -2 -148 -206 -52 79 -152 -223 74 -149 -69 232 38 -70 -256 -213 -236 132 -189 -200 199 -57 -108 -53 269 -101 -134",
"output": "8"
},
{
"input": "1 1000\n997",
"output": "1"
},
{
"input": "4 3\n2 -1 -2 -1",
"output": "1"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "2 2\n1 -1",
"output": "0"
},
{
"input": "2 2\n-1 1",
"output": "0"
},
{
"input": "2 3\n-1 1",
"output": "0"
},
{
"input": "2 2\n-2 2",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "2"
},
{
"input": "4 2\n-1 -1 -1 -1",
"output": "2"
},
{
"input": "4 1\n-1 -1 -1 1",
"output": "2"
},
{
"input": "3 2\n2 2 2",
"output": "3"
},
{
"input": "10 300\n300 300 300 300 300 300 300 300 300 300",
"output": "10"
}
] | 1,669,461,099 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 46 | 0 |
n, m = map(int, input().split())
l = list(map(int, input().split()))
s = set(l)
c = 0
s1 = set()
for i in l:
if i != 0 and i not in s1:
c += abs(l.count(i)-l.count(i*-1))
s1.add(i)
s1.add(i*-1)
print(c) | Title: Vanya and Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value.
Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero?
You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*.
Input Specification:
The first line contains two integers: *n* (1<=≤<=*n*<=≤<=1000) — the number of found cards and *x* (1<=≤<=*x*<=≤<=1000) — the maximum absolute value of the number on a card. The second line contains *n* space-separated integers — the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['3 2\n-1 1 2\n', '2 3\n-2 -2\n']
Demo Output:
['1\n', '2\n']
Note:
In the first sample, Vanya needs to find a single card with number -2.
In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value. | ```python
n, m = map(int, input().split())
l = list(map(int, input().split()))
s = set(l)
c = 0
s1 = set()
for i in l:
if i != 0 and i not in s1:
c += abs(l.count(i)-l.count(i*-1))
s1.add(i)
s1.add(i*-1)
print(c)
``` | 0 |
|
602 | B | Approximating a Constant Range | PROGRAMMING | 1,400 | [
"dp",
"implementation",
"two pointers"
] | null | null | When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range. | The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000). | Print a single number — the maximum length of an almost constant range of the given sequence. | [
"5\n1 2 3 3 2\n",
"11\n5 4 5 5 6 7 8 8 8 7 6\n"
] | [
"4\n",
"5\n"
] | In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10]. | 1,000 | [
{
"input": "5\n1 2 3 3 2",
"output": "4"
},
{
"input": "11\n5 4 5 5 6 7 8 8 8 7 6",
"output": "5"
},
{
"input": "2\n3 2",
"output": "2"
},
{
"input": "4\n1001 1000 1000 1001",
"output": "4"
},
{
"input": "4\n1 1 2 3",
"output": "3"
},
{
"input": "3\n1 2 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "18\n10 9 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "3"
},
{
"input": "4\n10 9 10 9",
"output": "4"
},
{
"input": "4\n4 3 2 3",
"output": "3"
},
{
"input": "4\n8 8 7 7",
"output": "4"
},
{
"input": "3\n99998 99999 100000",
"output": "2"
},
{
"input": "3\n100000 99999 99998",
"output": "2"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "2\n99999 100000",
"output": "2"
},
{
"input": "2\n100000 100000",
"output": "2"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "15\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "15"
}
] | 1,687,142,678 | 2,147,483,647 | Python 3 | OK | TESTS | 107 | 156 | 13,619,200 | if __name__ == "__main__":
n = int(input())
a = list(map(int, input().split()))
cnt, l, ans = {}, 0, 0
for r, v in enumerate(a):
if v in cnt:
cnt[v] += 1
else:
cnt[v] = 1
while len(cnt) > 2:
cnt[a[l]] -= 1
if cnt[a[l]] == 0:
cnt.pop(a[l])
l += 1
ans = max(ans, r - l + 1)
print(ans)
| Title: Approximating a Constant Range
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
Output Specification:
Print a single number — the maximum length of an almost constant range of the given sequence.
Demo Input:
['5\n1 2 3 3 2\n', '11\n5 4 5 5 6 7 8 8 8 7 6\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10]. | ```python
if __name__ == "__main__":
n = int(input())
a = list(map(int, input().split()))
cnt, l, ans = {}, 0, 0
for r, v in enumerate(a):
if v in cnt:
cnt[v] += 1
else:
cnt[v] = 1
while len(cnt) > 2:
cnt[a[l]] -= 1
if cnt[a[l]] == 0:
cnt.pop(a[l])
l += 1
ans = max(ans, r - l + 1)
print(ans)
``` | 3 |
|
931 | B | World Cup | PROGRAMMING | 1,200 | [
"constructive algorithms",
"implementation"
] | null | null | The last stage of Football World Cup is played using the play-off system.
There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over.
Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet. | The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in.
It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal. | In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final.
Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1. | [
"4 1 2\n",
"8 2 6\n",
"8 7 5\n"
] | [
"1\n",
"Final!\n",
"2\n"
] | In the first example teams 1 and 2 meet in the first round.
In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds.
In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round. | 1,000 | [
{
"input": "4 1 2",
"output": "1"
},
{
"input": "8 2 6",
"output": "Final!"
},
{
"input": "8 7 5",
"output": "2"
},
{
"input": "128 30 98",
"output": "Final!"
},
{
"input": "256 128 256",
"output": "Final!"
},
{
"input": "256 2 127",
"output": "7"
},
{
"input": "2 1 2",
"output": "Final!"
},
{
"input": "2 2 1",
"output": "Final!"
},
{
"input": "4 1 3",
"output": "Final!"
},
{
"input": "4 1 4",
"output": "Final!"
},
{
"input": "4 2 1",
"output": "1"
},
{
"input": "4 2 3",
"output": "Final!"
},
{
"input": "4 2 4",
"output": "Final!"
},
{
"input": "4 3 1",
"output": "Final!"
},
{
"input": "4 3 2",
"output": "Final!"
},
{
"input": "4 3 4",
"output": "1"
},
{
"input": "4 4 1",
"output": "Final!"
},
{
"input": "4 4 2",
"output": "Final!"
},
{
"input": "4 4 3",
"output": "1"
},
{
"input": "8 8 7",
"output": "1"
},
{
"input": "8 8 5",
"output": "2"
},
{
"input": "8 8 1",
"output": "Final!"
},
{
"input": "16 4 3",
"output": "1"
},
{
"input": "16 2 4",
"output": "2"
},
{
"input": "16 14 11",
"output": "3"
},
{
"input": "16 3 11",
"output": "Final!"
},
{
"input": "32 10 9",
"output": "1"
},
{
"input": "32 25 28",
"output": "2"
},
{
"input": "32 22 18",
"output": "3"
},
{
"input": "32 17 25",
"output": "4"
},
{
"input": "32 18 3",
"output": "Final!"
},
{
"input": "64 40 39",
"output": "1"
},
{
"input": "64 60 58",
"output": "2"
},
{
"input": "64 34 37",
"output": "3"
},
{
"input": "64 26 24",
"output": "4"
},
{
"input": "64 50 43",
"output": "5"
},
{
"input": "64 17 42",
"output": "Final!"
},
{
"input": "128 116 115",
"output": "1"
},
{
"input": "128 35 33",
"output": "2"
},
{
"input": "128 61 59",
"output": "3"
},
{
"input": "128 116 123",
"output": "4"
},
{
"input": "128 17 15",
"output": "5"
},
{
"input": "128 124 77",
"output": "6"
},
{
"input": "128 4 80",
"output": "Final!"
},
{
"input": "256 224 223",
"output": "1"
},
{
"input": "256 24 22",
"output": "2"
},
{
"input": "256 199 196",
"output": "3"
},
{
"input": "256 148 159",
"output": "4"
},
{
"input": "256 178 166",
"output": "5"
},
{
"input": "256 75 97",
"output": "6"
},
{
"input": "256 185 200",
"output": "7"
},
{
"input": "256 3 238",
"output": "Final!"
},
{
"input": "256 128 129",
"output": "Final!"
},
{
"input": "256 255 129",
"output": "7"
},
{
"input": "256 255 128",
"output": "Final!"
},
{
"input": "256 129 256",
"output": "7"
},
{
"input": "128 98 69",
"output": "6"
},
{
"input": "128 47 83",
"output": "Final!"
},
{
"input": "16 2 3",
"output": "2"
},
{
"input": "64 32 30",
"output": "2"
},
{
"input": "8 4 5",
"output": "Final!"
},
{
"input": "8 7 8",
"output": "1"
},
{
"input": "8 2 3",
"output": "2"
},
{
"input": "8 2 5",
"output": "Final!"
}
] | 1,520,178,631 | 931 | Python 3 | WRONG_ANSWER | PRETESTS | 5 | 61 | 5,632,000 | #Python is love <3
n,a,b = map(int,input().split())
if(a>b):
a,b = b,a
if(a<=n//2 and b>n//2):
print("Final!")
else:
if a%2:
a += 1
if b%2:
b+=1
p = a//2
q = b//2
print(q-p+1) | Title: World Cup
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The last stage of Football World Cup is played using the play-off system.
There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over.
Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet.
Input Specification:
The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in.
It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal.
Output Specification:
In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final.
Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1.
Demo Input:
['4 1 2\n', '8 2 6\n', '8 7 5\n']
Demo Output:
['1\n', 'Final!\n', '2\n']
Note:
In the first example teams 1 and 2 meet in the first round.
In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds.
In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round. | ```python
#Python is love <3
n,a,b = map(int,input().split())
if(a>b):
a,b = b,a
if(a<=n//2 and b>n//2):
print("Final!")
else:
if a%2:
a += 1
if b%2:
b+=1
p = a//2
q = b//2
print(q-p+1)
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. | The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. | In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. | [
"101\n",
"110010\n"
] | [
"11\n",
"11010\n"
] | In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | 0 | [
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
] | 1,517,258,487 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 404 | 6,246,400 | from sys import stdin, stdout
n = str(stdin.readline().strip())
ok = True
i = 1
for x in n:
if ok and i == len(n):
continue
if x == '0' and ok:
ok = False
continue
else:
stdout.write(x)
i = i + 1
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | ```python
from sys import stdin, stdout
n = str(stdin.readline().strip())
ok = True
i = 1
for x in n:
if ok and i == len(n):
continue
if x == '0' and ok:
ok = False
continue
else:
stdout.write(x)
i = i + 1
``` | 3 |
|
222 | A | Shooshuns and Sequence | PROGRAMMING | 1,200 | [
"brute force",
"implementation"
] | null | null | One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps:
1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence.
The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same. | The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found. | Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1. | [
"3 2\n3 1 1\n",
"3 1\n3 1 1\n"
] | [
"1\n",
"-1\n"
] | In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one.
In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1. | 500 | [
{
"input": "3 2\n3 1 1",
"output": "1"
},
{
"input": "3 1\n3 1 1",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "0"
},
{
"input": "2 1\n2 1",
"output": "-1"
},
{
"input": "4 4\n1 2 3 4",
"output": "3"
},
{
"input": "4 3\n1 2 3 4",
"output": "-1"
},
{
"input": "5 3\n2 1 1 1 1",
"output": "1"
},
{
"input": "5 3\n1 1 1 1 1",
"output": "0"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "0"
},
{
"input": "10 1\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "10 1\n1 2 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 1\n2 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 2\n2 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "10 2\n1 2 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "10 3\n3 2 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "10 1\n1 2 3 4 5 6 7 8 9 10",
"output": "-1"
},
{
"input": "10 10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "20 10\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "20 11\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "10"
},
{
"input": "20 9\n1 2 3 4 5 6 7 8 9 10 1 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "20 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "20 20\n20 1 19 2 18 3 17 4 16 5 15 6 14 7 13 8 12 9 11 10",
"output": "19"
}
] | 1,452,434,612 | 2,147,483,647 | Python 3 | OK | TESTS | 47 | 342 | 7,372,800 | n, k = map(int, input().split());
a = list(map(int, input().split()));
flag = 1
for i in range(k, n):
flag &= a[k - 1] == a[i];
if (flag == 0):
print(-1);
else:
cur = k - 1;
while (cur >= 0 and a[cur] == a[k - 1]):
cur -= 1;
print(cur + 1);
| Title: Shooshuns and Sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day shooshuns found a sequence of *n* integers, written on a blackboard. The shooshuns can perform one operation with it, the operation consists of two steps:
1. Find the number that goes *k*-th in the current sequence and add the same number to the end of the sequence; 1. Delete the first number of the current sequence.
The shooshuns wonder after how many operations all numbers on the board will be the same and whether all numbers will ever be the same.
Input Specification:
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105) — the sequence that the shooshuns found.
Output Specification:
Print the minimum number of operations, required for all numbers on the blackboard to become the same. If it is impossible to achieve, print -1.
Demo Input:
['3 2\n3 1 1\n', '3 1\n3 1 1\n']
Demo Output:
['1\n', '-1\n']
Note:
In the first test case after the first operation the blackboard will have sequence [1, 1, 1]. So, one operation is enough to make all numbers the same. Thus, the answer equals one.
In the second test case the sequence will never consist of the same numbers. It will always contain at least two distinct numbers 3 and 1. Thus, the answer equals -1. | ```python
n, k = map(int, input().split());
a = list(map(int, input().split()));
flag = 1
for i in range(k, n):
flag &= a[k - 1] == a[i];
if (flag == 0):
print(-1);
else:
cur = k - 1;
while (cur >= 0 and a[cur] == a[k - 1]):
cur -= 1;
print(cur + 1);
``` | 3 |
|
51 | B | bHTML Tables Analisys | PROGRAMMING | 1,700 | [
"expression parsing"
] | B. bHTML Tables Analisys | 2 | 256 | In this problem is used an extremely simplified version of HTML table markup. Please use the statement as a formal document and read it carefully.
A string is a bHTML table, if it satisfies the grammar:
Blanks in the grammar are only for purposes of illustration, in the given data there will be no spaces. The bHTML table is very similar to a simple regular HTML table in which meet only the following tags : "table", "tr", "td", all the tags are paired and the table contains at least one row and at least one cell in each row. Have a look at the sample tests as examples of tables.
As can be seen, the tables may be nested. You are given a table (which may contain other(s)). You need to write a program that analyzes all the tables and finds the number of cells in each of them. The tables are not required to be rectangular. | For convenience, input data can be separated into non-empty lines in an arbitrary manner. The input data consist of no more than 10 lines. Combine (concatenate) all the input lines into one, to get a text representation *s* of the specified table. String *s* corresponds to the given grammar (the root element of grammar is TABLE), its length does not exceed 5000. Only lower case letters are used to write tags. There are no spaces in the given string *s*. | Print the sizes of all the tables in the non-decreasing order. | [
"<table><tr><td></td></tr></table>\n",
"<table>\n<tr>\n<td>\n<table><tr><td></td></tr><tr><td></\ntd\n></tr><tr\n><td></td></tr><tr><td></td></tr></table>\n</td>\n</tr>\n</table>\n",
"<table><tr><td>\n<table><tr><td>\n<table><tr><td>\n<table><tr><td></td><td></td>\n</tr><tr><td></td></tr></table>\n</td></tr></table>\n</td></tr></table>\n</td></tr></table>\n"
] | [
"1 ",
"1 4 ",
"1 1 1 3 "
] | none | 1,000 | [
{
"input": "<table><tr><td></td></tr></table>",
"output": "1 "
},
{
"input": "<table>\n<tr>\n<td>\n<table><tr><td></td></tr><tr><td></\ntd\n></tr><tr\n><td></td></tr><tr><td></td></tr></table>\n</td>\n</tr>\n</table>",
"output": "1 4 "
},
{
"input": "<table><tr><td>\n<table><tr><td>\n<table><tr><td>\n<table><tr><td></td><td></td>\n</tr><tr><td></td></tr></table>\n</td></tr></table>\n</td></tr></table>\n</td></tr></table>",
"output": "1 1 1 3 "
},
{
"input": "<\nt\na\nble><tr><td></td>\n</\ntr>\n</\nt\nab\nle>",
"output": "1 "
},
{
"input": "<table><tr><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 1 "
},
{
"input": "<table><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 "
},
{
"input": "<table><tr><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 1 "
},
{
"input": "<table><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 "
},
{
"input": "<table><tr><td><table><tr><td></td><td></td></tr></table></td><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 2 2 "
},
{
"input": "<table><tr><td><table><tr><td></td><td></td></tr></table></td><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 2 2 "
},
{
"input": "<table><tr><td><table><tr><td></td></tr></table></td></tr><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 2 "
},
{
"input": "<table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
}
] | 1,699,274,846 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 10 | 62 | 0 | n=""
cnt=-1
flag=False
ans=[]
while True:
k=input()
n+=k
if n.count("<table>")==n.count("</table>") and n.count("<table>")!=0: break
n=n[1:len(n)-1].split("><")
tables=0
for i in n:
if i=="table":
cnt+=1+tables
ans.append(0)
if i=="td": ans[cnt]+=1
if i=="/table":
cnt-=1-tables
tables+=1
print(*sorted(ans)) | Title: bHTML Tables Analisys
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In this problem is used an extremely simplified version of HTML table markup. Please use the statement as a formal document and read it carefully.
A string is a bHTML table, if it satisfies the grammar:
Blanks in the grammar are only for purposes of illustration, in the given data there will be no spaces. The bHTML table is very similar to a simple regular HTML table in which meet only the following tags : "table", "tr", "td", all the tags are paired and the table contains at least one row and at least one cell in each row. Have a look at the sample tests as examples of tables.
As can be seen, the tables may be nested. You are given a table (which may contain other(s)). You need to write a program that analyzes all the tables and finds the number of cells in each of them. The tables are not required to be rectangular.
Input Specification:
For convenience, input data can be separated into non-empty lines in an arbitrary manner. The input data consist of no more than 10 lines. Combine (concatenate) all the input lines into one, to get a text representation *s* of the specified table. String *s* corresponds to the given grammar (the root element of grammar is TABLE), its length does not exceed 5000. Only lower case letters are used to write tags. There are no spaces in the given string *s*.
Output Specification:
Print the sizes of all the tables in the non-decreasing order.
Demo Input:
['<table><tr><td></td></tr></table>\n', '<table>\n<tr>\n<td>\n<table><tr><td></td></tr><tr><td></\ntd\n></tr><tr\n><td></td></tr><tr><td></td></tr></table>\n</td>\n</tr>\n</table>\n', '<table><tr><td>\n<table><tr><td>\n<table><tr><td>\n<table><tr><td></td><td></td>\n</tr><tr><td></td></tr></table>\n</td></tr></table>\n</td></tr></table>\n</td></tr></table>\n']
Demo Output:
['1 ', '1 4 ', '1 1 1 3 ']
Note:
none | ```python
n=""
cnt=-1
flag=False
ans=[]
while True:
k=input()
n+=k
if n.count("<table>")==n.count("</table>") and n.count("<table>")!=0: break
n=n[1:len(n)-1].split("><")
tables=0
for i in n:
if i=="table":
cnt+=1+tables
ans.append(0)
if i=="td": ans[cnt]+=1
if i=="/table":
cnt-=1-tables
tables+=1
print(*sorted(ans))
``` | -1 |
9 | A | Die Roll | PROGRAMMING | 800 | [
"math",
"probabilities"
] | A. Die Roll | 1 | 64 | Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. | The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. | Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». | [
"4 2\n"
] | [
"1/2\n"
] | Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | 0 | [
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,538,596,131 | 2,147,483,647 | Python 3 | OK | TESTS | 36 | 248 | 0 | lis = ['1/6', '1/3', '1/2', '2/3', '5/6', '1/1']
input = input()
input = input.split()
Y = int(input[0])
W = int(input[1])
print(lis[6-(max(Y,W))]) | Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | ```python
lis = ['1/6', '1/3', '1/2', '2/3', '5/6', '1/1']
input = input()
input = input.split()
Y = int(input[0])
W = int(input[1])
print(lis[6-(max(Y,W))])
``` | 3.876 |
807 | A | Is it rated? | PROGRAMMING | 900 | [
"implementation",
"sortings"
] | null | null | Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings. | If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe". | [
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] | [
"rated\n",
"unrated\n",
"maybe\n"
] | In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | 500 | [
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,620,588,887 | 2,147,483,647 | PyPy 3 | OK | TESTS | 150 | 124 | 21,606,400 | n = int(input())
after = []
for _ in range(n):
a, b = map(int, input().split())
if a != b: print('rated'); exit(0)
after.append(b)
if sorted(after)[::-1] == after:
print('maybe')
else:
print('unrated') | Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | ```python
n = int(input())
after = []
for _ in range(n):
a, b = map(int, input().split())
if a != b: print('rated'); exit(0)
after.append(b)
if sorted(after)[::-1] == after:
print('maybe')
else:
print('unrated')
``` | 3 |
|
285 | A | Slightly Decreasing Permutations | PROGRAMMING | 1,100 | [
"greedy",
"implementation"
] | null | null | Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1.
You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*. | The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient. | In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*.
If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists. | [
"5 2\n",
"3 0\n",
"3 2\n"
] | [
"1 5 2 4 3\n",
"1 2 3\n",
"3 2 1\n"
] | none | 500 | [
{
"input": "5 2",
"output": "1 5 2 4 3"
},
{
"input": "3 0",
"output": "1 2 3"
},
{
"input": "3 2",
"output": "3 2 1"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "1 2"
},
{
"input": "2 1",
"output": "2 1"
},
{
"input": "10 4",
"output": "10 9 8 7 1 2 3 4 5 6"
},
{
"input": "56893 5084",
"output": "56893 56892 56891 56890 56889 56888 56887 56886 56885 56884 56883 56882 56881 56880 56879 56878 56877 56876 56875 56874 56873 56872 56871 56870 56869 56868 56867 56866 56865 56864 56863 56862 56861 56860 56859 56858 56857 56856 56855 56854 56853 56852 56851 56850 56849 56848 56847 56846 56845 56844 56843 56842 56841 56840 56839 56838 56837 56836 56835 56834 56833 56832 56831 56830 56829 56828 56827 56826 56825 56824 56823 56822 56821 56820 56819 56818 56817 56816 56815 56814 56813 56812 56811 56810 56809 5..."
},
{
"input": "6 3",
"output": "6 5 4 1 2 3"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "310 186",
"output": "310 309 308 307 306 305 304 303 302 301 300 299 298 297 296 295 294 293 292 291 290 289 288 287 286 285 284 283 282 281 280 279 278 277 276 275 274 273 272 271 270 269 268 267 266 265 264 263 262 261 260 259 258 257 256 255 254 253 252 251 250 249 248 247 246 245 244 243 242 241 240 239 238 237 236 235 234 233 232 231 230 229 228 227 226 225 224 223 222 221 220 219 218 217 216 215 214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183..."
},
{
"input": "726 450",
"output": "726 725 724 723 722 721 720 719 718 717 716 715 714 713 712 711 710 709 708 707 706 705 704 703 702 701 700 699 698 697 696 695 694 693 692 691 690 689 688 687 686 685 684 683 682 681 680 679 678 677 676 675 674 673 672 671 670 669 668 667 666 665 664 663 662 661 660 659 658 657 656 655 654 653 652 651 650 649 648 647 646 645 644 643 642 641 640 639 638 637 636 635 634 633 632 631 630 629 628 627 626 625 624 623 622 621 620 619 618 617 616 615 614 613 612 611 610 609 608 607 606 605 604 603 602 601 600 599..."
},
{
"input": "438 418",
"output": "438 437 436 435 434 433 432 431 430 429 428 427 426 425 424 423 422 421 420 419 418 417 416 415 414 413 412 411 410 409 408 407 406 405 404 403 402 401 400 399 398 397 396 395 394 393 392 391 390 389 388 387 386 385 384 383 382 381 380 379 378 377 376 375 374 373 372 371 370 369 368 367 366 365 364 363 362 361 360 359 358 357 356 355 354 353 352 351 350 349 348 347 346 345 344 343 342 341 340 339 338 337 336 335 334 333 332 331 330 329 328 327 326 325 324 323 322 321 320 319 318 317 316 315 314 313 312 311..."
},
{
"input": "854 829",
"output": "854 853 852 851 850 849 848 847 846 845 844 843 842 841 840 839 838 837 836 835 834 833 832 831 830 829 828 827 826 825 824 823 822 821 820 819 818 817 816 815 814 813 812 811 810 809 808 807 806 805 804 803 802 801 800 799 798 797 796 795 794 793 792 791 790 789 788 787 786 785 784 783 782 781 780 779 778 777 776 775 774 773 772 771 770 769 768 767 766 765 764 763 762 761 760 759 758 757 756 755 754 753 752 751 750 749 748 747 746 745 744 743 742 741 740 739 738 737 736 735 734 733 732 731 730 729 728 727..."
},
{
"input": "214 167",
"output": "214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183 182 181 180 179 178 177 176 175 174 173 172 171 170 169 168 167 166 165 164 163 162 161 160 159 158 157 156 155 154 153 152 151 150 149 148 147 146 145 144 143 142 141 140 139 138 137 136 135 134 133 132 131 130 129 128 127 126 125 124 123 122 121 120 119 118 117 116 115 114 113 112 111 110 109 108 107 106 105 104 103 102 101 100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 ..."
},
{
"input": "85705 56268",
"output": "85705 85704 85703 85702 85701 85700 85699 85698 85697 85696 85695 85694 85693 85692 85691 85690 85689 85688 85687 85686 85685 85684 85683 85682 85681 85680 85679 85678 85677 85676 85675 85674 85673 85672 85671 85670 85669 85668 85667 85666 85665 85664 85663 85662 85661 85660 85659 85658 85657 85656 85655 85654 85653 85652 85651 85650 85649 85648 85647 85646 85645 85644 85643 85642 85641 85640 85639 85638 85637 85636 85635 85634 85633 85632 85631 85630 85629 85628 85627 85626 85625 85624 85623 85622 85621 8..."
},
{
"input": "11417 4583",
"output": "11417 11416 11415 11414 11413 11412 11411 11410 11409 11408 11407 11406 11405 11404 11403 11402 11401 11400 11399 11398 11397 11396 11395 11394 11393 11392 11391 11390 11389 11388 11387 11386 11385 11384 11383 11382 11381 11380 11379 11378 11377 11376 11375 11374 11373 11372 11371 11370 11369 11368 11367 11366 11365 11364 11363 11362 11361 11360 11359 11358 11357 11356 11355 11354 11353 11352 11351 11350 11349 11348 11347 11346 11345 11344 11343 11342 11341 11340 11339 11338 11337 11336 11335 11334 11333 1..."
},
{
"input": "53481 20593",
"output": "53481 53480 53479 53478 53477 53476 53475 53474 53473 53472 53471 53470 53469 53468 53467 53466 53465 53464 53463 53462 53461 53460 53459 53458 53457 53456 53455 53454 53453 53452 53451 53450 53449 53448 53447 53446 53445 53444 53443 53442 53441 53440 53439 53438 53437 53436 53435 53434 53433 53432 53431 53430 53429 53428 53427 53426 53425 53424 53423 53422 53421 53420 53419 53418 53417 53416 53415 53414 53413 53412 53411 53410 53409 53408 53407 53406 53405 53404 53403 53402 53401 53400 53399 53398 53397 5..."
},
{
"input": "79193 77281",
"output": "79193 79192 79191 79190 79189 79188 79187 79186 79185 79184 79183 79182 79181 79180 79179 79178 79177 79176 79175 79174 79173 79172 79171 79170 79169 79168 79167 79166 79165 79164 79163 79162 79161 79160 79159 79158 79157 79156 79155 79154 79153 79152 79151 79150 79149 79148 79147 79146 79145 79144 79143 79142 79141 79140 79139 79138 79137 79136 79135 79134 79133 79132 79131 79130 79129 79128 79127 79126 79125 79124 79123 79122 79121 79120 79119 79118 79117 79116 79115 79114 79113 79112 79111 79110 79109 7..."
},
{
"input": "42607 42144",
"output": "42607 42606 42605 42604 42603 42602 42601 42600 42599 42598 42597 42596 42595 42594 42593 42592 42591 42590 42589 42588 42587 42586 42585 42584 42583 42582 42581 42580 42579 42578 42577 42576 42575 42574 42573 42572 42571 42570 42569 42568 42567 42566 42565 42564 42563 42562 42561 42560 42559 42558 42557 42556 42555 42554 42553 42552 42551 42550 42549 42548 42547 42546 42545 42544 42543 42542 42541 42540 42539 42538 42537 42536 42535 42534 42533 42532 42531 42530 42529 42528 42527 42526 42525 42524 42523 4..."
},
{
"input": "100000 0",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "100000 99999",
"output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..."
},
{
"input": "100000 53860",
"output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..."
},
{
"input": "4 0",
"output": "1 2 3 4"
},
{
"input": "4 1",
"output": "4 1 2 3"
},
{
"input": "4 2",
"output": "4 3 1 2"
},
{
"input": "4 3",
"output": "4 3 2 1"
},
{
"input": "3 1",
"output": "3 1 2"
}
] | 1,496,441,366 | 2,147,483,647 | Python 3 | OK | TESTS | 28 | 218 | 7,475,200 | (n, k) = map(int, input().split(' '))
nums = []
for i in range(0, k):
nums.append(n - i)
for i in range(1, n - k + 1):
nums.append(i)
print(' '.join(map(str, nums)))
| Title: Slightly Decreasing Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1.
You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*.
Input Specification:
The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient.
Output Specification:
In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*.
If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists.
Demo Input:
['5 2\n', '3 0\n', '3 2\n']
Demo Output:
['1 5 2 4 3\n', '1 2 3\n', '3 2 1\n']
Note:
none | ```python
(n, k) = map(int, input().split(' '))
nums = []
for i in range(0, k):
nums.append(n - i)
for i in range(1, n - k + 1):
nums.append(i)
print(' '.join(map(str, nums)))
``` | 3 |
|
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,626,171,644 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 154 | 6,758,400 | s=input()
lc=0
uc=0
for x in s:
if x.islower():
lc=lc+1
else:
uc=uc+1
if uc>lc:
s=s.upper()
else:
s=s.lower()
print(s) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
s=input()
lc=0
uc=0
for x in s:
if x.islower():
lc=lc+1
else:
uc=uc+1
if uc>lc:
s=s.upper()
else:
s=s.lower()
print(s)
``` | 3.948911 |
58 | A | Chat room | PROGRAMMING | 1,000 | [
"greedy",
"strings"
] | A. Chat room | 1 | 256 | Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. | The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. | If Vasya managed to say hello, print "YES", otherwise print "NO". | [
"ahhellllloou\n",
"hlelo\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,642,690,916 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 46 | 0 | s=input()
list1=['h','e','l','l','o','#']
c=0
x=list1[c]
res=''
for i in s:
if i==x:
res+=i
c+=1
x=list1[c]
if res=='hello':
break
if res=='hello':
print('YES')
else:
print('NO') | Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
s=input()
list1=['h','e','l','l','o','#']
c=0
x=list1[c]
res=''
for i in s:
if i==x:
res+=i
c+=1
x=list1[c]
if res=='hello':
break
if res=='hello':
print('YES')
else:
print('NO')
``` | 3.977 |
157 | B | Trace | PROGRAMMING | 1,000 | [
"geometry",
"sortings"
] | null | null | One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric. | The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different. | Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4. | [
"1\n1\n",
"3\n1 4 2\n"
] | [
"3.1415926536\n",
"40.8407044967\n"
] | In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π | 1,000 | [
{
"input": "1\n1",
"output": "3.1415926536"
},
{
"input": "3\n1 4 2",
"output": "40.8407044967"
},
{
"input": "4\n4 1 3 2",
"output": "31.4159265359"
},
{
"input": "4\n100 10 2 1",
"output": "31111.1920484997"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "172.7875959474"
},
{
"input": "1\n1000",
"output": "3141592.6535897931"
},
{
"input": "8\n8 1 7 2 6 3 5 4",
"output": "113.0973355292"
},
{
"input": "100\n1000 999 998 997 996 995 994 993 992 991 990 989 988 987 986 985 984 983 982 981 980 979 978 977 976 975 974 973 972 971 970 969 968 967 966 965 964 963 962 961 960 959 958 957 956 955 954 953 952 951 950 949 948 947 946 945 944 943 942 941 940 939 938 937 936 935 934 933 932 931 930 929 928 927 926 925 924 923 922 921 920 919 918 917 916 915 914 913 912 911 910 909 908 907 906 905 904 903 902 901",
"output": "298608.3817237098"
},
{
"input": "6\n109 683 214 392 678 10",
"output": "397266.9574170437"
},
{
"input": "2\n151 400",
"output": "431023.3704798660"
},
{
"input": "6\n258 877 696 425 663 934",
"output": "823521.3902487604"
},
{
"input": "9\n635 707 108 234 52 180 910 203 782",
"output": "1100144.9065826489"
},
{
"input": "8\n885 879 891 428 522 176 135 983",
"output": "895488.9947571954"
},
{
"input": "3\n269 918 721",
"output": "1241695.6467754442"
},
{
"input": "7\n920 570 681 428 866 935 795",
"output": "1469640.1849419588"
},
{
"input": "2\n517 331",
"output": "495517.1260654109"
},
{
"input": "2\n457 898",
"output": "1877274.3981158488"
},
{
"input": "8\n872 704 973 612 183 274 739 253",
"output": "1780774.0965755312"
},
{
"input": "74\n652 446 173 457 760 847 670 25 196 775 998 279 656 809 883 148 969 884 792 502 641 800 663 938 362 339 545 608 107 184 834 666 149 458 864 72 199 658 618 987 126 723 806 643 689 958 626 904 944 415 427 498 628 331 636 261 281 276 478 220 513 595 510 384 354 561 469 462 799 449 747 109 903 456",
"output": "1510006.5089479341"
},
{
"input": "76\n986 504 673 158 87 332 124 218 714 235 212 122 878 370 938 81 686 323 386 348 410 468 875 107 50 960 82 834 234 663 651 422 794 633 294 771 945 607 146 913 950 858 297 88 882 725 247 872 645 749 799 987 115 394 380 382 971 429 593 426 652 353 351 233 868 598 889 116 71 376 916 464 414 976 138 903",
"output": "1528494.7817143100"
},
{
"input": "70\n12 347 748 962 514 686 192 159 990 4 10 788 602 542 946 215 523 727 799 717 955 796 529 465 897 103 181 515 495 153 710 179 747 145 16 585 943 998 923 708 156 399 770 547 775 285 9 68 713 722 570 143 913 416 663 624 925 218 64 237 797 138 942 213 188 818 780 840 480 758",
"output": "1741821.4892636713"
},
{
"input": "26\n656 508 45 189 561 366 96 486 547 386 703 570 780 689 264 26 11 74 466 76 421 48 982 886 215 650",
"output": "1818821.9252031571"
},
{
"input": "52\n270 658 808 249 293 707 700 78 791 167 92 772 807 502 830 991 945 102 968 376 556 578 326 980 688 368 280 853 646 256 666 638 424 737 321 996 925 405 199 680 953 541 716 481 727 143 577 919 892 355 346 298",
"output": "1272941.9273080483"
},
{
"input": "77\n482 532 200 748 692 697 171 863 586 547 301 149 326 812 147 698 303 691 527 805 681 387 619 947 598 453 167 799 840 508 893 688 643 974 998 341 804 230 538 669 271 404 477 759 943 596 949 235 880 160 151 660 832 82 969 539 708 889 258 81 224 655 790 144 462 582 646 256 445 52 456 920 67 819 631 484 534",
"output": "2045673.1891262225"
},
{
"input": "27\n167 464 924 575 775 97 944 390 297 315 668 296 533 829 851 406 702 366 848 512 71 197 321 900 544 529 116",
"output": "1573959.9105970615"
},
{
"input": "38\n488 830 887 566 720 267 583 102 65 200 884 220 263 858 510 481 316 804 754 568 412 166 374 869 356 977 145 421 500 58 664 252 745 70 381 927 670 772",
"output": "1479184.3434235646"
},
{
"input": "64\n591 387 732 260 840 397 563 136 571 876 831 953 799 493 579 13 559 872 53 678 256 232 969 993 847 14 837 365 547 997 604 199 834 529 306 443 739 49 19 276 343 835 904 588 900 870 439 576 975 955 518 117 131 347 800 83 432 882 869 709 32 950 314 450",
"output": "1258248.6984672088"
},
{
"input": "37\n280 281 169 68 249 389 977 101 360 43 448 447 368 496 125 507 747 392 338 270 916 150 929 428 118 266 589 470 774 852 263 644 187 817 808 58 637",
"output": "1495219.0323274869"
},
{
"input": "97\n768 569 306 968 437 779 227 561 412 60 44 807 234 645 169 858 580 396 343 145 842 723 416 80 456 247 81 150 297 116 760 964 312 558 101 850 549 650 299 868 121 435 579 705 118 424 302 812 970 397 659 565 916 183 933 459 6 593 518 717 326 305 744 470 75 981 824 221 294 324 194 293 251 446 481 215 338 861 528 829 921 945 540 89 450 178 24 460 990 392 148 219 934 615 932 340 937",
"output": "1577239.7333274092"
},
{
"input": "94\n145 703 874 425 277 652 239 496 458 658 339 842 564 699 893 352 625 980 432 121 798 872 499 859 850 721 414 825 543 843 304 111 342 45 219 311 50 748 465 902 781 822 504 985 919 656 280 310 917 438 464 527 491 713 906 329 635 777 223 810 501 535 156 252 806 112 971 719 103 443 165 98 579 554 244 996 221 560 301 51 977 422 314 858 528 772 448 626 185 194 536 66 577 677",
"output": "1624269.3753516484"
},
{
"input": "97\n976 166 649 81 611 927 480 231 998 711 874 91 969 521 531 414 993 790 317 981 9 261 437 332 173 573 904 777 882 990 658 878 965 64 870 896 271 732 431 53 761 943 418 602 708 949 930 130 512 240 363 458 673 319 131 784 224 48 919 126 208 212 911 59 677 535 450 273 479 423 79 807 336 18 72 290 724 28 123 605 287 228 350 897 250 392 885 655 746 417 643 114 813 378 355 635 905",
"output": "1615601.7212203942"
},
{
"input": "91\n493 996 842 9 748 178 1 807 841 519 796 998 84 670 778 143 707 208 165 893 154 943 336 150 761 881 434 112 833 55 412 682 552 945 758 189 209 600 354 325 440 844 410 20 136 665 88 791 688 17 539 821 133 236 94 606 483 446 429 60 960 476 915 134 137 852 754 908 276 482 117 252 297 903 981 203 829 811 471 135 188 667 710 393 370 302 874 872 551 457 692",
"output": "1806742.5014501044"
},
{
"input": "95\n936 736 17 967 229 607 589 291 242 244 29 698 800 566 630 667 90 416 11 94 812 838 668 520 678 111 490 823 199 973 681 676 683 721 262 896 682 713 402 691 874 44 95 704 56 322 822 887 639 433 406 35 988 61 176 496 501 947 440 384 372 959 577 370 754 802 1 945 427 116 746 408 308 391 397 730 493 183 203 871 831 862 461 565 310 344 504 378 785 137 279 123 475 138 415",
"output": "1611115.5269110680"
},
{
"input": "90\n643 197 42 218 582 27 66 704 195 445 641 675 285 639 503 686 242 327 57 955 848 287 819 992 756 749 363 48 648 736 580 117 752 921 923 372 114 313 202 337 64 497 399 25 883 331 24 871 917 8 517 486 323 529 325 92 891 406 864 402 263 773 931 253 625 31 17 271 140 131 232 586 893 525 846 54 294 562 600 801 214 55 768 683 389 738 314 284 328 804",
"output": "1569819.2914796301"
},
{
"input": "98\n29 211 984 75 333 96 840 21 352 168 332 433 130 944 215 210 620 442 363 877 91 491 513 955 53 82 351 19 998 706 702 738 770 453 344 117 893 590 723 662 757 16 87 546 312 669 568 931 224 374 927 225 751 962 651 587 361 250 256 240 282 600 95 64 384 589 813 783 39 918 412 648 506 283 886 926 443 173 946 241 310 33 622 565 261 360 547 339 943 367 354 25 479 743 385 485 896 741",
"output": "2042921.1539616778"
},
{
"input": "93\n957 395 826 67 185 4 455 880 683 654 463 84 258 878 553 592 124 585 9 133 20 609 43 452 725 125 801 537 700 685 771 155 566 376 19 690 383 352 174 208 177 416 304 1000 533 481 87 509 358 233 681 22 507 659 36 859 952 259 138 271 594 779 576 782 119 69 608 758 283 616 640 523 710 751 34 106 774 92 874 568 864 660 998 992 474 679 180 409 15 297 990 689 501",
"output": "1310703.8710041976"
},
{
"input": "97\n70 611 20 30 904 636 583 262 255 501 604 660 212 128 199 138 545 576 506 528 12 410 77 888 783 972 431 188 338 485 148 793 907 678 281 922 976 680 252 724 253 920 177 361 721 798 960 572 99 622 712 466 608 49 612 345 266 751 63 594 40 695 532 789 520 930 825 929 48 59 405 135 109 735 508 186 495 772 375 587 201 324 447 610 230 947 855 318 856 956 313 810 931 175 668 183 688",
"output": "1686117.9099228707"
},
{
"input": "96\n292 235 391 180 840 172 218 997 166 287 329 20 886 325 400 471 182 356 448 337 417 319 58 106 366 764 393 614 90 831 924 314 667 532 64 874 3 434 350 352 733 795 78 640 967 63 47 879 635 272 145 569 468 792 153 761 770 878 281 467 209 208 298 37 700 18 334 93 5 750 412 779 523 517 360 649 447 328 311 653 57 578 767 460 647 663 50 670 151 13 511 580 625 907 227 89",
"output": "1419726.5608617242"
},
{
"input": "100\n469 399 735 925 62 153 707 723 819 529 200 624 57 708 245 384 889 11 639 638 260 419 8 142 403 298 204 169 887 388 241 983 885 267 643 943 417 237 452 562 6 839 149 742 832 896 100 831 712 754 679 743 135 222 445 680 210 955 220 63 960 487 514 824 481 584 441 997 795 290 10 45 510 678 844 503 407 945 850 84 858 934 500 320 936 663 736 592 161 670 606 465 864 969 293 863 868 393 899 744",
"output": "1556458.0979239127"
},
{
"input": "100\n321 200 758 415 190 710 920 992 873 898 814 259 359 66 971 210 838 545 663 652 684 277 36 756 963 459 335 484 462 982 532 423 131 703 307 229 391 938 253 847 542 975 635 928 220 980 222 567 557 181 366 824 900 180 107 979 112 564 525 413 300 422 876 615 737 343 902 8 654 628 469 913 967 785 893 314 909 215 912 262 20 709 363 915 997 954 986 454 596 124 74 159 660 550 787 418 895 786 293 50",
"output": "1775109.8050211088"
},
{
"input": "100\n859 113 290 762 701 63 188 431 810 485 671 673 99 658 194 227 511 435 941 212 551 124 89 222 42 321 657 815 898 171 216 482 707 567 724 491 414 942 820 351 48 653 685 312 586 24 20 627 602 498 533 173 463 262 621 466 119 299 580 964 510 987 40 698 521 998 847 651 746 215 808 563 785 837 631 772 404 923 682 244 232 214 390 350 968 771 517 900 70 543 934 554 681 368 642 575 891 728 478 317",
"output": "1447969.4788174964"
},
{
"input": "100\n941 283 349 457 52 837 299 284 796 305 893 624 101 972 738 204 121 70 17 704 836 791 95 111 162 952 472 724 733 580 878 177 705 804 11 211 463 417 288 409 410 485 896 755 921 267 164 656 505 765 539 439 535 19 991 689 220 474 114 944 884 144 926 849 486 566 117 35 749 499 797 303 362 905 690 890 976 66 590 183 234 683 39 297 769 787 376 541 571 759 495 200 261 352 73 493 831 442 273 339",
"output": "1597889.4218394549"
},
{
"input": "100\n110 868 147 888 291 282 916 542 917 337 235 595 498 621 814 249 261 713 445 666 142 275 319 49 900 543 333 606 487 670 620 769 852 258 230 867 603 491 714 839 879 37 21 74 590 190 397 506 499 967 152 862 200 107 145 23 614 167 857 475 79 598 270 906 626 116 89 59 651 846 723 201 50 699 522 408 634 132 226 414 824 764 513 586 526 238 556 162 667 173 684 415 527 743 10 442 552 274 350 822",
"output": "1567230.6191330721"
},
{
"input": "100\n901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "298608.3817237098"
}
] | 1,617,397,308 | 2,147,483,647 | PyPy 3 | OK | TESTS | 44 | 218 | 0 | import math
n = int(input())
a = sorted(list(map(int, input().split())))
ans = 0
for i in range(n):
if i % 2 != n % 2:
if i == 0:
ans += math.pi * a[i] ** 2
else:
ans += math.pi * (a[i] ** 2 - a[i - 1] ** 2)
print(ans) | Title: Trace
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
Output Specification:
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
Demo Input:
['1\n1\n', '3\n1 4 2\n']
Demo Output:
['3.1415926536\n', '40.8407044967\n']
Note:
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π | ```python
import math
n = int(input())
a = sorted(list(map(int, input().split())))
ans = 0
for i in range(n):
if i % 2 != n % 2:
if i == 0:
ans += math.pi * a[i] ** 2
else:
ans += math.pi * (a[i] ** 2 - a[i - 1] ** 2)
print(ans)
``` | 3 |
|
1,006 | C | Three Parts of the Array | PROGRAMMING | 1,200 | [
"binary search",
"data structures",
"two pointers"
] | null | null | You are given an array $d_1, d_2, \dots, d_n$ consisting of $n$ integer numbers.
Your task is to split this array into three parts (some of which may be empty) in such a way that each element of the array belongs to exactly one of the three parts, and each of the parts forms a consecutive contiguous subsegment (possibly, empty) of the original array.
Let the sum of elements of the first part be $sum_1$, the sum of elements of the second part be $sum_2$ and the sum of elements of the third part be $sum_3$. Among all possible ways to split the array you have to choose a way such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
More formally, if the first part of the array contains $a$ elements, the second part of the array contains $b$ elements and the third part contains $c$ elements, then:
$$sum_1 = \sum\limits_{1 \le i \le a}d_i,$$ $$sum_2 = \sum\limits_{a + 1 \le i \le a + b}d_i,$$ $$sum_3 = \sum\limits_{a + b + 1 \le i \le a + b + c}d_i.$$
The sum of an empty array is $0$.
Your task is to find a way to split the array such that $sum_1 = sum_3$ and $sum_1$ is maximum possible. | The first line of the input contains one integer $n$ ($1 \le n \le 2 \cdot 10^5$) — the number of elements in the array $d$.
The second line of the input contains $n$ integers $d_1, d_2, \dots, d_n$ ($1 \le d_i \le 10^9$) — the elements of the array $d$. | Print a single integer — the maximum possible value of $sum_1$, considering that the condition $sum_1 = sum_3$ must be met.
Obviously, at least one valid way to split the array exists (use $a=c=0$ and $b=n$). | [
"5\n1 3 1 1 4\n",
"5\n1 3 2 1 4\n",
"3\n4 1 2\n"
] | [
"5\n",
"4\n",
"0\n"
] | In the first example there is only one possible splitting which maximizes $sum_1$: $[1, 3, 1], [~], [1, 4]$.
In the second example the only way to have $sum_1=4$ is: $[1, 3], [2, 1], [4]$.
In the third example there is only one way to split the array: $[~], [4, 1, 2], [~]$. | 0 | [
{
"input": "5\n1 3 1 1 4",
"output": "5"
},
{
"input": "5\n1 3 2 1 4",
"output": "4"
},
{
"input": "3\n4 1 2",
"output": "0"
},
{
"input": "1\n1000000000",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "5\n1 3 5 4 5",
"output": "9"
}
] | 1,642,922,833 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 20 | 280 | 19,148,800 | n=int(input())
a=list(map(int,input().split()))
low=0
high=n-1
lowsum=a[low]
highsum=a[high]
res=0
while high-low>1:
if lowsum==highsum:
res=max(res,lowsum)
low+=1
lowsum+=a[low]
elif lowsum<highsum:
low+=1
lowsum+=a[low]
else:
high-=1
highsum+=a[high]
if highsum==lowsum:
res=max(res,lowsum)
print(res) | Title: Three Parts of the Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array $d_1, d_2, \dots, d_n$ consisting of $n$ integer numbers.
Your task is to split this array into three parts (some of which may be empty) in such a way that each element of the array belongs to exactly one of the three parts, and each of the parts forms a consecutive contiguous subsegment (possibly, empty) of the original array.
Let the sum of elements of the first part be $sum_1$, the sum of elements of the second part be $sum_2$ and the sum of elements of the third part be $sum_3$. Among all possible ways to split the array you have to choose a way such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
More formally, if the first part of the array contains $a$ elements, the second part of the array contains $b$ elements and the third part contains $c$ elements, then:
$$sum_1 = \sum\limits_{1 \le i \le a}d_i,$$ $$sum_2 = \sum\limits_{a + 1 \le i \le a + b}d_i,$$ $$sum_3 = \sum\limits_{a + b + 1 \le i \le a + b + c}d_i.$$
The sum of an empty array is $0$.
Your task is to find a way to split the array such that $sum_1 = sum_3$ and $sum_1$ is maximum possible.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 2 \cdot 10^5$) — the number of elements in the array $d$.
The second line of the input contains $n$ integers $d_1, d_2, \dots, d_n$ ($1 \le d_i \le 10^9$) — the elements of the array $d$.
Output Specification:
Print a single integer — the maximum possible value of $sum_1$, considering that the condition $sum_1 = sum_3$ must be met.
Obviously, at least one valid way to split the array exists (use $a=c=0$ and $b=n$).
Demo Input:
['5\n1 3 1 1 4\n', '5\n1 3 2 1 4\n', '3\n4 1 2\n']
Demo Output:
['5\n', '4\n', '0\n']
Note:
In the first example there is only one possible splitting which maximizes $sum_1$: $[1, 3, 1], [~], [1, 4]$.
In the second example the only way to have $sum_1=4$ is: $[1, 3], [2, 1], [4]$.
In the third example there is only one way to split the array: $[~], [4, 1, 2], [~]$. | ```python
n=int(input())
a=list(map(int,input().split()))
low=0
high=n-1
lowsum=a[low]
highsum=a[high]
res=0
while high-low>1:
if lowsum==highsum:
res=max(res,lowsum)
low+=1
lowsum+=a[low]
elif lowsum<highsum:
low+=1
lowsum+=a[low]
else:
high-=1
highsum+=a[high]
if highsum==lowsum:
res=max(res,lowsum)
print(res)
``` | 0 |
|
845 | B | Luba And The Ticket | PROGRAMMING | 1,600 | [
"brute force",
"greedy",
"implementation"
] | null | null | Luba has a ticket consisting of 6 digits. In one move she can choose digit in any position and replace it with arbitrary digit. She wants to know the minimum number of digits she needs to replace in order to make the ticket lucky.
The ticket is considered lucky if the sum of first three digits equals to the sum of last three digits. | You are given a string consisting of 6 characters (all characters are digits from 0 to 9) — this string denotes Luba's ticket. The ticket can start with the digit 0. | Print one number — the minimum possible number of digits Luba needs to replace to make the ticket lucky. | [
"000000\n",
"123456\n",
"111000\n"
] | [
"0\n",
"2\n",
"1\n"
] | In the first example the ticket is already lucky, so the answer is 0.
In the second example Luba can replace 4 and 5 with zeroes, and the ticket will become lucky. It's easy to see that at least two replacements are required.
In the third example Luba can replace any zero with 3. It's easy to see that at least one replacement is required. | 0 | [
{
"input": "000000",
"output": "0"
},
{
"input": "123456",
"output": "2"
},
{
"input": "111000",
"output": "1"
},
{
"input": "120111",
"output": "0"
},
{
"input": "999999",
"output": "0"
},
{
"input": "199880",
"output": "1"
},
{
"input": "899889",
"output": "1"
},
{
"input": "899888",
"output": "1"
},
{
"input": "505777",
"output": "2"
},
{
"input": "999000",
"output": "3"
},
{
"input": "989010",
"output": "3"
},
{
"input": "651894",
"output": "1"
},
{
"input": "858022",
"output": "2"
},
{
"input": "103452",
"output": "1"
},
{
"input": "999801",
"output": "2"
},
{
"input": "999990",
"output": "1"
},
{
"input": "697742",
"output": "1"
},
{
"input": "242367",
"output": "2"
},
{
"input": "099999",
"output": "1"
},
{
"input": "198999",
"output": "1"
},
{
"input": "023680",
"output": "1"
},
{
"input": "999911",
"output": "2"
},
{
"input": "000990",
"output": "2"
},
{
"input": "117099",
"output": "1"
},
{
"input": "990999",
"output": "1"
},
{
"input": "000111",
"output": "1"
},
{
"input": "000444",
"output": "2"
},
{
"input": "202597",
"output": "2"
},
{
"input": "000333",
"output": "1"
},
{
"input": "030039",
"output": "1"
},
{
"input": "000009",
"output": "1"
},
{
"input": "006456",
"output": "1"
},
{
"input": "022995",
"output": "3"
},
{
"input": "999198",
"output": "1"
},
{
"input": "223456",
"output": "2"
},
{
"input": "333665",
"output": "2"
},
{
"input": "123986",
"output": "2"
},
{
"input": "599257",
"output": "1"
},
{
"input": "101488",
"output": "3"
},
{
"input": "111399",
"output": "2"
},
{
"input": "369009",
"output": "1"
},
{
"input": "024887",
"output": "2"
},
{
"input": "314347",
"output": "1"
},
{
"input": "145892",
"output": "1"
},
{
"input": "321933",
"output": "1"
},
{
"input": "100172",
"output": "1"
},
{
"input": "222455",
"output": "2"
},
{
"input": "317596",
"output": "1"
},
{
"input": "979245",
"output": "2"
},
{
"input": "000018",
"output": "1"
},
{
"input": "101389",
"output": "2"
},
{
"input": "123985",
"output": "2"
},
{
"input": "900000",
"output": "1"
},
{
"input": "132069",
"output": "1"
},
{
"input": "949256",
"output": "1"
},
{
"input": "123996",
"output": "2"
},
{
"input": "034988",
"output": "2"
},
{
"input": "320869",
"output": "2"
},
{
"input": "089753",
"output": "1"
},
{
"input": "335667",
"output": "2"
},
{
"input": "868580",
"output": "1"
},
{
"input": "958031",
"output": "2"
},
{
"input": "117999",
"output": "2"
},
{
"input": "000001",
"output": "1"
},
{
"input": "213986",
"output": "2"
},
{
"input": "123987",
"output": "3"
},
{
"input": "111993",
"output": "2"
},
{
"input": "642479",
"output": "1"
},
{
"input": "033788",
"output": "2"
},
{
"input": "766100",
"output": "2"
},
{
"input": "012561",
"output": "1"
},
{
"input": "111695",
"output": "2"
},
{
"input": "123689",
"output": "2"
},
{
"input": "944234",
"output": "1"
},
{
"input": "154999",
"output": "2"
},
{
"input": "333945",
"output": "1"
},
{
"input": "371130",
"output": "1"
},
{
"input": "977330",
"output": "2"
},
{
"input": "777544",
"output": "2"
},
{
"input": "111965",
"output": "2"
},
{
"input": "988430",
"output": "2"
},
{
"input": "123789",
"output": "3"
},
{
"input": "111956",
"output": "2"
},
{
"input": "444776",
"output": "2"
},
{
"input": "001019",
"output": "1"
},
{
"input": "011299",
"output": "2"
},
{
"input": "011389",
"output": "2"
},
{
"input": "999333",
"output": "2"
},
{
"input": "126999",
"output": "2"
},
{
"input": "744438",
"output": "0"
},
{
"input": "588121",
"output": "3"
},
{
"input": "698213",
"output": "2"
},
{
"input": "652858",
"output": "1"
},
{
"input": "989304",
"output": "3"
},
{
"input": "888213",
"output": "3"
},
{
"input": "969503",
"output": "2"
},
{
"input": "988034",
"output": "2"
},
{
"input": "889444",
"output": "2"
},
{
"input": "990900",
"output": "1"
},
{
"input": "301679",
"output": "2"
},
{
"input": "434946",
"output": "1"
},
{
"input": "191578",
"output": "2"
},
{
"input": "118000",
"output": "2"
},
{
"input": "636915",
"output": "0"
},
{
"input": "811010",
"output": "1"
},
{
"input": "822569",
"output": "1"
},
{
"input": "122669",
"output": "2"
},
{
"input": "010339",
"output": "2"
},
{
"input": "213698",
"output": "2"
},
{
"input": "895130",
"output": "2"
},
{
"input": "000900",
"output": "1"
},
{
"input": "191000",
"output": "2"
},
{
"input": "001000",
"output": "1"
},
{
"input": "080189",
"output": "2"
},
{
"input": "990000",
"output": "2"
},
{
"input": "201984",
"output": "2"
},
{
"input": "002667",
"output": "2"
},
{
"input": "877542",
"output": "2"
},
{
"input": "301697",
"output": "2"
},
{
"input": "211597",
"output": "2"
},
{
"input": "420337",
"output": "1"
},
{
"input": "024768",
"output": "2"
},
{
"input": "878033",
"output": "2"
},
{
"input": "788024",
"output": "2"
},
{
"input": "023869",
"output": "2"
},
{
"input": "466341",
"output": "1"
},
{
"input": "696327",
"output": "1"
},
{
"input": "779114",
"output": "2"
},
{
"input": "858643",
"output": "1"
},
{
"input": "011488",
"output": "3"
},
{
"input": "003669",
"output": "2"
},
{
"input": "202877",
"output": "3"
},
{
"input": "738000",
"output": "2"
},
{
"input": "567235",
"output": "2"
},
{
"input": "887321",
"output": "3"
},
{
"input": "401779",
"output": "2"
},
{
"input": "989473",
"output": "2"
},
{
"input": "004977",
"output": "3"
},
{
"input": "023778",
"output": "2"
},
{
"input": "809116",
"output": "1"
},
{
"input": "042762",
"output": "1"
},
{
"input": "777445",
"output": "2"
},
{
"input": "769302",
"output": "2"
},
{
"input": "023977",
"output": "2"
},
{
"input": "990131",
"output": "2"
}
] | 1,548,679,604 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 12 | 93 | 307,200 | s = list(input())
a = list(map(int, s[:3]))
b = list(map(int, s[3:]))
p = sum(a)
q = sum(b)
if p == q:
print(0)
elif p > q:
diff = p - q
num1 = 0
b = sorted(b)
diff -= 9 - b[0]
if diff <= 0:
num1 = 1
else:
diff -= 9 - b[1]
if diff <= 0:
num1 = 2
else:
num1 = 3
diff = p - q
a = sorted(a, reverse=True)
diff -= a[0]
if diff <= 0:
num2 = min(1, num1)
else:
diff -= a[1]
if diff <= 0:
num2 = min(2, num1)
else:
num2 = min(3, num1)
print(num2)
else:
diff = q - p
num1 = 0
a = sorted(a)
diff -= 9 - a[0]
if diff <= 0:
num1 = 1
else:
diff -= 9 - a[1]
if diff <= 0:
num1 = 2
else:
num1 = 3
diff = q - p
b = sorted(b, reverse=True)
diff -= b[0]
if diff <= 0:
num2 = min(1, num1)
else:
diff -= b[1]
if diff <= 0:
num2 = min(2, num1)
else:
num2 = min(3, num1)
print(num2) | Title: Luba And The Ticket
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luba has a ticket consisting of 6 digits. In one move she can choose digit in any position and replace it with arbitrary digit. She wants to know the minimum number of digits she needs to replace in order to make the ticket lucky.
The ticket is considered lucky if the sum of first three digits equals to the sum of last three digits.
Input Specification:
You are given a string consisting of 6 characters (all characters are digits from 0 to 9) — this string denotes Luba's ticket. The ticket can start with the digit 0.
Output Specification:
Print one number — the minimum possible number of digits Luba needs to replace to make the ticket lucky.
Demo Input:
['000000\n', '123456\n', '111000\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first example the ticket is already lucky, so the answer is 0.
In the second example Luba can replace 4 and 5 with zeroes, and the ticket will become lucky. It's easy to see that at least two replacements are required.
In the third example Luba can replace any zero with 3. It's easy to see that at least one replacement is required. | ```python
s = list(input())
a = list(map(int, s[:3]))
b = list(map(int, s[3:]))
p = sum(a)
q = sum(b)
if p == q:
print(0)
elif p > q:
diff = p - q
num1 = 0
b = sorted(b)
diff -= 9 - b[0]
if diff <= 0:
num1 = 1
else:
diff -= 9 - b[1]
if diff <= 0:
num1 = 2
else:
num1 = 3
diff = p - q
a = sorted(a, reverse=True)
diff -= a[0]
if diff <= 0:
num2 = min(1, num1)
else:
diff -= a[1]
if diff <= 0:
num2 = min(2, num1)
else:
num2 = min(3, num1)
print(num2)
else:
diff = q - p
num1 = 0
a = sorted(a)
diff -= 9 - a[0]
if diff <= 0:
num1 = 1
else:
diff -= 9 - a[1]
if diff <= 0:
num1 = 2
else:
num1 = 3
diff = q - p
b = sorted(b, reverse=True)
diff -= b[0]
if diff <= 0:
num2 = min(1, num1)
else:
diff -= b[1]
if diff <= 0:
num2 = min(2, num1)
else:
num2 = min(3, num1)
print(num2)
``` | 0 |
|
374 | A | Inna and Pink Pony | PROGRAMMING | 2,000 | [
"greedy",
"implementation"
] | null | null | Dima and Inna are doing so great! At the moment, Inna is sitting on the magic lawn playing with a pink pony. Dima wanted to play too. He brought an *n*<=×<=*m* chessboard, a very tasty candy and two numbers *a* and *b*.
Dima put the chessboard in front of Inna and placed the candy in position (*i*,<=*j*) on the board. The boy said he would give the candy if it reaches one of the corner cells of the board. He's got one more condition. There can only be actions of the following types:
- move the candy from position (*x*,<=*y*) on the board to position (*x*<=-<=*a*,<=*y*<=-<=*b*); - move the candy from position (*x*,<=*y*) on the board to position (*x*<=+<=*a*,<=*y*<=-<=*b*); - move the candy from position (*x*,<=*y*) on the board to position (*x*<=-<=*a*,<=*y*<=+<=*b*); - move the candy from position (*x*,<=*y*) on the board to position (*x*<=+<=*a*,<=*y*<=+<=*b*).
Naturally, Dima doesn't allow to move the candy beyond the chessboard borders.
Inna and the pony started shifting the candy around the board. They wonder what is the minimum number of allowed actions that they need to perform to move the candy from the initial position (*i*,<=*j*) to one of the chessboard corners. Help them cope with the task! | The first line of the input contains six integers *n*,<=*m*,<=*i*,<=*j*,<=*a*,<=*b* (1<=≤<=*n*,<=*m*<=≤<=106; 1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*; 1<=≤<=*a*,<=*b*<=≤<=106).
You can assume that the chessboard rows are numbered from 1 to *n* from top to bottom and the columns are numbered from 1 to *m* from left to right. Position (*i*,<=*j*) in the statement is a chessboard cell on the intersection of the *i*-th row and the *j*-th column. You can consider that the corners are: (1,<=*m*), (*n*,<=1), (*n*,<=*m*), (1,<=1). | In a single line print a single integer — the minimum number of moves needed to get the candy.
If Inna and the pony cannot get the candy playing by Dima's rules, print on a single line "Poor Inna and pony!" without the quotes. | [
"5 7 1 3 2 2\n",
"5 5 2 3 1 1\n"
] | [
"2\n",
"Poor Inna and pony!\n"
] | Note to sample 1:
Inna and the pony can move the candy to position (1 + 2, 3 + 2) = (3, 5), from there they can move it to positions (3 - 2, 5 + 2) = (1, 7) and (3 + 2, 5 + 2) = (5, 7). These positions correspond to the corner squares of the chess board. Thus, the answer to the test sample equals two. | 500 | [
{
"input": "5 7 1 3 2 2",
"output": "2"
},
{
"input": "5 5 2 3 1 1",
"output": "Poor Inna and pony!"
},
{
"input": "1 1 1 1 1 1",
"output": "0"
},
{
"input": "23000 15500 100 333 9 1",
"output": "15167"
},
{
"input": "33999 99333 33000 99000 3 9",
"output": "333"
},
{
"input": "5 7 1 3 1 2",
"output": "2"
},
{
"input": "1 100 1 50 1 50",
"output": "Poor Inna and pony!"
},
{
"input": "1000 1 1 1 1 500",
"output": "0"
},
{
"input": "304 400 12 20 4 4",
"output": "95"
},
{
"input": "1000000 1000000 1000000 1000000 1000000 1000000",
"output": "0"
},
{
"input": "1000000 99999 12345 23456 23 54",
"output": "Poor Inna and pony!"
},
{
"input": "50000 100000 500 1000 500 1000",
"output": "99"
},
{
"input": "50000 100000 500 1000 500 2000",
"output": "Poor Inna and pony!"
},
{
"input": "50000 100000 500 1000 500 500",
"output": "Poor Inna and pony!"
},
{
"input": "99999 99999 1 2 1 1",
"output": "Poor Inna and pony!"
},
{
"input": "5 4 2 3 2 2",
"output": "Poor Inna and pony!"
},
{
"input": "5 4 2 3 1 1",
"output": "1"
},
{
"input": "5 5 1 3 1 2",
"output": "Poor Inna and pony!"
},
{
"input": "2347 2348 234 48 238 198",
"output": "Poor Inna and pony!"
},
{
"input": "1000000 2 2 2 2 1",
"output": "499999"
},
{
"input": "100 100 50 50 500 500",
"output": "Poor Inna and pony!"
},
{
"input": "1000 2000 100 200 90 90",
"output": "20"
},
{
"input": "1000 1000 10 15 10 5",
"output": "197"
},
{
"input": "23000 15500 100 333 9 1",
"output": "15167"
},
{
"input": "5 5 4 3 1 2",
"output": "1"
},
{
"input": "5 5 4 4 1 1",
"output": "1"
},
{
"input": "5 5 4 2 1 1",
"output": "1"
},
{
"input": "3 3 2 2 2 2",
"output": "Poor Inna and pony!"
},
{
"input": "5 8 4 1 2 1",
"output": "Poor Inna and pony!"
},
{
"input": "5 8 4 2 1 2",
"output": "3"
},
{
"input": "2 8 1 2 1 3",
"output": "2"
},
{
"input": "1000000 1000000 500000 500000 1 1",
"output": "499999"
},
{
"input": "500000 100000 400 80000 2 2",
"output": "249800"
},
{
"input": "1004 999004 4 4 5 5",
"output": "199800"
},
{
"input": "11 11 3 3 4 4",
"output": "2"
},
{
"input": "100 100 70 5 1 1",
"output": "30"
},
{
"input": "1 5 1 3 1 1",
"output": "Poor Inna and pony!"
},
{
"input": "1 5 1 3 10 1",
"output": "Poor Inna and pony!"
},
{
"input": "6 1 5 1 2 2",
"output": "Poor Inna and pony!"
},
{
"input": "2 10 1 5 2 2",
"output": "Poor Inna and pony!"
},
{
"input": "5 1 3 1 1 1",
"output": "Poor Inna and pony!"
},
{
"input": "1000 1000 1 3 10000 1",
"output": "Poor Inna and pony!"
},
{
"input": "2 6 1 2 2 2",
"output": "Poor Inna and pony!"
},
{
"input": "2 6 1 2 6 2",
"output": "Poor Inna and pony!"
},
{
"input": "7 1 5 1 2 2",
"output": "Poor Inna and pony!"
},
{
"input": "2 20 2 5 2 2",
"output": "Poor Inna and pony!"
},
{
"input": "4 4 3 4 1 5",
"output": "Poor Inna and pony!"
}
] | 1,632,500,427 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 46 | 6,963,200 | n=int(input())
k=[f"{i}" for i in range(1,n+1)]
x=input().split()
y=input().split()
l=[]
for i in x[1:]:
l.append(i)
for j in y[1:]:
l.append(j)
l=list(set(l))
k=list(set(k))
l=(sorted(l))
k=(sorted(k))
if l==k:
print("I become the guy.")
else:
print("Oh, my keyboard!") | Title: Inna and Pink Pony
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and Inna are doing so great! At the moment, Inna is sitting on the magic lawn playing with a pink pony. Dima wanted to play too. He brought an *n*<=×<=*m* chessboard, a very tasty candy and two numbers *a* and *b*.
Dima put the chessboard in front of Inna and placed the candy in position (*i*,<=*j*) on the board. The boy said he would give the candy if it reaches one of the corner cells of the board. He's got one more condition. There can only be actions of the following types:
- move the candy from position (*x*,<=*y*) on the board to position (*x*<=-<=*a*,<=*y*<=-<=*b*); - move the candy from position (*x*,<=*y*) on the board to position (*x*<=+<=*a*,<=*y*<=-<=*b*); - move the candy from position (*x*,<=*y*) on the board to position (*x*<=-<=*a*,<=*y*<=+<=*b*); - move the candy from position (*x*,<=*y*) on the board to position (*x*<=+<=*a*,<=*y*<=+<=*b*).
Naturally, Dima doesn't allow to move the candy beyond the chessboard borders.
Inna and the pony started shifting the candy around the board. They wonder what is the minimum number of allowed actions that they need to perform to move the candy from the initial position (*i*,<=*j*) to one of the chessboard corners. Help them cope with the task!
Input Specification:
The first line of the input contains six integers *n*,<=*m*,<=*i*,<=*j*,<=*a*,<=*b* (1<=≤<=*n*,<=*m*<=≤<=106; 1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*; 1<=≤<=*a*,<=*b*<=≤<=106).
You can assume that the chessboard rows are numbered from 1 to *n* from top to bottom and the columns are numbered from 1 to *m* from left to right. Position (*i*,<=*j*) in the statement is a chessboard cell on the intersection of the *i*-th row and the *j*-th column. You can consider that the corners are: (1,<=*m*), (*n*,<=1), (*n*,<=*m*), (1,<=1).
Output Specification:
In a single line print a single integer — the minimum number of moves needed to get the candy.
If Inna and the pony cannot get the candy playing by Dima's rules, print on a single line "Poor Inna and pony!" without the quotes.
Demo Input:
['5 7 1 3 2 2\n', '5 5 2 3 1 1\n']
Demo Output:
['2\n', 'Poor Inna and pony!\n']
Note:
Note to sample 1:
Inna and the pony can move the candy to position (1 + 2, 3 + 2) = (3, 5), from there they can move it to positions (3 - 2, 5 + 2) = (1, 7) and (3 + 2, 5 + 2) = (5, 7). These positions correspond to the corner squares of the chess board. Thus, the answer to the test sample equals two. | ```python
n=int(input())
k=[f"{i}" for i in range(1,n+1)]
x=input().split()
y=input().split()
l=[]
for i in x[1:]:
l.append(i)
for j in y[1:]:
l.append(j)
l=list(set(l))
k=list(set(k))
l=(sorted(l))
k=(sorted(k))
if l==k:
print("I become the guy.")
else:
print("Oh, my keyboard!")
``` | -1 |
|
33 | A | What is for dinner? | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | A. What is for dinner? | 2 | 256 | In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one. | The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth. | In the first line output the maximum amount of crucians that Valerie can consume for dinner. | [
"4 3 18\n2 3\n1 2\n3 6\n2 3\n",
"2 2 13\n1 13\n2 12\n"
] | [
"11\n",
"13\n"
] | none | 500 | [
{
"input": "4 3 18\n2 3\n1 2\n3 6\n2 3",
"output": "11"
},
{
"input": "2 2 13\n1 13\n2 12",
"output": "13"
},
{
"input": "5 4 8\n4 6\n4 5\n1 3\n2 0\n3 3",
"output": "8"
},
{
"input": "1 1 0\n1 3",
"output": "0"
},
{
"input": "7 1 30\n1 8\n1 15\n1 5\n1 17\n1 9\n1 16\n1 16",
"output": "5"
},
{
"input": "4 2 8\n1 9\n1 10\n1 4\n2 6",
"output": "8"
},
{
"input": "10 4 14\n2 6\n1 5\n2 8\n2 6\n2 5\n4 1\n4 0\n2 4\n3 4\n1 0",
"output": "8"
},
{
"input": "54 22 1009\n15 7\n17 7\n11 9\n5 11\n12 9\n13 8\n13 12\n22 11\n20 9\n20 7\n16 11\n19 12\n3 12\n15 9\n1 12\n2 10\n16 10\n16 10\n14 10\n9 11\n9 9\n14 8\n10 10\n16 12\n1 8\n3 8\n21 11\n18 12\n2 6\n9 11\n11 7\n15 9\n20 11\n6 8\n8 8\n19 11\n15 7\n9 9\n22 7\n12 9\n17 9\n17 11\n12 7\n15 9\n5 11\n11 6\n18 8\n7 10\n4 10\n13 12\n4 8\n20 6\n15 12\n9 7",
"output": "180"
},
{
"input": "1 1 1000000\n1 1000000",
"output": "1000000"
},
{
"input": "4 3 181818\n3 1299\n1 1694\n3 1164\n2 1278",
"output": "4136"
},
{
"input": "50 50 0\n33 0\n26 0\n30 0\n41 0\n38 0\n36 0\n16 0\n7 0\n23 0\n5 0\n39 0\n29 0\n40 0\n47 0\n24 0\n43 0\n14 0\n10 0\n20 0\n3 0\n6 0\n34 0\n13 0\n18 0\n21 0\n9 0\n8 0\n22 0\n25 0\n4 0\n11 0\n17 0\n32 0\n44 0\n49 0\n50 0\n27 0\n28 0\n45 0\n12 0\n35 0\n15 0\n42 0\n31 0\n2 0\n1 0\n48 0\n19 0\n37 0\n46 0",
"output": "0"
},
{
"input": "19 12 199\n7 1\n8 6\n6 14\n1 7\n4 1\n6 6\n3 4\n1 5\n9 2\n5 3\n11 3\n9 4\n1 12\n4 7\n7 3\n12 14\n2 1\n10 8\n6 12",
"output": "54"
}
] | 1,622,744,193 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 186 | 0 | test=int(input())
result=[]
for i in range(test):
n=int(input())
if n<10:
result.append(n)
else:
result.append((n//10)+8)
for i in result:
print(i) | Title: What is for dinner?
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth.
Output Specification:
In the first line output the maximum amount of crucians that Valerie can consume for dinner.
Demo Input:
['4 3 18\n2 3\n1 2\n3 6\n2 3\n', '2 2 13\n1 13\n2 12\n']
Demo Output:
['11\n', '13\n']
Note:
none | ```python
test=int(input())
result=[]
for i in range(test):
n=int(input())
if n<10:
result.append(n)
else:
result.append((n//10)+8)
for i in result:
print(i)
``` | -1 |
270 | A | Fancy Fence | PROGRAMMING | 1,100 | [
"geometry",
"implementation",
"math"
] | null | null | Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? | The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees. | For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. | [
"3\n30\n60\n90\n"
] | [
"NO\nYES\nYES\n"
] | In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | 500 | [
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,698,863,007 | 2,147,483,647 | PyPy 3-64 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | // Md Abu Omayer Babu
#include <bits/stdc++.h>
using namespace std;
int main() {
int t;
cin>>t;
while(t--){
int a;
cin>>a;
if(360%(180-a)==0){
cout<<"YES\n";
}else{
cout<<"NO\n";
}
}
return 0;
} | Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | ```python
// Md Abu Omayer Babu
#include <bits/stdc++.h>
using namespace std;
int main() {
int t;
cin>>t;
while(t--){
int a;
cin>>a;
if(360%(180-a)==0){
cout<<"YES\n";
}else{
cout<<"NO\n";
}
}
return 0;
}
``` | -1 |
|
111 | E | Petya and Rectangle | PROGRAMMING | 2,900 | [] | E. Petya and Rectangle | 5 | 256 | Little Petya loves playing with rectangles. Mom bought Petya a rectangle divided into cells *n*<=×<=*m* in size (containing *n* rows, *m* columns). Petya marked two different cells of the rectangle and now he is solving the following task:
Let's define a simple path between those two cells as a sequence of distinct cells *a*1,<=*a*2,<=...,<=*a**k*, where *a*1 and *a**k* are the two marked cells. Besides, *a**i* and *a**i*<=+<=1 are side-neighboring cells of the path (1<=≤<=*i*<=<<=*k*). Let's denote the path length as number *k* (the sequence length).
Petya's task is to find the longest simple path's length and to print the path. Help him. | The first line contains space-separated integers *n* and *m* (4<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the rectangle, correspondingly. The second line contains space-separated integers *x*1 and *y*1 — the coordinates of the first marked cell. The third line contains space-separated integers *x*2 *y*2 — the coordinates of the second marked cell (1<=<<=*x*1,<=*x*2<=<<=*n*,<=1<=<<=*y*1,<=*y*2<=<<=*m*,<=*x*1<=≠<=*x*2,<=*y*1<=≠<=*y*2).
The coordinates of a marked cell are a pair of integers *x* *y*, where *x* represents the row's number and *y* represents the column's number. The rows are numbered from top to bottom with consecutive integers from 1 to *n*. The columns are numbered from the left to the right by consecutive integers from 1 to *m*.
It is guaranteed that the marked cells are not positioned in one row or column. | In the first line print the length of the found path — *k*. In the next lines print *k* pairs of integers, one per line — coordinates of the cells that constitute the found path in the order, in which they follow in the path (the path must go from cell (*x*1,<=*y*1) to cell (*x*2,<=*y*2)). If there are several solutions, print any of them. | [
"4 4\n2 2\n3 3\n"
] | [
"15\n2 2\n1 2\n1 1\n2 1\n3 1\n4 1\n4 2\n4 3\n4 4\n3 4\n2 4\n1 4\n1 3\n2 3\n3 3\n"
] | The statement test is described in the picture: | 2,500 | [] | 1,696,753,414 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | n, m = map(int, input().split())
x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
path = []
# Add the starting cell to the path
path.append((x1, y1))
# Add the cells in a zigzag pattern to the path
for i in range(1, n + 1):
if i % 2 == 1:
for j in range(1, m + 1):
if (i != x1 or j != y1) and (i != x2 or j != y2):
path.append((i, j))
else:
for j in range(m, 0, -1):
if (i != x1 or j != y1) and (i != x2 or j != y2):
path.append((i, j))
# Add the ending cell to the path
path.append((x2, y2))
# Print the length of the path
print(len(path))
# Print the coordinates of the cells in the path
for cell in path:
print(cell[0], cell[1])
| Title: Petya and Rectangle
Time Limit: 5 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya loves playing with rectangles. Mom bought Petya a rectangle divided into cells *n*<=×<=*m* in size (containing *n* rows, *m* columns). Petya marked two different cells of the rectangle and now he is solving the following task:
Let's define a simple path between those two cells as a sequence of distinct cells *a*1,<=*a*2,<=...,<=*a**k*, where *a*1 and *a**k* are the two marked cells. Besides, *a**i* and *a**i*<=+<=1 are side-neighboring cells of the path (1<=≤<=*i*<=<<=*k*). Let's denote the path length as number *k* (the sequence length).
Petya's task is to find the longest simple path's length and to print the path. Help him.
Input Specification:
The first line contains space-separated integers *n* and *m* (4<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the rectangle, correspondingly. The second line contains space-separated integers *x*1 and *y*1 — the coordinates of the first marked cell. The third line contains space-separated integers *x*2 *y*2 — the coordinates of the second marked cell (1<=<<=*x*1,<=*x*2<=<<=*n*,<=1<=<<=*y*1,<=*y*2<=<<=*m*,<=*x*1<=≠<=*x*2,<=*y*1<=≠<=*y*2).
The coordinates of a marked cell are a pair of integers *x* *y*, where *x* represents the row's number and *y* represents the column's number. The rows are numbered from top to bottom with consecutive integers from 1 to *n*. The columns are numbered from the left to the right by consecutive integers from 1 to *m*.
It is guaranteed that the marked cells are not positioned in one row or column.
Output Specification:
In the first line print the length of the found path — *k*. In the next lines print *k* pairs of integers, one per line — coordinates of the cells that constitute the found path in the order, in which they follow in the path (the path must go from cell (*x*1,<=*y*1) to cell (*x*2,<=*y*2)). If there are several solutions, print any of them.
Demo Input:
['4 4\n2 2\n3 3\n']
Demo Output:
['15\n2 2\n1 2\n1 1\n2 1\n3 1\n4 1\n4 2\n4 3\n4 4\n3 4\n2 4\n1 4\n1 3\n2 3\n3 3\n']
Note:
The statement test is described in the picture: | ```python
n, m = map(int, input().split())
x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
path = []
# Add the starting cell to the path
path.append((x1, y1))
# Add the cells in a zigzag pattern to the path
for i in range(1, n + 1):
if i % 2 == 1:
for j in range(1, m + 1):
if (i != x1 or j != y1) and (i != x2 or j != y2):
path.append((i, j))
else:
for j in range(m, 0, -1):
if (i != x1 or j != y1) and (i != x2 or j != y2):
path.append((i, j))
# Add the ending cell to the path
path.append((x2, y2))
# Print the length of the path
print(len(path))
# Print the coordinates of the cells in the path
for cell in path:
print(cell[0], cell[1])
``` | 0 |
454 | A | Little Pony and Crystal Mine | PROGRAMMING | 800 | [
"implementation"
] | null | null | Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw. | The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd). | Output a crystal of size *n*. | [
"3\n",
"5\n",
"7\n"
] | [
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] | none | 500 | [
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,584,882,056 | 2,147,483,647 | Python 3 | OK | TESTS | 12 | 108 | 0 | q=lambda:map(int,input().split())
qi=lambda:int(input())
qs=lambda:input().split()
n=qi()
star=n//2
d=1
for i in range(n//2):
print('*'*star+'D'*d+'*'*star)
star-=1
d+=2
print('D'*n)
for i in range(n//2):
star+=1
d-=2
print('*'*star+'D'*d+'*'*star) | Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none | ```python
q=lambda:map(int,input().split())
qi=lambda:int(input())
qs=lambda:input().split()
n=qi()
star=n//2
d=1
for i in range(n//2):
print('*'*star+'D'*d+'*'*star)
star-=1
d+=2
print('D'*n)
for i in range(n//2):
star+=1
d-=2
print('*'*star+'D'*d+'*'*star)
``` | 3 |
|
600 | B | Queries about less or equal elements | PROGRAMMING | 1,300 | [
"binary search",
"data structures",
"sortings",
"two pointers"
] | null | null | You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*. | The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*.
The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109).
The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109). | Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*. | [
"5 4\n1 3 5 7 9\n6 4 2 8\n",
"5 5\n1 2 1 2 5\n3 1 4 1 5\n"
] | [
"3 2 1 4\n",
"4 2 4 2 5\n"
] | none | 0 | [
{
"input": "5 4\n1 3 5 7 9\n6 4 2 8",
"output": "3 2 1 4"
},
{
"input": "5 5\n1 2 1 2 5\n3 1 4 1 5",
"output": "4 2 4 2 5"
},
{
"input": "1 1\n-1\n-2",
"output": "0"
},
{
"input": "1 1\n-80890826\n686519510",
"output": "1"
},
{
"input": "11 11\n237468511 -779187544 -174606592 193890085 404563196 -71722998 -617934776 170102710 -442808289 109833389 953091341\n994454001 322957429 216874735 -606986750 -455806318 -663190696 3793295 41395397 -929612742 -787653860 -684738874",
"output": "11 9 8 2 2 1 5 5 0 0 1"
},
{
"input": "20 22\n858276994 -568758442 -918490847 -983345984 -172435358 389604931 200224783 486556113 413281867 -258259500 -627945379 -584563643 444685477 -602481243 -370745158 965672503 630955806 -626138773 -997221880 633102929\n-61330638 -977252080 -212144219 385501731 669589742 954357160 563935906 584468977 -895883477 405774444 853372186 186056475 -964575261 -952431965 632332084 -388829939 -23011650 310957048 -770695392 977376693 321435214 199223897",
"output": "11 2 10 12 18 19 16 16 3 13 18 11 2 2 17 8 11 12 3 20 12 11"
},
{
"input": "5 9\n1 3 5 7 9\n1 2 3 4 5 6 7 8 9",
"output": "1 1 2 2 3 3 4 4 5"
},
{
"input": "22 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22\n1",
"output": "1"
},
{
"input": "5 1\n1 3 3 3 5\n3",
"output": "4"
},
{
"input": "4 5\n1 1 1 4\n1 5 5 4 3",
"output": "3 4 4 4 3"
},
{
"input": "5 4\n0 5 5 5 6\n5 1 6 3",
"output": "4 1 5 1"
},
{
"input": "1 3\n0\n-1 0 1",
"output": "0 1 1"
},
{
"input": "96 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1",
"output": "96"
},
{
"input": "7 1\n1 2 3 4 5 6 7\n1",
"output": "1"
},
{
"input": "13 13\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000",
"output": "7 13 7 13 7 13 7 13 7 13 7 13 7"
},
{
"input": "9 5\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "3 8\n1 1 1\n1 1 1 1 1 1 1 1",
"output": "3 3 3 3 3 3 3 3"
},
{
"input": "1 1\n-11111\n-5938",
"output": "1"
},
{
"input": "1 1\n1\n400000009",
"output": "1"
},
{
"input": "1 1\n1\n300000009",
"output": "1"
},
{
"input": "1 1\n1\n200000009",
"output": "1"
},
{
"input": "1 1\n1\n200000003",
"output": "1"
}
] | 1,664,544,676 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 46 | 0 | # your code goes here
def search(a,k):
l,r = 0,len(a)-1
while l<=r:
m = l + (r-l)//2
if a[m] == k:
l=m+1
elif a[m]>k:
r = m-1
else:
l = m+1
return l
m,n=map(int,input().split())
a,b=list(map(int,input().split())),list(map(int,input().split()))
a=sorted(a)
print(a,b)
for i in b:
print(search(a,i),end=' ')
| Title: Queries about less or equal elements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays of integers *a* and *b*. For each element of the second array *b**j* you should find the number of elements in array *a* that are less than or equal to the value *b**j*.
Input Specification:
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the sizes of arrays *a* and *b*.
The second line contains *n* integers — the elements of array *a* (<=-<=109<=≤<=*a**i*<=≤<=109).
The third line contains *m* integers — the elements of array *b* (<=-<=109<=≤<=*b**j*<=≤<=109).
Output Specification:
Print *m* integers, separated by spaces: the *j*-th of which is equal to the number of such elements in array *a* that are less than or equal to the value *b**j*.
Demo Input:
['5 4\n1 3 5 7 9\n6 4 2 8\n', '5 5\n1 2 1 2 5\n3 1 4 1 5\n']
Demo Output:
['3 2 1 4\n', '4 2 4 2 5\n']
Note:
none | ```python
# your code goes here
def search(a,k):
l,r = 0,len(a)-1
while l<=r:
m = l + (r-l)//2
if a[m] == k:
l=m+1
elif a[m]>k:
r = m-1
else:
l = m+1
return l
m,n=map(int,input().split())
a,b=list(map(int,input().split())),list(map(int,input().split()))
a=sorted(a)
print(a,b)
for i in b:
print(search(a,i),end=' ')
``` | 0 |
|
320 | A | Magic Numbers | PROGRAMMING | 900 | [
"brute force",
"greedy"
] | null | null | A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not. | The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros. | Print "YES" if *n* is a magic number or print "NO" if it's not. | [
"114114\n",
"1111\n",
"441231\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "114114",
"output": "YES"
},
{
"input": "1111",
"output": "YES"
},
{
"input": "441231",
"output": "NO"
},
{
"input": "1",
"output": "YES"
},
{
"input": "14",
"output": "YES"
},
{
"input": "114",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "414",
"output": "NO"
},
{
"input": "1000000000",
"output": "NO"
},
{
"input": "144144144",
"output": "YES"
},
{
"input": "1444",
"output": "NO"
},
{
"input": "11",
"output": "YES"
},
{
"input": "141414141",
"output": "YES"
},
{
"input": "11110111",
"output": "NO"
},
{
"input": "114114144",
"output": "YES"
},
{
"input": "444",
"output": "NO"
},
{
"input": "9999",
"output": "NO"
},
{
"input": "111444",
"output": "NO"
},
{
"input": "11114",
"output": "YES"
},
{
"input": "41111",
"output": "NO"
},
{
"input": "114414441",
"output": "NO"
},
{
"input": "144414441",
"output": "NO"
},
{
"input": "144244144",
"output": "NO"
},
{
"input": "111111111",
"output": "YES"
},
{
"input": "144444444",
"output": "NO"
},
{
"input": "444444444",
"output": "NO"
},
{
"input": "141441441",
"output": "YES"
},
{
"input": "441",
"output": "NO"
},
{
"input": "15",
"output": "NO"
},
{
"input": "14444",
"output": "NO"
},
{
"input": "11444",
"output": "NO"
},
{
"input": "144",
"output": "YES"
},
{
"input": "1414414",
"output": "YES"
},
{
"input": "141444",
"output": "NO"
},
{
"input": "14144",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "1144",
"output": "YES"
},
{
"input": "141111444",
"output": "NO"
},
{
"input": "14414414",
"output": "YES"
},
{
"input": "141414144",
"output": "YES"
},
{
"input": "1414",
"output": "YES"
},
{
"input": "1441",
"output": "YES"
},
{
"input": "12",
"output": "NO"
},
{
"input": "144144141",
"output": "YES"
},
{
"input": "144144",
"output": "YES"
},
{
"input": "14414411",
"output": "YES"
},
{
"input": "14414",
"output": "YES"
}
] | 1,621,827,909 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 2 | 154 | 0 | nums = input()
for i in nums:
if i != '1' and i != '4':
exit('NO')
print('YES') | Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
Input Specification:
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Output Specification:
Print "YES" if *n* is a magic number or print "NO" if it's not.
Demo Input:
['114114\n', '1111\n', '441231\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none | ```python
nums = input()
for i in nums:
if i != '1' and i != '4':
exit('NO')
print('YES')
``` | -1 |
|
459 | B | Pashmak and Flowers | PROGRAMMING | 1,300 | [
"combinatorics",
"implementation",
"sortings"
] | null | null | Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way. | The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109). | The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively. | [
"2\n1 2\n",
"3\n1 4 5\n",
"5\n3 1 2 3 1\n"
] | [
"1 1",
"4 1",
"2 4"
] | In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers. | 500 | [
{
"input": "2\n1 2",
"output": "1 1"
},
{
"input": "3\n1 4 5",
"output": "4 1"
},
{
"input": "5\n3 1 2 3 1",
"output": "2 4"
},
{
"input": "2\n1 1",
"output": "0 1"
},
{
"input": "3\n1 1 1",
"output": "0 3"
},
{
"input": "4\n1 1 1 1",
"output": "0 6"
},
{
"input": "5\n1 1 1 1 1",
"output": "0 10"
},
{
"input": "5\n2 2 2 2 2",
"output": "0 10"
},
{
"input": "10\n2 2 2 2 2 2 2 2 2 2",
"output": "0 45"
},
{
"input": "3\n2 2 2",
"output": "0 3"
},
{
"input": "3\n3 3 3",
"output": "0 3"
},
{
"input": "2\n10000000 100000000",
"output": "90000000 1"
},
{
"input": "5\n5 5 5 5 5",
"output": "0 10"
},
{
"input": "5\n3 3 3 3 3",
"output": "0 10"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "0 15"
},
{
"input": "2\n5 6",
"output": "1 1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0 45"
},
{
"input": "10\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "0 45"
},
{
"input": "4\n4 4 4 4",
"output": "0 6"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "0 21"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 1 1",
"output": "0 55"
},
{
"input": "8\n8 8 8 8 8 8 8 8",
"output": "0 28"
},
{
"input": "2\n3 2",
"output": "1 1"
}
] | 1,684,179,466 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 78 | 17,612,800 | n = int(input())
a = list(map(int,input().split()))
mn,mx= min(a),max(a)
xc,mc=a.count(mx),a.count(mn)
print(mx-mn,xc*mc) | Title: Pashmak and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way.
Input Specification:
The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109).
Output Specification:
The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively.
Demo Input:
['2\n1 2\n', '3\n1 4 5\n', '5\n3 1 2 3 1\n']
Demo Output:
['1 1', '4 1', '2 4']
Note:
In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers. | ```python
n = int(input())
a = list(map(int,input().split()))
mn,mx= min(a),max(a)
xc,mc=a.count(mx),a.count(mn)
print(mx-mn,xc*mc)
``` | 0 |
|
950 | A | Left-handers, Right-handers and Ambidexters | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively. | The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training. | Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players. | [
"1 4 2\n",
"5 5 5\n",
"0 2 0\n"
] | [
"6\n",
"14\n",
"0\n"
] | In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand. | 500 | [
{
"input": "1 4 2",
"output": "6"
},
{
"input": "5 5 5",
"output": "14"
},
{
"input": "0 2 0",
"output": "0"
},
{
"input": "30 70 34",
"output": "128"
},
{
"input": "89 32 24",
"output": "112"
},
{
"input": "89 44 77",
"output": "210"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "100 100 100",
"output": "300"
},
{
"input": "1 1 1",
"output": "2"
},
{
"input": "30 70 35",
"output": "130"
},
{
"input": "89 44 76",
"output": "208"
},
{
"input": "0 100 100",
"output": "200"
},
{
"input": "100 0 100",
"output": "200"
},
{
"input": "100 1 100",
"output": "200"
},
{
"input": "1 100 100",
"output": "200"
},
{
"input": "100 100 0",
"output": "200"
},
{
"input": "100 100 1",
"output": "200"
},
{
"input": "1 2 1",
"output": "4"
},
{
"input": "0 0 100",
"output": "100"
},
{
"input": "0 100 0",
"output": "0"
},
{
"input": "100 0 0",
"output": "0"
},
{
"input": "10 8 7",
"output": "24"
},
{
"input": "45 47 16",
"output": "108"
},
{
"input": "59 43 100",
"output": "202"
},
{
"input": "34 1 30",
"output": "62"
},
{
"input": "14 81 1",
"output": "30"
},
{
"input": "53 96 94",
"output": "242"
},
{
"input": "62 81 75",
"output": "218"
},
{
"input": "21 71 97",
"output": "188"
},
{
"input": "49 82 73",
"output": "204"
},
{
"input": "88 19 29",
"output": "96"
},
{
"input": "89 4 62",
"output": "132"
},
{
"input": "58 3 65",
"output": "126"
},
{
"input": "27 86 11",
"output": "76"
},
{
"input": "35 19 80",
"output": "134"
},
{
"input": "4 86 74",
"output": "156"
},
{
"input": "32 61 89",
"output": "182"
},
{
"input": "68 60 98",
"output": "226"
},
{
"input": "37 89 34",
"output": "142"
},
{
"input": "92 9 28",
"output": "74"
},
{
"input": "79 58 98",
"output": "234"
},
{
"input": "35 44 88",
"output": "166"
},
{
"input": "16 24 19",
"output": "58"
},
{
"input": "74 71 75",
"output": "220"
},
{
"input": "83 86 99",
"output": "268"
},
{
"input": "97 73 15",
"output": "176"
},
{
"input": "77 76 73",
"output": "226"
},
{
"input": "48 85 55",
"output": "188"
},
{
"input": "1 2 2",
"output": "4"
},
{
"input": "2 2 2",
"output": "6"
},
{
"input": "2 1 2",
"output": "4"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "3 2 1",
"output": "6"
},
{
"input": "1 2 3",
"output": "6"
},
{
"input": "1 3 2",
"output": "6"
},
{
"input": "2 1 3",
"output": "6"
},
{
"input": "2 3 1",
"output": "6"
},
{
"input": "3 1 2",
"output": "6"
},
{
"input": "99 99 99",
"output": "296"
},
{
"input": "99 99 100",
"output": "298"
},
{
"input": "99 100 99",
"output": "298"
},
{
"input": "99 100 100",
"output": "298"
},
{
"input": "100 99 99",
"output": "298"
},
{
"input": "100 99 100",
"output": "298"
},
{
"input": "100 100 99",
"output": "298"
},
{
"input": "89 32 23",
"output": "110"
},
{
"input": "4 5 0",
"output": "8"
},
{
"input": "3 0 3",
"output": "6"
},
{
"input": "0 0 2",
"output": "2"
},
{
"input": "97 97 0",
"output": "194"
},
{
"input": "1 4 0",
"output": "2"
},
{
"input": "5 2 0",
"output": "4"
},
{
"input": "0 5 10",
"output": "14"
},
{
"input": "0 1 2",
"output": "2"
},
{
"input": "5 2 3",
"output": "10"
},
{
"input": "5 5 0",
"output": "10"
},
{
"input": "0 0 10",
"output": "10"
},
{
"input": "0 1 1",
"output": "2"
},
{
"input": "0 0 1",
"output": "0"
}
] | 1,544,194,472 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | x=list(map(int,input().split()))
if x[2]==0 or 1:
if x[0]<x[1]:
answer=x[0]*2
else:
answer=x[1]*2
while x[2]>1 :
if x[0]<x[1]:
x[0]=x[0]+1
x[2]=x[2]-1
answer=x[0]*2
else:
x[1]+=1
x[2]-=1
answer=x[1]*2
if x[0]==0 or x[1]==0:
answer=0
print(answer)
| Title: Left-handers, Right-handers and Ambidexters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively.
Input Specification:
The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training.
Output Specification:
Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players.
Demo Input:
['1 4 2\n', '5 5 5\n', '0 2 0\n']
Demo Output:
['6\n', '14\n', '0\n']
Note:
In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand. | ```python
x=list(map(int,input().split()))
if x[2]==0 or 1:
if x[0]<x[1]:
answer=x[0]*2
else:
answer=x[1]*2
while x[2]>1 :
if x[0]<x[1]:
x[0]=x[0]+1
x[2]=x[2]-1
answer=x[0]*2
else:
x[1]+=1
x[2]-=1
answer=x[1]*2
if x[0]==0 or x[1]==0:
answer=0
print(answer)
``` | 0 |
|
653 | A | Bear and Three Balls | PROGRAMMING | 900 | [
"brute force",
"implementation",
"sortings"
] | null | null | Limak is a little polar bear. He has *n* balls, the *i*-th ball has size *t**i*.
Limak wants to give one ball to each of his three friends. Giving gifts isn't easy — there are two rules Limak must obey to make friends happy:
- No two friends can get balls of the same size. - No two friends can get balls of sizes that differ by more than 2.
For example, Limak can choose balls with sizes 4, 5 and 3, or balls with sizes 90, 91 and 92. But he can't choose balls with sizes 5, 5 and 6 (two friends would get balls of the same size), and he can't choose balls with sizes 30, 31 and 33 (because sizes 30 and 33 differ by more than 2).
Your task is to check whether Limak can choose three balls that satisfy conditions above. | The first line of the input contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of balls Limak has.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000) where *t**i* denotes the size of the *i*-th ball. | Print "YES" (without quotes) if Limak can choose three balls of distinct sizes, such that any two of them differ by no more than 2. Otherwise, print "NO" (without quotes). | [
"4\n18 55 16 17\n",
"6\n40 41 43 44 44 44\n",
"8\n5 972 3 4 1 4 970 971\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | In the first sample, there are 4 balls and Limak is able to choose three of them to satisfy the rules. He must must choose balls with sizes 18, 16 and 17.
In the second sample, there is no way to give gifts to three friends without breaking the rules.
In the third sample, there is even more than one way to choose balls:
1. Choose balls with sizes 3, 4 and 5. 1. Choose balls with sizes 972, 970, 971. | 500 | [
{
"input": "4\n18 55 16 17",
"output": "YES"
},
{
"input": "6\n40 41 43 44 44 44",
"output": "NO"
},
{
"input": "8\n5 972 3 4 1 4 970 971",
"output": "YES"
},
{
"input": "3\n959 747 656",
"output": "NO"
},
{
"input": "4\n1 2 2 3",
"output": "YES"
},
{
"input": "50\n998 30 384 289 505 340 872 223 663 31 929 625 864 699 735 589 676 399 745 635 963 381 75 97 324 612 597 797 103 382 25 894 219 458 337 572 201 355 294 275 278 311 586 573 965 704 936 237 715 543",
"output": "NO"
},
{
"input": "50\n941 877 987 982 966 979 984 810 811 909 872 980 957 897 845 995 924 905 984 914 824 840 868 910 815 808 872 858 883 952 823 835 860 874 959 972 931 867 866 987 982 837 800 921 887 910 982 980 828 869",
"output": "YES"
},
{
"input": "3\n408 410 409",
"output": "YES"
},
{
"input": "3\n903 902 904",
"output": "YES"
},
{
"input": "3\n399 400 398",
"output": "YES"
},
{
"input": "3\n450 448 449",
"output": "YES"
},
{
"input": "3\n390 389 388",
"output": "YES"
},
{
"input": "3\n438 439 440",
"output": "YES"
},
{
"input": "11\n488 688 490 94 564 615 641 170 489 517 669",
"output": "YES"
},
{
"input": "24\n102 672 983 82 720 501 81 721 982 312 207 897 159 964 611 956 118 984 37 271 596 403 772 954",
"output": "YES"
},
{
"input": "36\n175 551 70 479 875 480 979 32 465 402 640 116 76 687 874 678 359 785 753 401 978 629 162 963 886 641 39 845 132 930 2 372 478 947 407 318",
"output": "YES"
},
{
"input": "6\n10 79 306 334 304 305",
"output": "YES"
},
{
"input": "34\n787 62 26 683 486 364 684 891 846 801 969 837 359 800 836 359 471 637 732 91 841 836 7 799 959 405 416 841 737 803 615 483 323 365",
"output": "YES"
},
{
"input": "30\n860 238 14 543 669 100 428 789 576 484 754 274 849 850 586 377 711 386 510 408 520 693 23 477 266 851 728 711 964 73",
"output": "YES"
},
{
"input": "11\n325 325 324 324 324 325 325 324 324 324 324",
"output": "NO"
},
{
"input": "7\n517 517 518 517 518 518 518",
"output": "NO"
},
{
"input": "20\n710 710 711 711 711 711 710 710 710 710 711 710 710 710 710 710 710 711 711 710",
"output": "NO"
},
{
"input": "48\n29 30 29 29 29 30 29 30 30 30 30 29 30 30 30 29 29 30 30 29 30 29 29 30 29 30 29 30 30 29 30 29 29 30 30 29 29 30 30 29 29 30 30 30 29 29 30 29",
"output": "NO"
},
{
"input": "7\n880 880 514 536 881 881 879",
"output": "YES"
},
{
"input": "15\n377 432 262 376 261 375 377 262 263 263 261 376 262 262 375",
"output": "YES"
},
{
"input": "32\n305 426 404 961 426 425 614 304 404 425 615 403 303 304 615 303 305 405 427 614 403 303 425 615 404 304 427 403 206 616 405 404",
"output": "YES"
},
{
"input": "41\n115 686 988 744 762 519 745 519 518 83 85 115 520 44 687 686 685 596 988 687 989 988 114 745 84 519 519 746 988 84 745 744 115 114 85 115 520 746 745 116 987",
"output": "YES"
},
{
"input": "47\n1 2 483 28 7 109 270 651 464 162 353 521 224 989 721 499 56 69 197 716 313 446 580 645 828 197 100 138 789 499 147 677 384 711 783 937 300 543 540 93 669 604 739 122 632 822 116",
"output": "NO"
},
{
"input": "31\n1 2 1 373 355 692 750 920 578 666 615 232 141 129 663 929 414 704 422 559 568 731 354 811 532 618 39 879 292 602 995",
"output": "NO"
},
{
"input": "50\n5 38 41 4 15 40 27 39 20 3 44 47 30 6 36 29 35 12 19 26 10 2 21 50 11 46 48 49 17 16 33 13 32 28 31 18 23 34 7 14 24 45 9 37 1 8 42 25 43 22",
"output": "YES"
},
{
"input": "50\n967 999 972 990 969 978 963 987 954 955 973 970 959 981 995 983 986 994 979 957 965 982 992 977 953 975 956 961 993 997 998 958 980 962 960 951 996 991 1000 966 971 988 976 968 989 984 974 964 985 952",
"output": "YES"
},
{
"input": "50\n850 536 761 506 842 898 857 723 583 637 536 943 895 929 890 612 832 633 696 731 553 880 710 812 665 877 915 636 711 540 748 600 554 521 813 796 568 513 543 809 798 820 928 504 999 646 907 639 550 911",
"output": "NO"
},
{
"input": "3\n3 1 2",
"output": "YES"
},
{
"input": "3\n500 999 1000",
"output": "NO"
},
{
"input": "10\n101 102 104 105 107 109 110 112 113 115",
"output": "NO"
},
{
"input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "50\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "NO"
},
{
"input": "3\n1000 999 998",
"output": "YES"
},
{
"input": "49\n343 322 248 477 53 156 245 493 209 141 370 66 229 184 434 137 276 472 216 456 147 180 140 114 493 323 393 262 380 314 222 124 98 441 129 346 48 401 347 460 122 125 114 106 189 260 374 165 456",
"output": "NO"
},
{
"input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3",
"output": "YES"
},
{
"input": "3\n999 999 1000",
"output": "NO"
},
{
"input": "9\n2 4 5 13 25 100 200 300 400",
"output": "NO"
},
{
"input": "9\n1 1 1 2 2 2 3 3 3",
"output": "YES"
},
{
"input": "3\n1 1 2",
"output": "NO"
},
{
"input": "3\n998 999 1000",
"output": "YES"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 2 2 4",
"output": "NO"
},
{
"input": "4\n4 3 4 5",
"output": "YES"
},
{
"input": "6\n1 1 1 2 2 2",
"output": "NO"
},
{
"input": "3\n2 3 2",
"output": "NO"
},
{
"input": "5\n10 5 6 3 2",
"output": "NO"
},
{
"input": "3\n1 2 1",
"output": "NO"
},
{
"input": "3\n1 2 3",
"output": "YES"
},
{
"input": "4\n998 999 1000 1000",
"output": "YES"
},
{
"input": "5\n2 3 9 9 4",
"output": "YES"
},
{
"input": "4\n1 2 4 4",
"output": "NO"
},
{
"input": "3\n1 1 1",
"output": "NO"
},
{
"input": "3\n2 2 3",
"output": "NO"
},
{
"input": "7\n1 2 2 2 4 5 6",
"output": "YES"
},
{
"input": "5\n1 3 10 3 10",
"output": "NO"
},
{
"input": "3\n1 2 2",
"output": "NO"
},
{
"input": "4\n1000 1000 999 998",
"output": "YES"
},
{
"input": "3\n5 3 7",
"output": "NO"
},
{
"input": "6\n1 1 2 2 3 3",
"output": "YES"
},
{
"input": "9\n6 6 6 5 5 5 4 4 4",
"output": "YES"
},
{
"input": "7\n5 6 6 6 7 7 7",
"output": "YES"
},
{
"input": "5\n2 3 3 3 4",
"output": "YES"
},
{
"input": "5\n2 1 2 1 3",
"output": "YES"
},
{
"input": "3\n1 2 7",
"output": "NO"
},
{
"input": "3\n1000 1000 1000",
"output": "NO"
},
{
"input": "5\n1 100 2 100 3",
"output": "YES"
},
{
"input": "5\n5 4 6 5 5",
"output": "YES"
},
{
"input": "12\n1 1 1 1 2 2 2 2 3 3 3 3",
"output": "YES"
},
{
"input": "5\n9 9 1 2 3",
"output": "YES"
},
{
"input": "6\n1 2 3 1 2 3",
"output": "YES"
},
{
"input": "7\n1 1 1 1 2 3 3",
"output": "YES"
},
{
"input": "3\n13 13 13",
"output": "NO"
},
{
"input": "3\n42 42 42",
"output": "NO"
},
{
"input": "8\n1 1 1 1 2 2 2 2",
"output": "NO"
},
{
"input": "6\n1 1 1 1 2 3",
"output": "YES"
},
{
"input": "6\n1 1 2 2 6 6",
"output": "NO"
},
{
"input": "6\n1 2 5 5 5 5",
"output": "NO"
},
{
"input": "9\n1 2 3 1 2 3 1 2 3",
"output": "YES"
},
{
"input": "4\n1 2 1 100",
"output": "NO"
},
{
"input": "5\n1 1 2 2 3",
"output": "YES"
}
] | 1,595,919,390 | 2,147,483,647 | Python 3 | OK | TESTS | 84 | 109 | 6,963,200 | def optimal_size (t):
if len(t) <= 2:
return "NO"
for x in range(len(t)-2):
if abs(t[x+1] - t[x]) <= 2 and abs(t[x+2] - t[x]) <= 2 and abs(t[x+2] - t[x+1]) <= 2:
return "YES"
return "NO"
n = int(input())
t = list(map(int,input().split()))
t = list(set(t))
t = sorted(t)
print (optimal_size(t))
| Title: Bear and Three Balls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is a little polar bear. He has *n* balls, the *i*-th ball has size *t**i*.
Limak wants to give one ball to each of his three friends. Giving gifts isn't easy — there are two rules Limak must obey to make friends happy:
- No two friends can get balls of the same size. - No two friends can get balls of sizes that differ by more than 2.
For example, Limak can choose balls with sizes 4, 5 and 3, or balls with sizes 90, 91 and 92. But he can't choose balls with sizes 5, 5 and 6 (two friends would get balls of the same size), and he can't choose balls with sizes 30, 31 and 33 (because sizes 30 and 33 differ by more than 2).
Your task is to check whether Limak can choose three balls that satisfy conditions above.
Input Specification:
The first line of the input contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of balls Limak has.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000) where *t**i* denotes the size of the *i*-th ball.
Output Specification:
Print "YES" (without quotes) if Limak can choose three balls of distinct sizes, such that any two of them differ by no more than 2. Otherwise, print "NO" (without quotes).
Demo Input:
['4\n18 55 16 17\n', '6\n40 41 43 44 44 44\n', '8\n5 972 3 4 1 4 970 971\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first sample, there are 4 balls and Limak is able to choose three of them to satisfy the rules. He must must choose balls with sizes 18, 16 and 17.
In the second sample, there is no way to give gifts to three friends without breaking the rules.
In the third sample, there is even more than one way to choose balls:
1. Choose balls with sizes 3, 4 and 5. 1. Choose balls with sizes 972, 970, 971. | ```python
def optimal_size (t):
if len(t) <= 2:
return "NO"
for x in range(len(t)-2):
if abs(t[x+1] - t[x]) <= 2 and abs(t[x+2] - t[x]) <= 2 and abs(t[x+2] - t[x+1]) <= 2:
return "YES"
return "NO"
n = int(input())
t = list(map(int,input().split()))
t = list(set(t))
t = sorted(t)
print (optimal_size(t))
``` | 3 |
|
334 | A | Candy Bags | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies. | The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers. | Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits. | [
"2\n"
] | [
"1 4\n2 3\n"
] | The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother. | 500 | [
{
"input": "2",
"output": "1 4\n2 3"
},
{
"input": "4",
"output": "1 16 2 15\n3 14 4 13\n5 12 6 11\n7 10 8 9"
},
{
"input": "6",
"output": "1 36 2 35 3 34\n4 33 5 32 6 31\n7 30 8 29 9 28\n10 27 11 26 12 25\n13 24 14 23 15 22\n16 21 17 20 18 19"
},
{
"input": "8",
"output": "1 64 2 63 3 62 4 61\n5 60 6 59 7 58 8 57\n9 56 10 55 11 54 12 53\n13 52 14 51 15 50 16 49\n17 48 18 47 19 46 20 45\n21 44 22 43 23 42 24 41\n25 40 26 39 27 38 28 37\n29 36 30 35 31 34 32 33"
},
{
"input": "10",
"output": "1 100 2 99 3 98 4 97 5 96\n6 95 7 94 8 93 9 92 10 91\n11 90 12 89 13 88 14 87 15 86\n16 85 17 84 18 83 19 82 20 81\n21 80 22 79 23 78 24 77 25 76\n26 75 27 74 28 73 29 72 30 71\n31 70 32 69 33 68 34 67 35 66\n36 65 37 64 38 63 39 62 40 61\n41 60 42 59 43 58 44 57 45 56\n46 55 47 54 48 53 49 52 50 51"
},
{
"input": "100",
"output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951\n51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 993..."
},
{
"input": "62",
"output": "1 3844 2 3843 3 3842 4 3841 5 3840 6 3839 7 3838 8 3837 9 3836 10 3835 11 3834 12 3833 13 3832 14 3831 15 3830 16 3829 17 3828 18 3827 19 3826 20 3825 21 3824 22 3823 23 3822 24 3821 25 3820 26 3819 27 3818 28 3817 29 3816 30 3815 31 3814\n32 3813 33 3812 34 3811 35 3810 36 3809 37 3808 38 3807 39 3806 40 3805 41 3804 42 3803 43 3802 44 3801 45 3800 46 3799 47 3798 48 3797 49 3796 50 3795 51 3794 52 3793 53 3792 54 3791 55 3790 56 3789 57 3788 58 3787 59 3786 60 3785 61 3784 62 3783\n63 3782 64 3781 65 378..."
},
{
"input": "66",
"output": "1 4356 2 4355 3 4354 4 4353 5 4352 6 4351 7 4350 8 4349 9 4348 10 4347 11 4346 12 4345 13 4344 14 4343 15 4342 16 4341 17 4340 18 4339 19 4338 20 4337 21 4336 22 4335 23 4334 24 4333 25 4332 26 4331 27 4330 28 4329 29 4328 30 4327 31 4326 32 4325 33 4324\n34 4323 35 4322 36 4321 37 4320 38 4319 39 4318 40 4317 41 4316 42 4315 43 4314 44 4313 45 4312 46 4311 47 4310 48 4309 49 4308 50 4307 51 4306 52 4305 53 4304 54 4303 55 4302 56 4301 57 4300 58 4299 59 4298 60 4297 61 4296 62 4295 63 4294 64 4293 65 4292..."
},
{
"input": "18",
"output": "1 324 2 323 3 322 4 321 5 320 6 319 7 318 8 317 9 316\n10 315 11 314 12 313 13 312 14 311 15 310 16 309 17 308 18 307\n19 306 20 305 21 304 22 303 23 302 24 301 25 300 26 299 27 298\n28 297 29 296 30 295 31 294 32 293 33 292 34 291 35 290 36 289\n37 288 38 287 39 286 40 285 41 284 42 283 43 282 44 281 45 280\n46 279 47 278 48 277 49 276 50 275 51 274 52 273 53 272 54 271\n55 270 56 269 57 268 58 267 59 266 60 265 61 264 62 263 63 262\n64 261 65 260 66 259 67 258 68 257 69 256 70 255 71 254 72 253\n73 252 7..."
},
{
"input": "68",
"output": "1 4624 2 4623 3 4622 4 4621 5 4620 6 4619 7 4618 8 4617 9 4616 10 4615 11 4614 12 4613 13 4612 14 4611 15 4610 16 4609 17 4608 18 4607 19 4606 20 4605 21 4604 22 4603 23 4602 24 4601 25 4600 26 4599 27 4598 28 4597 29 4596 30 4595 31 4594 32 4593 33 4592 34 4591\n35 4590 36 4589 37 4588 38 4587 39 4586 40 4585 41 4584 42 4583 43 4582 44 4581 45 4580 46 4579 47 4578 48 4577 49 4576 50 4575 51 4574 52 4573 53 4572 54 4571 55 4570 56 4569 57 4568 58 4567 59 4566 60 4565 61 4564 62 4563 63 4562 64 4561 65 4560..."
},
{
"input": "86",
"output": "1 7396 2 7395 3 7394 4 7393 5 7392 6 7391 7 7390 8 7389 9 7388 10 7387 11 7386 12 7385 13 7384 14 7383 15 7382 16 7381 17 7380 18 7379 19 7378 20 7377 21 7376 22 7375 23 7374 24 7373 25 7372 26 7371 27 7370 28 7369 29 7368 30 7367 31 7366 32 7365 33 7364 34 7363 35 7362 36 7361 37 7360 38 7359 39 7358 40 7357 41 7356 42 7355 43 7354\n44 7353 45 7352 46 7351 47 7350 48 7349 49 7348 50 7347 51 7346 52 7345 53 7344 54 7343 55 7342 56 7341 57 7340 58 7339 59 7338 60 7337 61 7336 62 7335 63 7334 64 7333 65 7332..."
},
{
"input": "96",
"output": "1 9216 2 9215 3 9214 4 9213 5 9212 6 9211 7 9210 8 9209 9 9208 10 9207 11 9206 12 9205 13 9204 14 9203 15 9202 16 9201 17 9200 18 9199 19 9198 20 9197 21 9196 22 9195 23 9194 24 9193 25 9192 26 9191 27 9190 28 9189 29 9188 30 9187 31 9186 32 9185 33 9184 34 9183 35 9182 36 9181 37 9180 38 9179 39 9178 40 9177 41 9176 42 9175 43 9174 44 9173 45 9172 46 9171 47 9170 48 9169\n49 9168 50 9167 51 9166 52 9165 53 9164 54 9163 55 9162 56 9161 57 9160 58 9159 59 9158 60 9157 61 9156 62 9155 63 9154 64 9153 65 9152..."
},
{
"input": "12",
"output": "1 144 2 143 3 142 4 141 5 140 6 139\n7 138 8 137 9 136 10 135 11 134 12 133\n13 132 14 131 15 130 16 129 17 128 18 127\n19 126 20 125 21 124 22 123 23 122 24 121\n25 120 26 119 27 118 28 117 29 116 30 115\n31 114 32 113 33 112 34 111 35 110 36 109\n37 108 38 107 39 106 40 105 41 104 42 103\n43 102 44 101 45 100 46 99 47 98 48 97\n49 96 50 95 51 94 52 93 53 92 54 91\n55 90 56 89 57 88 58 87 59 86 60 85\n61 84 62 83 63 82 64 81 65 80 66 79\n67 78 68 77 69 76 70 75 71 74 72 73"
},
{
"input": "88",
"output": "1 7744 2 7743 3 7742 4 7741 5 7740 6 7739 7 7738 8 7737 9 7736 10 7735 11 7734 12 7733 13 7732 14 7731 15 7730 16 7729 17 7728 18 7727 19 7726 20 7725 21 7724 22 7723 23 7722 24 7721 25 7720 26 7719 27 7718 28 7717 29 7716 30 7715 31 7714 32 7713 33 7712 34 7711 35 7710 36 7709 37 7708 38 7707 39 7706 40 7705 41 7704 42 7703 43 7702 44 7701\n45 7700 46 7699 47 7698 48 7697 49 7696 50 7695 51 7694 52 7693 53 7692 54 7691 55 7690 56 7689 57 7688 58 7687 59 7686 60 7685 61 7684 62 7683 63 7682 64 7681 65 7680..."
},
{
"input": "28",
"output": "1 784 2 783 3 782 4 781 5 780 6 779 7 778 8 777 9 776 10 775 11 774 12 773 13 772 14 771\n15 770 16 769 17 768 18 767 19 766 20 765 21 764 22 763 23 762 24 761 25 760 26 759 27 758 28 757\n29 756 30 755 31 754 32 753 33 752 34 751 35 750 36 749 37 748 38 747 39 746 40 745 41 744 42 743\n43 742 44 741 45 740 46 739 47 738 48 737 49 736 50 735 51 734 52 733 53 732 54 731 55 730 56 729\n57 728 58 727 59 726 60 725 61 724 62 723 63 722 64 721 65 720 66 719 67 718 68 717 69 716 70 715\n71 714 72 713 73 712 74 7..."
},
{
"input": "80",
"output": "1 6400 2 6399 3 6398 4 6397 5 6396 6 6395 7 6394 8 6393 9 6392 10 6391 11 6390 12 6389 13 6388 14 6387 15 6386 16 6385 17 6384 18 6383 19 6382 20 6381 21 6380 22 6379 23 6378 24 6377 25 6376 26 6375 27 6374 28 6373 29 6372 30 6371 31 6370 32 6369 33 6368 34 6367 35 6366 36 6365 37 6364 38 6363 39 6362 40 6361\n41 6360 42 6359 43 6358 44 6357 45 6356 46 6355 47 6354 48 6353 49 6352 50 6351 51 6350 52 6349 53 6348 54 6347 55 6346 56 6345 57 6344 58 6343 59 6342 60 6341 61 6340 62 6339 63 6338 64 6337 65 6336..."
},
{
"input": "48",
"output": "1 2304 2 2303 3 2302 4 2301 5 2300 6 2299 7 2298 8 2297 9 2296 10 2295 11 2294 12 2293 13 2292 14 2291 15 2290 16 2289 17 2288 18 2287 19 2286 20 2285 21 2284 22 2283 23 2282 24 2281\n25 2280 26 2279 27 2278 28 2277 29 2276 30 2275 31 2274 32 2273 33 2272 34 2271 35 2270 36 2269 37 2268 38 2267 39 2266 40 2265 41 2264 42 2263 43 2262 44 2261 45 2260 46 2259 47 2258 48 2257\n49 2256 50 2255 51 2254 52 2253 53 2252 54 2251 55 2250 56 2249 57 2248 58 2247 59 2246 60 2245 61 2244 62 2243 63 2242 64 2241 65 224..."
},
{
"input": "54",
"output": "1 2916 2 2915 3 2914 4 2913 5 2912 6 2911 7 2910 8 2909 9 2908 10 2907 11 2906 12 2905 13 2904 14 2903 15 2902 16 2901 17 2900 18 2899 19 2898 20 2897 21 2896 22 2895 23 2894 24 2893 25 2892 26 2891 27 2890\n28 2889 29 2888 30 2887 31 2886 32 2885 33 2884 34 2883 35 2882 36 2881 37 2880 38 2879 39 2878 40 2877 41 2876 42 2875 43 2874 44 2873 45 2872 46 2871 47 2870 48 2869 49 2868 50 2867 51 2866 52 2865 53 2864 54 2863\n55 2862 56 2861 57 2860 58 2859 59 2858 60 2857 61 2856 62 2855 63 2854 64 2853 65 285..."
},
{
"input": "58",
"output": "1 3364 2 3363 3 3362 4 3361 5 3360 6 3359 7 3358 8 3357 9 3356 10 3355 11 3354 12 3353 13 3352 14 3351 15 3350 16 3349 17 3348 18 3347 19 3346 20 3345 21 3344 22 3343 23 3342 24 3341 25 3340 26 3339 27 3338 28 3337 29 3336\n30 3335 31 3334 32 3333 33 3332 34 3331 35 3330 36 3329 37 3328 38 3327 39 3326 40 3325 41 3324 42 3323 43 3322 44 3321 45 3320 46 3319 47 3318 48 3317 49 3316 50 3315 51 3314 52 3313 53 3312 54 3311 55 3310 56 3309 57 3308 58 3307\n59 3306 60 3305 61 3304 62 3303 63 3302 64 3301 65 330..."
},
{
"input": "64",
"output": "1 4096 2 4095 3 4094 4 4093 5 4092 6 4091 7 4090 8 4089 9 4088 10 4087 11 4086 12 4085 13 4084 14 4083 15 4082 16 4081 17 4080 18 4079 19 4078 20 4077 21 4076 22 4075 23 4074 24 4073 25 4072 26 4071 27 4070 28 4069 29 4068 30 4067 31 4066 32 4065\n33 4064 34 4063 35 4062 36 4061 37 4060 38 4059 39 4058 40 4057 41 4056 42 4055 43 4054 44 4053 45 4052 46 4051 47 4050 48 4049 49 4048 50 4047 51 4046 52 4045 53 4044 54 4043 55 4042 56 4041 57 4040 58 4039 59 4038 60 4037 61 4036 62 4035 63 4034 64 4033\n65 403..."
},
{
"input": "44",
"output": "1 1936 2 1935 3 1934 4 1933 5 1932 6 1931 7 1930 8 1929 9 1928 10 1927 11 1926 12 1925 13 1924 14 1923 15 1922 16 1921 17 1920 18 1919 19 1918 20 1917 21 1916 22 1915\n23 1914 24 1913 25 1912 26 1911 27 1910 28 1909 29 1908 30 1907 31 1906 32 1905 33 1904 34 1903 35 1902 36 1901 37 1900 38 1899 39 1898 40 1897 41 1896 42 1895 43 1894 44 1893\n45 1892 46 1891 47 1890 48 1889 49 1888 50 1887 51 1886 52 1885 53 1884 54 1883 55 1882 56 1881 57 1880 58 1879 59 1878 60 1877 61 1876 62 1875 63 1874 64 1873 65 187..."
}
] | 1,686,185,567 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 124 | 0 | def main():
n = int(input())
ans = {i:[] for i in range(n)}
for i in range(n):
ans[i] = [j+1 for j in range(2*i, 2*i+n//2, 1)] + [n**2-k for k in range(2*i, 2*i+n//2, 1)]
for i in range(n):
print(*ans[i])
if __name__ == "__main__":
main() | Title: Candy Bags
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
Input Specification:
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
Output Specification:
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits.
Demo Input:
['2\n']
Demo Output:
['1 4\n2 3\n']
Note:
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother. | ```python
def main():
n = int(input())
ans = {i:[] for i in range(n)}
for i in range(n):
ans[i] = [j+1 for j in range(2*i, 2*i+n//2, 1)] + [n**2-k for k in range(2*i, 2*i+n//2, 1)]
for i in range(n):
print(*ans[i])
if __name__ == "__main__":
main()
``` | 0 |
|
342 | A | Xenia and Divisors | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | null | null | Xenia the mathematician has a sequence consisting of *n* (*n* is divisible by 3) positive integers, each of them is at most 7. She wants to split the sequence into groups of three so that for each group of three *a*,<=*b*,<=*c* the following conditions held:
- *a*<=<<=*b*<=<<=*c*; - *a* divides *b*, *b* divides *c*.
Naturally, Xenia wants each element of the sequence to belong to exactly one group of three. Thus, if the required partition exists, then it has groups of three.
Help Xenia, find the required partition or else say that it doesn't exist. | The first line contains integer *n* (3<=≤<=*n*<=≤<=99999) — the number of elements in the sequence. The next line contains *n* positive integers, each of them is at most 7.
It is guaranteed that *n* is divisible by 3. | If the required partition exists, print groups of three. Print each group as values of the elements it contains. You should print values in increasing order. Separate the groups and integers in groups by whitespaces. If there are multiple solutions, you can print any of them.
If there is no solution, print -1. | [
"6\n1 1 1 2 2 2\n",
"6\n2 2 1 1 4 6\n"
] | [
"-1\n",
"1 2 4\n1 2 6\n"
] | none | 500 | [
{
"input": "6\n1 1 1 2 2 2",
"output": "-1"
},
{
"input": "6\n2 2 1 1 4 6",
"output": "1 2 4\n1 2 6"
},
{
"input": "3\n1 2 3",
"output": "-1"
},
{
"input": "3\n7 5 7",
"output": "-1"
},
{
"input": "3\n1 3 4",
"output": "-1"
},
{
"input": "3\n1 1 1",
"output": "-1"
},
{
"input": "9\n1 3 6 6 3 1 3 1 6",
"output": "1 3 6\n1 3 6\n1 3 6"
},
{
"input": "6\n1 2 4 1 3 5",
"output": "-1"
},
{
"input": "3\n1 3 7",
"output": "-1"
},
{
"input": "3\n1 1 1",
"output": "-1"
},
{
"input": "9\n1 2 4 1 2 4 1 3 6",
"output": "1 2 4\n1 2 4\n1 3 6"
},
{
"input": "12\n3 6 1 1 3 6 1 1 2 6 2 6",
"output": "1 3 6\n1 3 6\n1 2 6\n1 2 6"
},
{
"input": "9\n1 1 1 4 4 4 6 2 2",
"output": "-1"
},
{
"input": "9\n1 2 4 6 3 1 3 1 5",
"output": "-1"
},
{
"input": "15\n2 1 2 1 3 6 1 2 1 6 1 3 4 6 4",
"output": "1 2 4\n1 2 4\n1 3 6\n1 3 6\n1 2 6"
},
{
"input": "3\n2 3 6",
"output": "-1"
},
{
"input": "3\n2 4 6",
"output": "-1"
},
{
"input": "3\n2 5 6",
"output": "-1"
},
{
"input": "3\n2 4 7",
"output": "-1"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "-1"
},
{
"input": "3\n7 7 7",
"output": "-1"
},
{
"input": "6\n1 2 4 7 7 7",
"output": "-1"
},
{
"input": "6\n1 1 2 6 6 6",
"output": "-1"
},
{
"input": "9\n1 1 1 3 3 2 4 4 6",
"output": "-1"
},
{
"input": "6\n1 2 4 5 5 5",
"output": "-1"
},
{
"input": "15\n1 1 1 1 1 2 2 2 2 4 4 6 6 6 6",
"output": "-1"
},
{
"input": "6\n1 1 5 5 7 7",
"output": "-1"
},
{
"input": "9\n1 1 1 2 3 4 5 6 7",
"output": "-1"
},
{
"input": "6\n1 1 4 4 7 7",
"output": "-1"
},
{
"input": "24\n1 1 1 1 1 1 1 1 1 2 2 2 3 3 3 3 3 3 4 4 4 6 6 6",
"output": "-1"
},
{
"input": "3\n1 7 6",
"output": "-1"
},
{
"input": "6\n1 1 2 4 7 7",
"output": "-1"
},
{
"input": "9\n1 1 1 7 7 7 7 7 7",
"output": "-1"
},
{
"input": "9\n1 1 1 2 3 4 6 5 5",
"output": "-1"
}
] | 1,588,200,348 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 24 | 1,000 | 5,734,400 | n = int(input())
a = [int(i) for i in input().split()]
a.sort()
results = []
ans = ''
for i in range(n // 3):
group = []
num = a[0]
group.append(num)
for j in range(1, len(a)):
if (a[j] != num and a[j] % num == 0):
num = a[j]
group.append(num)
if (len(group) == 3):
break
if (len(group) != 3):
ans = -1
break
results.append(group)
for j in group:
a.remove(j)
if (ans == -1):
print (ans)
else:
for result in results:
print (' '.join([str(i) for i in result])) | Title: Xenia and Divisors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the mathematician has a sequence consisting of *n* (*n* is divisible by 3) positive integers, each of them is at most 7. She wants to split the sequence into groups of three so that for each group of three *a*,<=*b*,<=*c* the following conditions held:
- *a*<=<<=*b*<=<<=*c*; - *a* divides *b*, *b* divides *c*.
Naturally, Xenia wants each element of the sequence to belong to exactly one group of three. Thus, if the required partition exists, then it has groups of three.
Help Xenia, find the required partition or else say that it doesn't exist.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=99999) — the number of elements in the sequence. The next line contains *n* positive integers, each of them is at most 7.
It is guaranteed that *n* is divisible by 3.
Output Specification:
If the required partition exists, print groups of three. Print each group as values of the elements it contains. You should print values in increasing order. Separate the groups and integers in groups by whitespaces. If there are multiple solutions, you can print any of them.
If there is no solution, print -1.
Demo Input:
['6\n1 1 1 2 2 2\n', '6\n2 2 1 1 4 6\n']
Demo Output:
['-1\n', '1 2 4\n1 2 6\n']
Note:
none | ```python
n = int(input())
a = [int(i) for i in input().split()]
a.sort()
results = []
ans = ''
for i in range(n // 3):
group = []
num = a[0]
group.append(num)
for j in range(1, len(a)):
if (a[j] != num and a[j] % num == 0):
num = a[j]
group.append(num)
if (len(group) == 3):
break
if (len(group) != 3):
ans = -1
break
results.append(group)
for j in group:
a.remove(j)
if (ans == -1):
print (ans)
else:
for result in results:
print (' '.join([str(i) for i in result]))
``` | 0 |
|
675 | A | Infinite Sequence | PROGRAMMING | 1,100 | [
"math"
] | null | null | Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help. | The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively. | If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes). | [
"1 7 3\n",
"10 10 0\n",
"1 -4 5\n",
"0 60 50\n"
] | [
"YES\n",
"YES\n",
"NO\n",
"NO\n"
] | In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element.
In the second sample, the favorite integer of Vasya is equal to the first element of the sequence.
In the third sample all elements of the sequence are greater than Vasya's favorite integer.
In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer. | 500 | [
{
"input": "1 7 3",
"output": "YES"
},
{
"input": "10 10 0",
"output": "YES"
},
{
"input": "1 -4 5",
"output": "NO"
},
{
"input": "0 60 50",
"output": "NO"
},
{
"input": "1 -4 -5",
"output": "YES"
},
{
"input": "0 1 0",
"output": "NO"
},
{
"input": "10 10 42",
"output": "YES"
},
{
"input": "-1000000000 1000000000 -1",
"output": "NO"
},
{
"input": "10 16 4",
"output": "NO"
},
{
"input": "-1000000000 1000000000 5",
"output": "YES"
},
{
"input": "1000000000 -1000000000 5",
"output": "NO"
},
{
"input": "1000000000 -1000000000 0",
"output": "NO"
},
{
"input": "1000000000 1000000000 0",
"output": "YES"
},
{
"input": "115078364 -899474523 -1",
"output": "YES"
},
{
"input": "-245436499 416383245 992",
"output": "YES"
},
{
"input": "-719636354 536952440 2",
"output": "YES"
},
{
"input": "-198350539 963391024 68337739",
"output": "YES"
},
{
"input": "-652811055 875986516 1091",
"output": "YES"
},
{
"input": "119057893 -516914539 -39748277",
"output": "YES"
},
{
"input": "989140430 731276607 -36837689",
"output": "YES"
},
{
"input": "677168390 494583489 -985071853",
"output": "NO"
},
{
"input": "58090193 777423708 395693923",
"output": "NO"
},
{
"input": "479823846 -403424770 -653472589",
"output": "NO"
},
{
"input": "-52536829 -132023273 -736287999",
"output": "NO"
},
{
"input": "-198893776 740026818 -547885271",
"output": "NO"
},
{
"input": "-2 -2 -2",
"output": "YES"
},
{
"input": "-2 -2 -1",
"output": "YES"
},
{
"input": "-2 -2 0",
"output": "YES"
},
{
"input": "-2 -2 1",
"output": "YES"
},
{
"input": "-2 -2 2",
"output": "YES"
},
{
"input": "-2 -1 -2",
"output": "NO"
},
{
"input": "-2 -1 -1",
"output": "NO"
},
{
"input": "-2 -1 0",
"output": "NO"
},
{
"input": "-2 -1 1",
"output": "YES"
},
{
"input": "-2 -1 2",
"output": "NO"
},
{
"input": "-2 0 -2",
"output": "NO"
},
{
"input": "-2 0 -1",
"output": "NO"
},
{
"input": "-2 0 0",
"output": "NO"
},
{
"input": "-2 0 1",
"output": "YES"
},
{
"input": "-2 0 2",
"output": "YES"
},
{
"input": "-2 1 -2",
"output": "NO"
},
{
"input": "-2 1 -1",
"output": "NO"
},
{
"input": "-2 1 0",
"output": "NO"
},
{
"input": "-2 1 1",
"output": "YES"
},
{
"input": "-2 1 2",
"output": "NO"
},
{
"input": "-2 2 -2",
"output": "NO"
},
{
"input": "-2 2 -1",
"output": "NO"
},
{
"input": "-2 2 0",
"output": "NO"
},
{
"input": "-2 2 1",
"output": "YES"
},
{
"input": "-2 2 2",
"output": "YES"
},
{
"input": "-1 -2 -2",
"output": "NO"
},
{
"input": "-1 -2 -1",
"output": "YES"
},
{
"input": "-1 -2 0",
"output": "NO"
},
{
"input": "-1 -2 1",
"output": "NO"
},
{
"input": "-1 -2 2",
"output": "NO"
},
{
"input": "-1 -1 -2",
"output": "YES"
},
{
"input": "-1 -1 -1",
"output": "YES"
},
{
"input": "-1 -1 0",
"output": "YES"
},
{
"input": "-1 -1 1",
"output": "YES"
},
{
"input": "-1 -1 2",
"output": "YES"
},
{
"input": "-1 0 -2",
"output": "NO"
},
{
"input": "-1 0 -1",
"output": "NO"
},
{
"input": "-1 0 0",
"output": "NO"
},
{
"input": "-1 0 1",
"output": "YES"
},
{
"input": "-1 0 2",
"output": "NO"
},
{
"input": "-1 1 -2",
"output": "NO"
},
{
"input": "-1 1 -1",
"output": "NO"
},
{
"input": "-1 1 0",
"output": "NO"
},
{
"input": "-1 1 1",
"output": "YES"
},
{
"input": "-1 1 2",
"output": "YES"
},
{
"input": "-1 2 -2",
"output": "NO"
},
{
"input": "-1 2 -1",
"output": "NO"
},
{
"input": "-1 2 0",
"output": "NO"
},
{
"input": "-1 2 1",
"output": "YES"
},
{
"input": "-1 2 2",
"output": "NO"
},
{
"input": "0 -2 -2",
"output": "YES"
},
{
"input": "0 -2 -1",
"output": "YES"
},
{
"input": "0 -2 0",
"output": "NO"
},
{
"input": "0 -2 1",
"output": "NO"
},
{
"input": "0 -2 2",
"output": "NO"
},
{
"input": "0 -1 -2",
"output": "NO"
},
{
"input": "0 -1 -1",
"output": "YES"
},
{
"input": "0 -1 0",
"output": "NO"
},
{
"input": "0 -1 1",
"output": "NO"
},
{
"input": "0 -1 2",
"output": "NO"
},
{
"input": "0 0 -2",
"output": "YES"
},
{
"input": "0 0 -1",
"output": "YES"
},
{
"input": "0 0 0",
"output": "YES"
},
{
"input": "0 0 1",
"output": "YES"
},
{
"input": "0 0 2",
"output": "YES"
},
{
"input": "0 1 -2",
"output": "NO"
},
{
"input": "0 1 -1",
"output": "NO"
},
{
"input": "0 1 0",
"output": "NO"
},
{
"input": "0 1 1",
"output": "YES"
},
{
"input": "0 1 2",
"output": "NO"
},
{
"input": "0 2 -2",
"output": "NO"
},
{
"input": "0 2 -1",
"output": "NO"
},
{
"input": "0 2 0",
"output": "NO"
},
{
"input": "0 2 1",
"output": "YES"
},
{
"input": "0 2 2",
"output": "YES"
},
{
"input": "1 -2 -2",
"output": "NO"
},
{
"input": "1 -2 -1",
"output": "YES"
},
{
"input": "1 -2 0",
"output": "NO"
},
{
"input": "1 -2 1",
"output": "NO"
},
{
"input": "1 -2 2",
"output": "NO"
},
{
"input": "1 -1 -2",
"output": "YES"
},
{
"input": "1 -1 -1",
"output": "YES"
},
{
"input": "1 -1 0",
"output": "NO"
},
{
"input": "1 -1 1",
"output": "NO"
},
{
"input": "1 -1 2",
"output": "NO"
},
{
"input": "1 0 -2",
"output": "NO"
},
{
"input": "1 0 -1",
"output": "YES"
},
{
"input": "1 0 0",
"output": "NO"
},
{
"input": "1 0 1",
"output": "NO"
},
{
"input": "1 0 2",
"output": "NO"
},
{
"input": "1 1 -2",
"output": "YES"
},
{
"input": "1 1 -1",
"output": "YES"
},
{
"input": "1 1 0",
"output": "YES"
},
{
"input": "1 1 1",
"output": "YES"
},
{
"input": "1 1 2",
"output": "YES"
},
{
"input": "1 2 -2",
"output": "NO"
},
{
"input": "1 2 -1",
"output": "NO"
},
{
"input": "1 2 0",
"output": "NO"
},
{
"input": "1 2 1",
"output": "YES"
},
{
"input": "1 2 2",
"output": "NO"
},
{
"input": "2 -2 -2",
"output": "YES"
},
{
"input": "2 -2 -1",
"output": "YES"
},
{
"input": "2 -2 0",
"output": "NO"
},
{
"input": "2 -2 1",
"output": "NO"
},
{
"input": "2 -2 2",
"output": "NO"
},
{
"input": "2 -1 -2",
"output": "NO"
},
{
"input": "2 -1 -1",
"output": "YES"
},
{
"input": "2 -1 0",
"output": "NO"
},
{
"input": "2 -1 1",
"output": "NO"
},
{
"input": "2 -1 2",
"output": "NO"
},
{
"input": "2 0 -2",
"output": "YES"
},
{
"input": "2 0 -1",
"output": "YES"
},
{
"input": "2 0 0",
"output": "NO"
},
{
"input": "2 0 1",
"output": "NO"
},
{
"input": "2 0 2",
"output": "NO"
},
{
"input": "2 1 -2",
"output": "NO"
},
{
"input": "2 1 -1",
"output": "YES"
},
{
"input": "2 1 0",
"output": "NO"
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "2 1 2",
"output": "NO"
},
{
"input": "2 2 -2",
"output": "YES"
},
{
"input": "2 2 -1",
"output": "YES"
},
{
"input": "2 2 0",
"output": "YES"
},
{
"input": "2 2 1",
"output": "YES"
},
{
"input": "2 2 2",
"output": "YES"
},
{
"input": "-1000000000 1000000000 1",
"output": "YES"
},
{
"input": "-1000000000 1000000000 2",
"output": "YES"
},
{
"input": "1000000000 -1000000000 -1",
"output": "YES"
},
{
"input": "5 2 3",
"output": "NO"
},
{
"input": "2 1 -1",
"output": "YES"
},
{
"input": "3 2 1",
"output": "NO"
},
{
"input": "0 -5 -3",
"output": "NO"
},
{
"input": "2 5 5",
"output": "NO"
},
{
"input": "0 10 1",
"output": "YES"
},
{
"input": "15 5 -5",
"output": "YES"
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "20 10 0",
"output": "NO"
},
{
"input": "20 15 5",
"output": "NO"
},
{
"input": "1 6 1",
"output": "YES"
},
{
"input": "1000000000 0 -1000000000",
"output": "YES"
},
{
"input": "1 1 -5",
"output": "YES"
},
{
"input": "4 6 1",
"output": "YES"
},
{
"input": "-5 -10 -5",
"output": "YES"
},
{
"input": "2 0 0",
"output": "NO"
},
{
"input": "10 9 -1",
"output": "YES"
},
{
"input": "-2 -1 -1",
"output": "NO"
},
{
"input": "1 13 3",
"output": "YES"
},
{
"input": "2 3 0",
"output": "NO"
},
{
"input": "1 1 -1",
"output": "YES"
},
{
"input": "5 -10 -5",
"output": "YES"
},
{
"input": "5 3 1",
"output": "NO"
},
{
"input": "1 1000000000 1",
"output": "YES"
},
{
"input": "-1000000000 1000000000 1000000000",
"output": "YES"
}
] | 1,564,592,108 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 93 | 0 | a=int(input())
b=int(input())
c=int(input())
if(b in range(a+c) or b in range(a+2*c+1)):
print("YES\n")
else:
print("NO\n") | Title: Infinite Sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help.
Input Specification:
The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively.
Output Specification:
If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes).
Demo Input:
['1 7 3\n', '10 10 0\n', '1 -4 5\n', '0 60 50\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n', 'NO\n']
Note:
In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element.
In the second sample, the favorite integer of Vasya is equal to the first element of the sequence.
In the third sample all elements of the sequence are greater than Vasya's favorite integer.
In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer. | ```python
a=int(input())
b=int(input())
c=int(input())
if(b in range(a+c) or b in range(a+2*c+1)):
print("YES\n")
else:
print("NO\n")
``` | -1 |
|
812 | A | Sagheer and Crossroads | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | Sagheer is walking in the street when he comes to an intersection of two roads. Each road can be represented as two parts where each part has 3 lanes getting into the intersection (one for each direction) and 3 lanes getting out of the intersection, so we have 4 parts in total. Each part has 4 lights, one for each lane getting into the intersection (*l* — left, *s* — straight, *r* — right) and a light *p* for a pedestrian crossing.
An accident is possible if a car can hit a pedestrian. This can happen if the light of a pedestrian crossing of some part and the light of a lane that can get to or from that same part are green at the same time.
Now, Sagheer is monitoring the configuration of the traffic lights. Your task is to help him detect whether an accident is possible. | The input consists of four lines with each line describing a road part given in a counter-clockwise order.
Each line contains four integers *l*, *s*, *r*, *p* — for the left, straight, right and pedestrian lights, respectively. The possible values are 0 for red light and 1 for green light. | On a single line, print "YES" if an accident is possible, and "NO" otherwise. | [
"1 0 0 1\n0 1 0 0\n0 0 1 0\n0 0 0 1\n",
"0 1 1 0\n1 0 1 0\n1 1 0 0\n0 0 0 1\n",
"1 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 1 0\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | In the first example, some accidents are possible because cars of part 1 can hit pedestrians of parts 1 and 4. Also, cars of parts 2 and 3 can hit pedestrians of part 4.
In the second example, no car can pass the pedestrian crossing of part 4 which is the only green pedestrian light. So, no accident can occur. | 500 | [
{
"input": "1 0 0 1\n0 1 0 0\n0 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 1 1 0\n1 0 1 0\n1 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "1 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 1 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "1 1 1 0\n0 1 0 1\n1 1 1 0\n1 1 1 1",
"output": "YES"
},
{
"input": "0 1 1 0\n0 1 0 0\n1 0 0 1\n1 0 0 0",
"output": "YES"
},
{
"input": "1 0 0 0\n0 1 0 0\n1 1 0 0\n0 1 1 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 1\n1 0 1 1\n1 1 1 0",
"output": "YES"
},
{
"input": "1 1 0 0\n0 1 0 1\n1 1 1 0\n0 0 1 1",
"output": "YES"
},
{
"input": "0 1 0 0\n0 0 0 0\n1 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 1 0\n0 0 0 0\n1 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 1 0\n0 1 0 1\n1 0 1 0\n0 0 1 0",
"output": "YES"
},
{
"input": "1 1 1 0\n0 1 0 1\n1 1 1 1\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 1 0\n0 0 0 0\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 1\n1 0 1 1\n0 0 0 1",
"output": "YES"
},
{
"input": "1 1 0 0\n0 1 0 0\n1 1 1 0\n1 0 1 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "1 0 1 0\n1 1 0 0\n1 1 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 1 0\n1 1 0 0\n1 0 1 0\n1 0 0 0",
"output": "NO"
},
{
"input": "0 0 1 0\n1 0 0 0\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "0 1 1 0\n1 1 0 1\n1 0 0 1\n1 1 1 0",
"output": "YES"
},
{
"input": "1 0 0 0\n1 1 0 0\n1 1 0 1\n0 0 1 0",
"output": "YES"
},
{
"input": "0 0 0 0\n1 1 0 0\n0 0 0 1\n0 0 1 0",
"output": "NO"
},
{
"input": "0 1 0 0\n0 0 0 1\n0 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 1 0 0\n1 1 0 1\n1 0 0 1\n1 1 0 1",
"output": "YES"
},
{
"input": "1 0 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 1 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n1 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 1 0 0\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 1 0\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n1 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 1 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 1 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 0 0\n1 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 0 0\n0 1 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 0 0\n0 0 1 0",
"output": "YES"
},
{
"input": "1 0 0 0\n0 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 1 0 0\n0 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 1 0\n0 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n1 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 1 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 1 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 1\n1 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 1 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 1 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 0\n0 1 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 0\n0 0 1 0",
"output": "NO"
},
{
"input": "1 0 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 1 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 1 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n1 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 1 0\n0 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n1 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 1 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 1 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n1 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n0 1 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n0 0 1 0",
"output": "NO"
},
{
"input": "1 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 1 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 1 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n1 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 0\n0 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 1 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n1 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n1 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n0 1 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "1 1 1 1\n1 1 1 1\n1 1 1 1\n1 1 1 1",
"output": "YES"
},
{
"input": "1 0 0 0\n0 1 0 0\n0 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "1 1 1 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "1 0 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 1 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n1 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 1 0\n1 0 1 0\n1 1 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "1 1 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "1 1 1 0\n1 1 1 0\n1 1 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "1 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 1 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 1 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 1 1 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 1 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 1\n0 0 0 0\n0 1 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 1\n1 0 0 0\n0 0 0 0",
"output": "YES"
}
] | 1,496,326,779 | 279 | Python 3 | CHALLENGED | CHALLENGES | 7 | 61 | 0 | for i in range(4):
l, s, r, p = map(int, input().split())
if p and any([l, s, r]):
print('YES')
exit()
print('NO')
| Title: Sagheer and Crossroads
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sagheer is walking in the street when he comes to an intersection of two roads. Each road can be represented as two parts where each part has 3 lanes getting into the intersection (one for each direction) and 3 lanes getting out of the intersection, so we have 4 parts in total. Each part has 4 lights, one for each lane getting into the intersection (*l* — left, *s* — straight, *r* — right) and a light *p* for a pedestrian crossing.
An accident is possible if a car can hit a pedestrian. This can happen if the light of a pedestrian crossing of some part and the light of a lane that can get to or from that same part are green at the same time.
Now, Sagheer is monitoring the configuration of the traffic lights. Your task is to help him detect whether an accident is possible.
Input Specification:
The input consists of four lines with each line describing a road part given in a counter-clockwise order.
Each line contains four integers *l*, *s*, *r*, *p* — for the left, straight, right and pedestrian lights, respectively. The possible values are 0 for red light and 1 for green light.
Output Specification:
On a single line, print "YES" if an accident is possible, and "NO" otherwise.
Demo Input:
['1 0 0 1\n0 1 0 0\n0 0 1 0\n0 0 0 1\n', '0 1 1 0\n1 0 1 0\n1 1 0 0\n0 0 0 1\n', '1 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 1 0\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
In the first example, some accidents are possible because cars of part 1 can hit pedestrians of parts 1 and 4. Also, cars of parts 2 and 3 can hit pedestrians of part 4.
In the second example, no car can pass the pedestrian crossing of part 4 which is the only green pedestrian light. So, no accident can occur. | ```python
for i in range(4):
l, s, r, p = map(int, input().split())
if p and any([l, s, r]):
print('YES')
exit()
print('NO')
``` | -1 |
|
785 | A | Anton and Polyhedrons | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. | Output one number — the total number of faces in all the polyhedrons in Anton's collection. | [
"4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n",
"3\nDodecahedron\nOctahedron\nOctahedron\n"
] | [
"42\n",
"28\n"
] | In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces. | 500 | [
{
"input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron",
"output": "42"
},
{
"input": "3\nDodecahedron\nOctahedron\nOctahedron",
"output": "28"
},
{
"input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron",
"output": "256"
},
{
"input": "1\nTetrahedron",
"output": "4"
},
{
"input": "1\nCube",
"output": "6"
},
{
"input": "1\nOctahedron",
"output": "8"
},
{
"input": "1\nDodecahedron",
"output": "12"
},
{
"input": "1\nIcosahedron",
"output": "20"
},
{
"input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron",
"output": "340"
}
] | 1,689,403,515 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 202 | 0 | n = int(input())
p = {
"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20
}
t = 0
for i in range(n):
a = input()
t += p[a]
print(t) | Title: Anton and Polyhedrons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output Specification:
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
Demo Input:
['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n']
Demo Output:
['42\n', '28\n']
Note:
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces. | ```python
n = int(input())
p = {
"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20
}
t = 0
for i in range(n):
a = input()
t += p[a]
print(t)
``` | 3 |
|
867 | A | Between the Offices | PROGRAMMING | 800 | [
"implementation"
] | null | null | As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. | The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. | Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower). | [
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] | [
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] | In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | 500 | [
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,679,732,548 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 46 | 0 | k = int(input())
a = input()
sf = a.count('SF')
fs = a.count('FS')
if sf>fs:
print('YES')
else:
print('NO')
| Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | ```python
k = int(input())
a = input()
sf = a.count('SF')
fs = a.count('FS')
if sf>fs:
print('YES')
else:
print('NO')
``` | 3 |
|
439 | A | Devu, the Singer and Churu, the Joker | PROGRAMMING | 900 | [
"greedy",
"implementation"
] | null | null | Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event. | The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100). | If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event. | [
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] | [
"5\n",
"-1\n"
] | Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1. | 500 | [
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,539,037,403 | 2,147,483,647 | Python 3 | OK | TESTS | 26 | 109 | 0 | n,d=map(int, input().split())
a=list(map(int, input().split()))
songst=sum(a)
mint=songst+(n-1)*10
if d>=mint:
print((d-songst)//5)
else:
print(-1) | Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1. | ```python
n,d=map(int, input().split())
a=list(map(int, input().split()))
songst=sum(a)
mint=songst+(n-1)*10
if d>=mint:
print((d-songst)//5)
else:
print(-1)
``` | 3 |
|
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,691,533,968 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | age = int(input('w = '))
if age % 2 == 0 :
print ('YES')
elif age <= 2:
print ('NO')
else:
print('NO') | Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
age = int(input('w = '))
if age % 2 == 0 :
print ('YES')
elif age <= 2:
print ('NO')
else:
print('NO')
``` | 0 |
373 | A | Collecting Beats is Fun | PROGRAMMING | 900 | [
"implementation"
] | null | null | Cucumber boy is fan of Kyubeat, a famous music game.
Kyubeat has 16 panels for playing arranged in 4<=×<=4 table. When a panel lights up, he has to press that panel.
Each panel has a timing to press (the preffered time when a player should press it), and Cucumber boy is able to press at most *k* panels in a time with his one hand. Cucumber boy is trying to press all panels in perfect timing, that is he wants to press each panel exactly in its preffered time. If he cannot press the panels with his two hands in perfect timing, his challenge to press all the panels in perfect timing will fail.
You are given one scene of Kyubeat's panel from the music Cucumber boy is trying. Tell him is he able to press all the panels in perfect timing. | The first line contains a single integer *k* (1<=≤<=*k*<=≤<=5) — the number of panels Cucumber boy can press with his one hand.
Next 4 lines contain 4 characters each (digits from 1 to 9, or period) — table of panels. If a digit *i* was written on the panel, it means the boy has to press that panel in time *i*. If period was written on the panel, he doesn't have to press that panel. | Output "YES" (without quotes), if he is able to press all the panels in perfect timing. If not, output "NO" (without quotes). | [
"1\n.135\n1247\n3468\n5789\n",
"5\n..1.\n1111\n..1.\n..1.\n",
"1\n....\n12.1\n.2..\n.2..\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | In the third sample boy cannot press all panels in perfect timing. He can press all the panels in timing in time 1, but he cannot press the panels in time 2 in timing with his two hands. | 500 | [
{
"input": "1\n.135\n1247\n3468\n5789",
"output": "YES"
},
{
"input": "5\n..1.\n1111\n..1.\n..1.",
"output": "YES"
},
{
"input": "1\n....\n12.1\n.2..\n.2..",
"output": "NO"
},
{
"input": "1\n6981\n.527\n4163\n2345",
"output": "YES"
},
{
"input": "5\n9999\n9999\n9999\n9999",
"output": "NO"
},
{
"input": "2\n4444\n3333\n2222\n1111",
"output": "YES"
},
{
"input": "3\n2123\n1232\n2321\n3213",
"output": "NO"
},
{
"input": "2\n1...\n.1..\n..1.\n...1",
"output": "YES"
},
{
"input": "2\n1.1.\n.1.1\n2.2.\n.222",
"output": "NO"
},
{
"input": "1\n1..2\n.3.4\n567.\n.89.",
"output": "YES"
},
{
"input": "1\n1122\n3344\n5588\n6699",
"output": "YES"
},
{
"input": "4\n1111\n1221\n1221\n1111",
"output": "NO"
},
{
"input": "5\n3141\n5926\n5358\n9793",
"output": "YES"
},
{
"input": "5\n5454\n4343\n3232\n2121",
"output": "YES"
},
{
"input": "5\n1222\n2221\n2221\n1122",
"output": "NO"
},
{
"input": "1\n....\n5..5\n6..6\n7..7",
"output": "YES"
},
{
"input": "1\n9875\n8643\n7421\n531.",
"output": "YES"
},
{
"input": "1\n..1.\n..1.\n..1.\n..1.",
"output": "NO"
},
{
"input": "4\n4.4.\n4.4.\n4444\n..4.",
"output": "NO"
},
{
"input": "5\n4.4.\n4.4.\n4444\n..4.",
"output": "YES"
},
{
"input": "3\n1.1.\n.1.1\n1.1.\n.1.1",
"output": "NO"
},
{
"input": "2\n1131\n4412\n2569\n3478",
"output": "YES"
},
{
"input": "2\n8888\n8888\n8888\n8888",
"output": "NO"
}
] | 1,579,779,970 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 92 | 0 | k = int(input())
k = 2 * k
jk = [0] * 10
for i in range(4):
line = list(input())
for j in line:
if j != ".":
j = int(j)
jk[j] = jk[j] + 1
flag = 0
for i in range(11):
if jk[i] > k:
flag = 1
break
if flag == 1:
print("NO")
else:
print("YES") | Title: Collecting Beats is Fun
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Cucumber boy is fan of Kyubeat, a famous music game.
Kyubeat has 16 panels for playing arranged in 4<=×<=4 table. When a panel lights up, he has to press that panel.
Each panel has a timing to press (the preffered time when a player should press it), and Cucumber boy is able to press at most *k* panels in a time with his one hand. Cucumber boy is trying to press all panels in perfect timing, that is he wants to press each panel exactly in its preffered time. If he cannot press the panels with his two hands in perfect timing, his challenge to press all the panels in perfect timing will fail.
You are given one scene of Kyubeat's panel from the music Cucumber boy is trying. Tell him is he able to press all the panels in perfect timing.
Input Specification:
The first line contains a single integer *k* (1<=≤<=*k*<=≤<=5) — the number of panels Cucumber boy can press with his one hand.
Next 4 lines contain 4 characters each (digits from 1 to 9, or period) — table of panels. If a digit *i* was written on the panel, it means the boy has to press that panel in time *i*. If period was written on the panel, he doesn't have to press that panel.
Output Specification:
Output "YES" (without quotes), if he is able to press all the panels in perfect timing. If not, output "NO" (without quotes).
Demo Input:
['1\n.135\n1247\n3468\n5789\n', '5\n..1.\n1111\n..1.\n..1.\n', '1\n....\n12.1\n.2..\n.2..\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the third sample boy cannot press all panels in perfect timing. He can press all the panels in timing in time 1, but he cannot press the panels in time 2 in timing with his two hands. | ```python
k = int(input())
k = 2 * k
jk = [0] * 10
for i in range(4):
line = list(input())
for j in line:
if j != ".":
j = int(j)
jk[j] = jk[j] + 1
flag = 0
for i in range(11):
if jk[i] > k:
flag = 1
break
if flag == 1:
print("NO")
else:
print("YES")
``` | -1 |
|
595 | A | Vitaly and Night | PROGRAMMING | 800 | [
"constructive algorithms",
"implementation"
] | null | null | One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping. | The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'. | Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping. | [
"2 2\n0 0 0 1\n1 0 1 1\n",
"1 3\n1 1 0 1 0 0\n"
] | [
"3\n",
"2\n"
] | In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off. | 500 | [
{
"input": "2 2\n0 0 0 1\n1 0 1 1",
"output": "3"
},
{
"input": "1 3\n1 1 0 1 0 0",
"output": "2"
},
{
"input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1",
"output": "8"
},
{
"input": "1 5\n1 0 1 1 1 0 1 1 1 1",
"output": "5"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "6"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "100"
},
{
"input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0",
"output": "8"
},
{
"input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "1 1\n0 0",
"output": "0"
},
{
"input": "1 1\n0 1",
"output": "1"
},
{
"input": "1 1\n1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
}
] | 1,591,389,404 | 2,147,483,647 | Python 3 | OK | TESTS | 36 | 124 | 0 | n, m = input().split()
n, m = int(n), int(m)
result = 0
for each_n in range(n):
windows = [int(i) for i in input().split()]
i = 0
while i < 2*m:
if (windows[i] | windows[i + 1]) == 1:
result += 1
i = i + 2
print(result) | Title: Vitaly and Night
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Output Specification:
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
Demo Input:
['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n']
Demo Output:
['3\n', '2\n']
Note:
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off. | ```python
n, m = input().split()
n, m = int(n), int(m)
result = 0
for each_n in range(n):
windows = [int(i) for i in input().split()]
i = 0
while i < 2*m:
if (windows[i] | windows[i + 1]) == 1:
result += 1
i = i + 2
print(result)
``` | 3 |
|
606 | A | Magic Spheres | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)? | The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get. | If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No". | [
"4 4 0\n2 1 2\n",
"5 6 1\n2 7 2\n",
"3 3 3\n2 2 2\n"
] | [
"Yes\n",
"No\n",
"Yes\n"
] | In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs. | 500 | [
{
"input": "4 4 0\n2 1 2",
"output": "Yes"
},
{
"input": "5 6 1\n2 7 2",
"output": "No"
},
{
"input": "3 3 3\n2 2 2",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 0",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 1",
"output": "No"
},
{
"input": "0 1 0\n0 0 0",
"output": "Yes"
},
{
"input": "1 0 0\n1 0 0",
"output": "Yes"
},
{
"input": "2 2 1\n1 1 2",
"output": "No"
},
{
"input": "1 3 1\n2 1 1",
"output": "Yes"
},
{
"input": "1000000 1000000 1000000\n1000000 1000000 1000000",
"output": "Yes"
},
{
"input": "1000000 500000 500000\n0 750000 750000",
"output": "Yes"
},
{
"input": "500000 1000000 500000\n750001 0 750000",
"output": "No"
},
{
"input": "499999 500000 1000000\n750000 750000 0",
"output": "No"
},
{
"input": "500000 500000 0\n0 0 500000",
"output": "Yes"
},
{
"input": "0 500001 499999\n500000 0 0",
"output": "No"
},
{
"input": "1000000 500000 1000000\n500000 1000000 500000",
"output": "Yes"
},
{
"input": "1000000 1000000 499999\n500000 500000 1000000",
"output": "No"
},
{
"input": "500000 1000000 1000000\n1000000 500001 500000",
"output": "No"
},
{
"input": "1000000 500000 500000\n0 1000000 500000",
"output": "Yes"
},
{
"input": "500000 500000 1000000\n500001 1000000 0",
"output": "No"
},
{
"input": "500000 999999 500000\n1000000 0 500000",
"output": "No"
},
{
"input": "4 0 3\n2 2 1",
"output": "Yes"
},
{
"input": "0 2 4\n2 0 2",
"output": "Yes"
},
{
"input": "3 1 0\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 1\n1 3 2",
"output": "Yes"
},
{
"input": "1 2 4\n2 1 3",
"output": "No"
},
{
"input": "1 1 0\n0 0 1",
"output": "No"
},
{
"input": "4 0 0\n0 1 1",
"output": "Yes"
},
{
"input": "0 3 0\n1 0 1",
"output": "No"
},
{
"input": "0 0 3\n1 0 1",
"output": "Yes"
},
{
"input": "1 12 1\n4 0 4",
"output": "Yes"
},
{
"input": "4 0 4\n1 2 1",
"output": "Yes"
},
{
"input": "4 4 0\n1 1 3",
"output": "No"
},
{
"input": "0 9 0\n2 2 2",
"output": "No"
},
{
"input": "0 10 0\n2 2 2",
"output": "Yes"
},
{
"input": "9 0 9\n0 8 0",
"output": "Yes"
},
{
"input": "0 9 9\n9 0 0",
"output": "No"
},
{
"input": "9 10 0\n0 0 9",
"output": "Yes"
},
{
"input": "10 0 9\n0 10 0",
"output": "No"
},
{
"input": "0 10 10\n10 0 0",
"output": "Yes"
},
{
"input": "10 10 0\n0 0 11",
"output": "No"
},
{
"input": "307075 152060 414033\n381653 222949 123101",
"output": "No"
},
{
"input": "569950 228830 153718\n162186 357079 229352",
"output": "No"
},
{
"input": "149416 303568 749016\n238307 493997 190377",
"output": "No"
},
{
"input": "438332 298094 225324\n194220 400244 245231",
"output": "No"
},
{
"input": "293792 300060 511272\n400687 382150 133304",
"output": "No"
},
{
"input": "295449 518151 368838\n382897 137148 471892",
"output": "No"
},
{
"input": "191789 291147 691092\n324321 416045 176232",
"output": "Yes"
},
{
"input": "286845 704749 266526\n392296 104421 461239",
"output": "Yes"
},
{
"input": "135522 188282 377041\n245719 212473 108265",
"output": "Yes"
},
{
"input": "404239 359124 133292\n180069 184791 332544",
"output": "No"
},
{
"input": "191906 624432 244408\n340002 367217 205432",
"output": "No"
},
{
"input": "275980 429361 101824\n274288 302579 166062",
"output": "No"
},
{
"input": "136092 364927 395302\n149173 343146 390922",
"output": "No"
},
{
"input": "613852 334661 146012\n363786 326286 275233",
"output": "No"
},
{
"input": "348369 104625 525203\n285621 215396 366411",
"output": "No"
},
{
"input": "225307 153572 114545\n154753 153282 149967",
"output": "Yes"
},
{
"input": "438576 124465 629784\n375118 276028 390116",
"output": "Yes"
},
{
"input": "447521 327510 158732\n395759 178458 259139",
"output": "Yes"
},
{
"input": "8 5 5\n5 5 5",
"output": "Yes"
},
{
"input": "100 100 100\n1 1 1",
"output": "Yes"
},
{
"input": "100 100 100\n0 0 0",
"output": "Yes"
},
{
"input": "3 2 3\n2 3 2",
"output": "No"
},
{
"input": "5 4 3\n2 2 2",
"output": "Yes"
},
{
"input": "14 9 8\n12 5 10",
"output": "Yes"
},
{
"input": "10 10 10\n1 1 1",
"output": "Yes"
},
{
"input": "6 3 3\n3 3 3",
"output": "Yes"
},
{
"input": "10 0 4\n2 4 2",
"output": "Yes"
},
{
"input": "100 100 100\n2 2 2",
"output": "Yes"
},
{
"input": "4 6 0\n2 1 2",
"output": "Yes"
},
{
"input": "4 6 3\n4 2 3",
"output": "Yes"
},
{
"input": "5 5 5\n1 1 1",
"output": "Yes"
},
{
"input": "41 17 34\n0 19 24",
"output": "Yes"
},
{
"input": "8 8 8\n3 3 3",
"output": "Yes"
},
{
"input": "7 7 1\n1 1 2",
"output": "Yes"
},
{
"input": "6 6 0\n2 2 2",
"output": "Yes"
},
{
"input": "5 5 5\n2 2 2",
"output": "Yes"
},
{
"input": "400 400 400\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 4\n2 2 2",
"output": "Yes"
}
] | 1,624,367,619 | 2,147,483,647 | PyPy 3 | OK | TESTS | 79 | 109 | 0 | a=list(map(int,input().split()))
b=list(map(int,input().split()))
p=0
k=0
for i,j in zip(a,b):
if i>j:
p+=(i-j)//2
if i<j:
k+=j-i
if p>=k:
print('YES')
else:
print('NO') | Title: Magic Spheres
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)?
Input Specification:
The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get.
Output Specification:
If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No".
Demo Input:
['4 4 0\n2 1 2\n', '5 6 1\n2 7 2\n', '3 3 3\n2 2 2\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n']
Note:
In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs. | ```python
a=list(map(int,input().split()))
b=list(map(int,input().split()))
p=0
k=0
for i,j in zip(a,b):
if i>j:
p+=(i-j)//2
if i<j:
k+=j-i
if p>=k:
print('YES')
else:
print('NO')
``` | 3 |
|
217 | A | Ice Skating | PROGRAMMING | 1,200 | [
"brute force",
"dfs and similar",
"dsu",
"graphs"
] | null | null | Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates. | The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct. | Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one. | [
"2\n2 1\n1 2\n",
"2\n2 1\n4 1\n"
] | [
"1\n",
"0\n"
] | none | 500 | [
{
"input": "2\n2 1\n1 2",
"output": "1"
},
{
"input": "2\n2 1\n4 1",
"output": "0"
},
{
"input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459",
"output": "21"
},
{
"input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815",
"output": "16"
},
{
"input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663",
"output": "10"
},
{
"input": "1\n321 88",
"output": "0"
},
{
"input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689",
"output": "7"
},
{
"input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510",
"output": "6"
},
{
"input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888",
"output": "5"
},
{
"input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802",
"output": "13"
},
{
"input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662",
"output": "11"
},
{
"input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786",
"output": "38"
},
{
"input": "3\n175 201\n907 909\n388 360",
"output": "2"
},
{
"input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86",
"output": "6"
},
{
"input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820",
"output": "16"
},
{
"input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901",
"output": "31"
},
{
"input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210",
"output": "29"
},
{
"input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894",
"output": "29"
},
{
"input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823",
"output": "13"
},
{
"input": "5\n175 158\n16 2\n397 381\n668 686\n957 945",
"output": "4"
},
{
"input": "5\n312 284\n490 509\n730 747\n504 497\n782 793",
"output": "4"
},
{
"input": "2\n802 903\n476 348",
"output": "1"
},
{
"input": "4\n325 343\n425 442\n785 798\n275 270",
"output": "3"
},
{
"input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653",
"output": "25"
},
{
"input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124",
"output": "34"
},
{
"input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255",
"output": "29"
},
{
"input": "5\n664 666\n951 941\n739 742\n844 842\n2 2",
"output": "4"
},
{
"input": "3\n939 867\n411 427\n757 708",
"output": "2"
},
{
"input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636",
"output": "34"
},
{
"input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195",
"output": "28"
},
{
"input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488",
"output": "22"
},
{
"input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235",
"output": "8"
},
{
"input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621",
"output": "22"
},
{
"input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461",
"output": "22"
},
{
"input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924",
"output": "6"
},
{
"input": "3\n1 1\n2 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "5\n1 1\n1 2\n2 2\n3 1\n3 3",
"output": "0"
},
{
"input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3",
"output": "0"
},
{
"input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10",
"output": "1"
},
{
"input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11",
"output": "1"
},
{
"input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11",
"output": "3"
},
{
"input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25",
"output": "7"
},
{
"input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28",
"output": "5"
},
{
"input": "3\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n1 2",
"output": "0"
},
{
"input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4",
"output": "1"
},
{
"input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100",
"output": "6"
},
{
"input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "4\n3 1\n2 1\n2 2\n1 2",
"output": "0"
},
{
"input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "3\n1 2\n1 3\n1 4",
"output": "0"
},
{
"input": "4\n1 1\n2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "4\n1 3\n2 1\n3 2\n3 1",
"output": "1"
},
{
"input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4",
"output": "0"
},
{
"input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700",
"output": "2"
},
{
"input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n3 2\n3 1",
"output": "0"
},
{
"input": "3\n1 2\n3 4\n3 2",
"output": "0"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "0"
},
{
"input": "4\n5 5\n5 4\n6 3\n6 4",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n2 1",
"output": "0"
}
] | 1,591,182,465 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 11 | 280 | 0 | n=int(input())
x=[]
y=[]
for i in range(n):
x1,y1=map(int,input().split())
x.append(x1)
y.append(y1)
dx=[]
dy=[]
ans=0
for i in range (n):
if x[i] not in dx and y[i] not in dy:
ans+=1
if x[i] not in dx:
dx.append(x[i])
if y[i] not in dy:
dy.append(y[i])
print(ans-1)
| Title: Ice Skating
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output Specification:
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
Demo Input:
['2\n2 1\n1 2\n', '2\n2 1\n4 1\n']
Demo Output:
['1\n', '0\n']
Note:
none | ```python
n=int(input())
x=[]
y=[]
for i in range(n):
x1,y1=map(int,input().split())
x.append(x1)
y.append(y1)
dx=[]
dy=[]
ans=0
for i in range (n):
if x[i] not in dx and y[i] not in dy:
ans+=1
if x[i] not in dx:
dx.append(x[i])
if y[i] not in dy:
dy.append(y[i])
print(ans-1)
``` | 0 |
|
133 | A | HQ9+ | PROGRAMMING | 900 | [
"implementation"
] | null | null | HQ9+ is a joke programming language which has only four one-character instructions:
- "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator.
Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored.
You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output. | The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive. | Output "YES", if executing the program will produce any output, and "NO" otherwise. | [
"Hi!\n",
"Codeforces\n"
] | [
"YES\n",
"NO\n"
] | In the first case the program contains only one instruction — "H", which prints "Hello, World!".
In the second case none of the program characters are language instructions. | 500 | [
{
"input": "Hi!",
"output": "YES"
},
{
"input": "Codeforces",
"output": "NO"
},
{
"input": "a+b=c",
"output": "NO"
},
{
"input": "hq-lowercase",
"output": "NO"
},
{
"input": "Q",
"output": "YES"
},
{
"input": "9",
"output": "YES"
},
{
"input": "H",
"output": "YES"
},
{
"input": "+",
"output": "NO"
},
{
"input": "~",
"output": "NO"
},
{
"input": "dEHsbM'gS[\\brZ_dpjXw8f?L[4E\"s4Zc9*(,j:>p$}m7HD[_9nOWQ\\uvq2mHWR",
"output": "YES"
},
{
"input": "tt6l=RHOfStm.;Qd$-}zDes*E,.F7qn5-b%HC",
"output": "YES"
},
{
"input": "@F%K2=%RyL/",
"output": "NO"
},
{
"input": "juq)k(FT.^G=G\\zcqnO\"uJIE1_]KFH9S=1c\"mJ;F9F)%>&.WOdp09+k`Yc6}\"6xw,Aos:M\\_^^:xBb[CcsHm?J",
"output": "YES"
},
{
"input": "6G_\"Fq#<AWyHG=Rci1t%#Jc#x<Fpg'N@t%F=``YO7\\Zd;6PkMe<#91YgzTC)",
"output": "YES"
},
{
"input": "Fvg_~wC>SO4lF}*c`Q;mII9E{4.QodbqN]C",
"output": "YES"
},
{
"input": "p-UXsbd&f",
"output": "NO"
},
{
"input": "<]D7NMA)yZe=`?RbP5lsa.l_Mg^V:\"-0x+$3c,q&L%18Ku<HcA\\s!^OQblk^x{35S'>yz8cKgVHWZ]kV0>_",
"output": "YES"
},
{
"input": "f.20)8b+.R}Gy!DbHU3v(.(=Q^`z[_BaQ}eO=C1IK;b2GkD\\{\\Bf\"!#qh]",
"output": "YES"
},
{
"input": "}do5RU<(w<q[\"-NR)IAH_HyiD{",
"output": "YES"
},
{
"input": "Iy^.,Aw*,5+f;l@Q;jLK'G5H-r1Pfmx?ei~`CjMmUe{K:lS9cu4ay8rqRh-W?Gqv!e-j*U)!Mzn{E8B6%~aSZ~iQ_QwlC9_cX(o8",
"output": "YES"
},
{
"input": "sKLje,:q>-D,;NvQ3,qN3-N&tPx0nL/,>Ca|z\"k2S{NF7btLa3_TyXG4XZ:`(t&\"'^M|@qObZxv",
"output": "YES"
},
{
"input": "%z:c@1ZsQ@\\6U/NQ+M9R>,$bwG`U1+C\\18^:S},;kw!&4r|z`",
"output": "YES"
},
{
"input": "OKBB5z7ud81[Tn@P\"nDUd,>@",
"output": "NO"
},
{
"input": "y{0;neX]w0IenPvPx0iXp+X|IzLZZaRzBJ>q~LhMhD$x-^GDwl;,a'<bAqH8QrFwbK@oi?I'W.bZ]MlIQ/x(0YzbTH^l.)]0Bv",
"output": "YES"
},
{
"input": "EL|xIP5_+Caon1hPpQ0[8+r@LX4;b?gMy>;/WH)pf@Ur*TiXu*e}b-*%acUA~A?>MDz#!\\Uh",
"output": "YES"
},
{
"input": "UbkW=UVb>;z6)p@Phr;^Dn.|5O{_i||:Rv|KJ_ay~V(S&Jp",
"output": "NO"
},
{
"input": "!3YPv@2JQ44@)R2O_4`GO",
"output": "YES"
},
{
"input": "Kba/Q,SL~FMd)3hOWU'Jum{9\"$Ld4:GW}D]%tr@G{hpG:PV5-c'VIZ~m/6|3I?_4*1luKnOp`%p|0H{[|Y1A~4-ZdX,Rw2[\\",
"output": "YES"
},
{
"input": "NRN*=v>;oU7[acMIJn*n^bWm!cm3#E7Efr>{g-8bl\"DN4~_=f?[T;~Fq#&)aXq%</GcTJD^e$@Extm[e\"C)q_L",
"output": "NO"
},
{
"input": "y#<fv{_=$MP!{D%I\\1OqjaqKh[pqE$KvYL<9@*V'j8uH0/gQdA'G;&y4Cv6&",
"output": "YES"
},
{
"input": "+SE_Pg<?7Fh,z&uITQut2a-mk8X8La`c2A}",
"output": "YES"
},
{
"input": "Uh3>ER](J",
"output": "NO"
},
{
"input": "!:!{~=9*\\P;Z6F?HC5GadFz)>k*=u|+\"Cm]ICTmB!`L{&oS/z6b~#Snbp/^\\Q>XWU-vY+/dP.7S=-#&whS@,",
"output": "YES"
},
{
"input": "KimtYBZp+ISeO(uH;UldoE6eAcp|9u?SzGZd6j-e}[}u#e[Cx8.qgY]$2!",
"output": "YES"
},
{
"input": "[:[SN-{r>[l+OggH3v3g{EPC*@YBATT@",
"output": "YES"
},
{
"input": "'jdL(vX",
"output": "NO"
},
{
"input": "Q;R+aay]cL?Zh*uG\"YcmO*@Dts*Gjp}D~M7Z96+<4?9I3aH~0qNdO(RmyRy=ci,s8qD_kwj;QHFzD|5,5",
"output": "YES"
},
{
"input": "{Q@#<LU_v^qdh%gGxz*pu)Y\"]k-l-N30WAxvp2IE3:jD0Wi4H/xWPH&s",
"output": "YES"
},
{
"input": "~@Gb(S&N$mBuBUMAky-z^{5VwLNTzYg|ZUZncL@ahS?K*As<$iNUARM3r43J'jJB)$ujfPAq\"G<S9flGyakZg!2Z.-NJ|2{F>]",
"output": "YES"
},
{
"input": "Jp5Aa>aP6fZ!\\6%A}<S}j{O4`C6y$8|i3IW,WHy&\"ioE&7zP\"'xHAY;:x%@SnS]Mr{R|})gU",
"output": "YES"
},
{
"input": "ZA#:U)$RI^sE\\vuAt]x\"2zipI!}YEu2<j$:H0_9/~eB?#->",
"output": "YES"
},
{
"input": "&ppw0._:\\p-PuWM@l}%%=",
"output": "NO"
},
{
"input": "P(^pix\"=oiEZu8?@d@J(I`Xp5TN^T3\\Z7P5\"ZrvZ{2Fwz3g-8`U!)(1$a<g+9Q|COhDoH;HwFY02Pa|ZGp$/WZBR=>6Jg!yr",
"output": "YES"
},
{
"input": "`WfODc\\?#ax~1xu@[ao+o_rN|L7%v,p,nDv>3+6cy.]q3)+A6b!q*Hc+#.t4f~vhUa~$^q",
"output": "YES"
},
{
"input": ",)TH9N}'6t2+0Yg?S#6/{_.,!)9d}h'wG|sY&'Ul4D0l0",
"output": "YES"
},
{
"input": "VXB&r9Z)IlKOJ:??KDA",
"output": "YES"
},
{
"input": "\")1cL>{o\\dcYJzu?CefyN^bGRviOH&P7rJS3PT4:0V3F)%\\}L=AJouYsj_>j2|7^1NWu*%NbOP>ngv-ls<;b-4Sd3Na0R",
"output": "YES"
},
{
"input": "2Y}\\A)>row{~c[g>:'.|ZC8%UTQ/jcdhK%6O)QRC.kd@%y}LJYk=V{G5pQK/yKJ%{G3C",
"output": "YES"
},
{
"input": "O.&=qt(`z(",
"output": "NO"
},
{
"input": "_^r6fyIc/~~;>l%9?aVEi7-{=,[<aMiB'-scSg$$|\"jAzY0N>QkHHGBZj2c\"=fhRlWd5;5K|GgU?7h]!;wl@",
"output": "YES"
},
{
"input": "+/`sAd&eB29E=Nu87${.u6GY@$^a$,}s^!p!F}B-z8<<wORb<S7;HM1a,gp",
"output": "YES"
},
{
"input": "U_ilyOGMT+QiW/M8/D(1=6a7)_FA,h4`8",
"output": "YES"
},
{
"input": "!0WKT:$O",
"output": "NO"
},
{
"input": "1EE*I%EQz6$~pPu7|(r7nyPQt4uGU@]~H'4uII?b1_Wn)K?ZRHrr0z&Kr;}aO3<mN=3:{}QgPxI|Ncm4#)",
"output": "YES"
},
{
"input": "[u3\"$+!:/.<Dp1M7tH}:zxjt],^kv}qP;y12\"`^'/u*h%AFmPJ>e1#Yly",
"output": "YES"
},
{
"input": "'F!_]tB<A&UO+p?7liE>(x&RFgG2~\\(",
"output": "NO"
},
{
"input": "Qv)X8",
"output": "YES"
},
{
"input": "aGv7,J@&g1(}E3g6[LuDZwZl2<v7IwQA%\"R(?ouBD>_=y\"3Kf%^>vON<a^T\\G^ootgE@whWmZo=[ex|F",
"output": "YES"
},
{
"input": "e{}2vQ+/r@p0}cLKNe4MCk",
"output": "YES"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnkH",
"output": "YES"
},
{
"input": "Qzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky",
"output": "YES"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwb9uvhifnuapwyndmhtqvkgkbhtytszotwflegsjzzszfwtzfpnscguemwrczqxycivdqnky",
"output": "YES"
},
{
"input": "1H1",
"output": "YES"
},
{
"input": "+Q",
"output": "YES"
},
{
"input": "1ab",
"output": "NO"
},
{
"input": "!",
"output": "NO"
},
{
"input": "0+",
"output": "NO"
},
{
"input": "+H",
"output": "YES"
},
{
"input": "cH",
"output": "YES"
},
{
"input": "+8",
"output": "NO"
},
{
"input": "8+",
"output": "NO"
},
{
"input": "++++++++++++++++++++++++++",
"output": "NO"
},
{
"input": "(+)",
"output": "NO"
},
{
"input": "H+",
"output": "YES"
},
{
"input": "a!",
"output": "NO"
},
{
"input": "++++++++++++++",
"output": "NO"
},
{
"input": "+++++++++++++++++++++++++++++++++++++++++++++++++++++++++",
"output": "NO"
},
{
"input": "8",
"output": "NO"
},
{
"input": "3",
"output": "NO"
},
{
"input": "HQ9",
"output": "YES"
},
{
"input": "+++H",
"output": "YES"
},
{
"input": "++++++++++",
"output": "NO"
},
{
"input": "HHHHHHH",
"output": "YES"
},
{
"input": "abacabaH",
"output": "YES"
},
{
"input": "+G",
"output": "NO"
}
] | 1,689,859,953 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 92 | 0 | str1=input()
lis=['H','Q','9','+']
for i in str1:
if i in lis:
print("YES")
break
else:
print("NO")
break | Title: HQ9+
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
HQ9+ is a joke programming language which has only four one-character instructions:
- "H" prints "Hello, World!",- "Q" prints the source code of the program itself,- "9" prints the lyrics of "99 Bottles of Beer" song, - "+" increments the value stored in the internal accumulator.
Instructions "H" and "Q" are case-sensitive and must be uppercase. The characters of the program which are not instructions are ignored.
You are given a program written in HQ9+. You have to figure out whether executing this program will produce any output.
Input Specification:
The input will consist of a single line *p* which will give a program in HQ9+. String *p* will contain between 1 and 100 characters, inclusive. ASCII-code of each character of *p* will be between 33 (exclamation mark) and 126 (tilde), inclusive.
Output Specification:
Output "YES", if executing the program will produce any output, and "NO" otherwise.
Demo Input:
['Hi!\n', 'Codeforces\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first case the program contains only one instruction — "H", which prints "Hello, World!".
In the second case none of the program characters are language instructions. | ```python
str1=input()
lis=['H','Q','9','+']
for i in str1:
if i in lis:
print("YES")
break
else:
print("NO")
break
``` | 0 |
|
432 | A | Choosing Teams | PROGRAMMING | 800 | [
"greedy",
"implementation",
"sortings"
] | null | null | The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times? | The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship. | Print a single number — the answer to the problem. | [
"5 2\n0 4 5 1 0\n",
"6 4\n0 1 2 3 4 5\n",
"6 5\n0 0 0 0 0 0\n"
] | [
"1\n",
"0\n",
"2\n"
] | In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits. | 500 | [
{
"input": "5 2\n0 4 5 1 0",
"output": "1"
},
{
"input": "6 4\n0 1 2 3 4 5",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "3 4\n0 1 0",
"output": "1"
},
{
"input": "3 4\n0 2 0",
"output": "0"
},
{
"input": "6 5\n0 0 0 0 0 0",
"output": "2"
},
{
"input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1",
"output": "3"
},
{
"input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4",
"output": "4"
},
{
"input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1",
"output": "3"
},
{
"input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0",
"output": "5"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4",
"output": "4"
},
{
"input": "6 3\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "1 4\n1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "2 3\n0 0",
"output": "0"
}
] | 1,696,945,367 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 35 | 62 | 1,740,800 | n, k = map(int, input().split())
ans = 0
for el in input().split():
if 5 - int(el) >= k:
ans += 1
print(ans // 3) | Title: Choosing Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times.
The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
Input Specification:
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n']
Demo Output:
['1\n', '0\n', '2\n']
Note:
In the first sample only one team could be made: the first, the fourth and the fifth participants.
In the second sample no teams could be created.
In the third sample two teams could be created. Any partition into two teams fits. | ```python
n, k = map(int, input().split())
ans = 0
for el in input().split():
if 5 - int(el) >= k:
ans += 1
print(ans // 3)
``` | 3 |
|
200 | B | Drinks | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink. | The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space. | Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4. | [
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] | [
"66.666666666667\n",
"37.500000000000\n"
] | Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent. | 500 | [
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,684,143,362 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #import<cstdio>
float i,k,n,t;main(){for(scanf("%f",&n);i++<n;t+=k)scanf("%f",&k);printf("%f",t/n);}
| Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent. | ```python
#import<cstdio>
float i,k,n,t;main(){for(scanf("%f",&n);i++<n;t+=k)scanf("%f",&k);printf("%f",t/n);}
``` | -1 |
|
984 | A | Game | PROGRAMMING | 800 | [
"sortings"
] | null | null | Two players play a game.
Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns.
The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it.
You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves. | The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$). | Print one number that will be left on the board. | [
"3\n2 1 3\n",
"3\n2 2 2\n"
] | [
"2",
"2"
] | In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board.
In the second sample, $2$ is left on the board regardless of the actions of the players. | 500 | [
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 2 2",
"output": "2"
},
{
"input": "9\n44 53 51 80 5 27 74 79 94",
"output": "53"
},
{
"input": "10\n38 82 23 37 96 4 81 60 67 86",
"output": "60"
},
{
"input": "10\n58 26 77 15 53 81 68 48 22 65",
"output": "53"
},
{
"input": "1\n124",
"output": "124"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 1 1000",
"output": "1"
},
{
"input": "2\n322 322",
"output": "322"
},
{
"input": "3\n9 92 12",
"output": "12"
},
{
"input": "3\n1 2 2",
"output": "2"
}
] | 1,616,501,076 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 62 | 0 | n = int(input())
sorted_ip = sorted(map(int, input().split()))
print(sorted_ip[n//2])
| Title: Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players play a game.
Initially there are $n$ integers $a_1, a_2, \ldots, a_n$ written on the board. Each turn a player selects one number and erases it from the board. This continues until there is only one number left on the board, i. e. $n - 1$ turns are made. The first player makes the first move, then players alternate turns.
The first player wants to minimize the last number that would be left on the board, while the second player wants to maximize it.
You want to know what number will be left on the board after $n - 1$ turns if both players make optimal moves.
Input Specification:
The first line contains one integer $n$ ($1 \le n \le 1000$) — the number of numbers on the board.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 10^6$).
Output Specification:
Print one number that will be left on the board.
Demo Input:
['3\n2 1 3\n', '3\n2 2 2\n']
Demo Output:
['2', '2']
Note:
In the first sample, the first player erases $3$ and the second erases $1$. $2$ is left on the board.
In the second sample, $2$ is left on the board regardless of the actions of the players. | ```python
n = int(input())
sorted_ip = sorted(map(int, input().split()))
print(sorted_ip[n//2])
``` | 0 |
|
208 | C | Police Station | PROGRAMMING | 1,900 | [
"dp",
"graphs",
"shortest paths"
] | null | null | The Berland road network consists of *n* cities and of *m* bidirectional roads. The cities are numbered from 1 to *n*, where the main capital city has number *n*, and the culture capital — number 1. The road network is set up so that it is possible to reach any city from any other one by the roads. Moving on each road in any direction takes the same time.
All residents of Berland are very lazy people, and so when they want to get from city *v* to city *u*, they always choose one of the shortest paths (no matter which one).
The Berland government wants to make this country's road network safer. For that, it is going to put a police station in one city. The police station has a rather strange property: when a citizen of Berland is driving along the road with a police station at one end of it, the citizen drives more carefully, so all such roads are considered safe. The roads, both ends of which differ from the city with the police station, are dangerous.
Now the government wonders where to put the police station so that the average number of safe roads for all the shortest paths from the cultural capital to the main capital would take the maximum value. | The first input line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=100, ) — the number of cities and the number of roads in Berland, correspondingly. Next *m* lines contain pairs of integers *v**i*, *u**i* (1<=≤<=*v**i*,<=*u**i*<=≤<=*n*, *v**i*<=≠<=*u**i*) — the numbers of cities that are connected by the *i*-th road. The numbers on a line are separated by a space.
It is guaranteed that each pair of cities is connected with no more than one road and that it is possible to get from any city to any other one along Berland roads. | Print the maximum possible value of the average number of safe roads among all shortest paths from the culture capital to the main one. The answer will be considered valid if its absolute or relative inaccuracy does not exceed 10<=-<=6. | [
"4 4\n1 2\n2 4\n1 3\n3 4\n",
"11 14\n1 2\n1 3\n2 4\n3 4\n4 5\n4 6\n5 11\n6 11\n1 8\n8 9\n9 7\n11 7\n1 10\n10 4\n"
] | [
"1.000000000000\n",
"1.714285714286\n"
] | In the first sample you can put a police station in one of the capitals, then each path will have exactly one safe road. If we place the station not in the capital, then the average number of safe roads will also make <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/8f23cc2cd3bef67bde56e16911c7af627da25d4d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample we can obtain the maximum sought value if we put the station in city 4, then 6 paths will have 2 safe roads each, and one path will have 0 safe roads, so the answer will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d7723df54e28c93b1c3b9d4c68b039b5071092af.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 2,500 | [] | 1,692,257,767 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 60 | 0 | print("_RANDOM_GUESS_1692257767.1684995")# 1692257767.1685169 | Title: Police Station
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Berland road network consists of *n* cities and of *m* bidirectional roads. The cities are numbered from 1 to *n*, where the main capital city has number *n*, and the culture capital — number 1. The road network is set up so that it is possible to reach any city from any other one by the roads. Moving on each road in any direction takes the same time.
All residents of Berland are very lazy people, and so when they want to get from city *v* to city *u*, they always choose one of the shortest paths (no matter which one).
The Berland government wants to make this country's road network safer. For that, it is going to put a police station in one city. The police station has a rather strange property: when a citizen of Berland is driving along the road with a police station at one end of it, the citizen drives more carefully, so all such roads are considered safe. The roads, both ends of which differ from the city with the police station, are dangerous.
Now the government wonders where to put the police station so that the average number of safe roads for all the shortest paths from the cultural capital to the main capital would take the maximum value.
Input Specification:
The first input line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=100, ) — the number of cities and the number of roads in Berland, correspondingly. Next *m* lines contain pairs of integers *v**i*, *u**i* (1<=≤<=*v**i*,<=*u**i*<=≤<=*n*, *v**i*<=≠<=*u**i*) — the numbers of cities that are connected by the *i*-th road. The numbers on a line are separated by a space.
It is guaranteed that each pair of cities is connected with no more than one road and that it is possible to get from any city to any other one along Berland roads.
Output Specification:
Print the maximum possible value of the average number of safe roads among all shortest paths from the culture capital to the main one. The answer will be considered valid if its absolute or relative inaccuracy does not exceed 10<=-<=6.
Demo Input:
['4 4\n1 2\n2 4\n1 3\n3 4\n', '11 14\n1 2\n1 3\n2 4\n3 4\n4 5\n4 6\n5 11\n6 11\n1 8\n8 9\n9 7\n11 7\n1 10\n10 4\n']
Demo Output:
['1.000000000000\n', '1.714285714286\n']
Note:
In the first sample you can put a police station in one of the capitals, then each path will have exactly one safe road. If we place the station not in the capital, then the average number of safe roads will also make <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/8f23cc2cd3bef67bde56e16911c7af627da25d4d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample we can obtain the maximum sought value if we put the station in city 4, then 6 paths will have 2 safe roads each, and one path will have 0 safe roads, so the answer will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d7723df54e28c93b1c3b9d4c68b039b5071092af.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
print("_RANDOM_GUESS_1692257767.1684995")# 1692257767.1685169
``` | 0 |
|
938 | B | Run For Your Prize | PROGRAMMING | 1,100 | [
"brute force",
"greedy"
] | null | null | You and your friend are participating in a TV show "Run For Your Prize".
At the start of the show *n* prizes are located on a straight line. *i*-th prize is located at position *a**i*. Positions of all prizes are distinct. You start at position 1, your friend — at position 106 (and there is no prize in any of these two positions). You have to work as a team and collect all prizes in minimum possible time, in any order.
You know that it takes exactly 1 second to move from position *x* to position *x*<=+<=1 or *x*<=-<=1, both for you and your friend. You also have trained enough to instantly pick up any prize, if its position is equal to your current position (and the same is true for your friend). Carrying prizes does not affect your speed (or your friend's speed) at all.
Now you may discuss your strategy with your friend and decide who will pick up each prize. Remember that every prize must be picked up, either by you or by your friend.
What is the minimum number of seconds it will take to pick up all the prizes? | The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of prizes.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (2<=≤<=*a**i*<=≤<=106<=-<=1) — the positions of the prizes. No two prizes are located at the same position. Positions are given in ascending order. | Print one integer — the minimum number of seconds it will take to collect all prizes. | [
"3\n2 3 9\n",
"2\n2 999995\n"
] | [
"8\n",
"5\n"
] | In the first example you take all the prizes: take the first at 1, the second at 2 and the third at 8.
In the second example you take the first prize in 1 second and your friend takes the other in 5 seconds, you do this simultaneously, so the total time is 5. | 0 | [
{
"input": "3\n2 3 9",
"output": "8"
},
{
"input": "2\n2 999995",
"output": "5"
},
{
"input": "1\n20",
"output": "19"
},
{
"input": "6\n2 3 500000 999997 999998 999999",
"output": "499999"
},
{
"input": "1\n999999",
"output": "1"
},
{
"input": "1\n510000",
"output": "490000"
},
{
"input": "3\n2 5 27",
"output": "26"
},
{
"input": "2\n600000 800000",
"output": "400000"
},
{
"input": "5\n2 5 6 27 29",
"output": "28"
},
{
"input": "1\n500001",
"output": "499999"
},
{
"input": "10\n3934 38497 42729 45023 51842 68393 77476 82414 91465 98055",
"output": "98054"
},
{
"input": "1\n900000",
"output": "100000"
},
{
"input": "1\n500000",
"output": "499999"
},
{
"input": "1\n999998",
"output": "2"
},
{
"input": "3\n999997 999998 999999",
"output": "3"
},
{
"input": "2\n999997 999999",
"output": "3"
},
{
"input": "2\n2 999998",
"output": "2"
},
{
"input": "2\n500000 500001",
"output": "499999"
},
{
"input": "1\n500002",
"output": "499998"
},
{
"input": "1\n700000",
"output": "300000"
},
{
"input": "2\n2 999999",
"output": "1"
},
{
"input": "2\n999998 999999",
"output": "2"
},
{
"input": "1\n999995",
"output": "5"
},
{
"input": "2\n499999 500001",
"output": "499999"
},
{
"input": "1\n499999",
"output": "499998"
},
{
"input": "2\n100 999900",
"output": "100"
},
{
"input": "2\n499999 500000",
"output": "499999"
},
{
"input": "2\n500001 999999",
"output": "499999"
},
{
"input": "3\n500000 500001 500002",
"output": "499999"
},
{
"input": "2\n2 500001",
"output": "499999"
},
{
"input": "2\n499999 999999",
"output": "499998"
},
{
"input": "2\n2 500000",
"output": "499999"
},
{
"input": "4\n2 3 4 999999",
"output": "3"
},
{
"input": "2\n100000 500001",
"output": "499999"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n800000",
"output": "200000"
},
{
"input": "1\n505050",
"output": "494950"
},
{
"input": "1\n753572",
"output": "246428"
},
{
"input": "2\n576696 760487",
"output": "423304"
},
{
"input": "10\n3 4 5 6 7 8 9 10 11 12",
"output": "11"
},
{
"input": "4\n2 3 4 5",
"output": "4"
},
{
"input": "4\n999996 999997 999998 999999",
"output": "4"
}
] | 1,520,061,524 | 2,624 | Python 3 | WRONG_ANSWER | TESTS | 0 | 46 | 5,632,000 | you=1
friend=10**6
total=input('total:')
number=input('each number:')
index=list(map(int, number.strip().split()))
A=friend-index[-1]
B=index[-1]-1
if A<B:
print(A)
else:
print(B) | Title: Run For Your Prize
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You and your friend are participating in a TV show "Run For Your Prize".
At the start of the show *n* prizes are located on a straight line. *i*-th prize is located at position *a**i*. Positions of all prizes are distinct. You start at position 1, your friend — at position 106 (and there is no prize in any of these two positions). You have to work as a team and collect all prizes in minimum possible time, in any order.
You know that it takes exactly 1 second to move from position *x* to position *x*<=+<=1 or *x*<=-<=1, both for you and your friend. You also have trained enough to instantly pick up any prize, if its position is equal to your current position (and the same is true for your friend). Carrying prizes does not affect your speed (or your friend's speed) at all.
Now you may discuss your strategy with your friend and decide who will pick up each prize. Remember that every prize must be picked up, either by you or by your friend.
What is the minimum number of seconds it will take to pick up all the prizes?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of prizes.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (2<=≤<=*a**i*<=≤<=106<=-<=1) — the positions of the prizes. No two prizes are located at the same position. Positions are given in ascending order.
Output Specification:
Print one integer — the minimum number of seconds it will take to collect all prizes.
Demo Input:
['3\n2 3 9\n', '2\n2 999995\n']
Demo Output:
['8\n', '5\n']
Note:
In the first example you take all the prizes: take the first at 1, the second at 2 and the third at 8.
In the second example you take the first prize in 1 second and your friend takes the other in 5 seconds, you do this simultaneously, so the total time is 5. | ```python
you=1
friend=10**6
total=input('total:')
number=input('each number:')
index=list(map(int, number.strip().split()))
A=friend-index[-1]
B=index[-1]-1
if A<B:
print(A)
else:
print(B)
``` | 0 |
|
189 | A | Cut Ribbon | PROGRAMMING | 1,300 | [
"brute force",
"dp"
] | null | null | Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions:
- After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum.
Help Polycarpus and find the number of ribbon pieces after the required cutting. | The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide. | Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists. | [
"5 5 3 2\n",
"7 5 5 2\n"
] | [
"2\n",
"2\n"
] | In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3.
In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2. | 500 | [
{
"input": "5 5 3 2",
"output": "2"
},
{
"input": "7 5 5 2",
"output": "2"
},
{
"input": "4 4 4 4",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "4000 1 2 3",
"output": "4000"
},
{
"input": "4000 3 4 5",
"output": "1333"
},
{
"input": "10 3 4 5",
"output": "3"
},
{
"input": "100 23 15 50",
"output": "2"
},
{
"input": "3119 3515 1021 7",
"output": "11"
},
{
"input": "918 102 1327 1733",
"output": "9"
},
{
"input": "3164 42 430 1309",
"output": "15"
},
{
"input": "3043 317 1141 2438",
"output": "7"
},
{
"input": "26 1 772 2683",
"output": "26"
},
{
"input": "370 2 1 15",
"output": "370"
},
{
"input": "734 12 6 2",
"output": "367"
},
{
"input": "418 18 14 17",
"output": "29"
},
{
"input": "18 16 28 9",
"output": "2"
},
{
"input": "14 6 2 17",
"output": "7"
},
{
"input": "29 27 18 2",
"output": "2"
},
{
"input": "29 12 7 10",
"output": "3"
},
{
"input": "27 23 4 3",
"output": "9"
},
{
"input": "5 14 5 2",
"output": "1"
},
{
"input": "5 17 26 5",
"output": "1"
},
{
"input": "9 1 10 3",
"output": "9"
},
{
"input": "2 19 15 1",
"output": "2"
},
{
"input": "4 6 4 9",
"output": "1"
},
{
"input": "10 6 2 9",
"output": "5"
},
{
"input": "2 2 9 6",
"output": "1"
},
{
"input": "6 2 4 1",
"output": "6"
},
{
"input": "27 24 5 27",
"output": "1"
},
{
"input": "2683 83 26 2709",
"output": "101"
},
{
"input": "728 412 789 158",
"output": "3"
},
{
"input": "3964 4 2916 176",
"output": "991"
},
{
"input": "3399 2035 2 3334",
"output": "683"
},
{
"input": "3455 244 3301 3",
"output": "991"
},
{
"input": "595 2263 3625 1",
"output": "595"
},
{
"input": "4000 1 1 1",
"output": "4000"
},
{
"input": "3999 2 2 3999",
"output": "1"
},
{
"input": "25 6 8 11",
"output": "3"
},
{
"input": "4000 500 1000 2000",
"output": "8"
},
{
"input": "53 10 11 23",
"output": "5"
},
{
"input": "100 100 1 1",
"output": "100"
},
{
"input": "17 3 4 10",
"output": "5"
},
{
"input": "413 101 102 105",
"output": "4"
},
{
"input": "490 4 49 50",
"output": "111"
},
{
"input": "3999 2 3 3",
"output": "1999"
},
{
"input": "8 3 8 4",
"output": "2"
},
{
"input": "5 1 3 3",
"output": "5"
},
{
"input": "100 3 17 22",
"output": "27"
},
{
"input": "4000 2 3 4",
"output": "2000"
},
{
"input": "4000 3 3 5",
"output": "1332"
},
{
"input": "13 4 6 7",
"output": "2"
},
{
"input": "4000 5 2 2",
"output": "2000"
},
{
"input": "3999 2 2 3",
"output": "1999"
},
{
"input": "4000 33 7 3333",
"output": "564"
},
{
"input": "60 33 20 9",
"output": "4"
},
{
"input": "100 9 11 99",
"output": "10"
},
{
"input": "2009 6 8 9",
"output": "334"
}
] | 1,682,047,805 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 5 | 46 | 0 | n,a,b,c = list(map(int,input().split()))
l = [a,b,c]
l2 = [a,b,c,0]
l.sort()
cor =1
for i in l:
if n%i in l2:
if n%i ==0:
cor-=1
cor+=n//i
break
print(cor) | Title: Cut Ribbon
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions:
- After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum.
Help Polycarpus and find the number of ribbon pieces after the required cutting.
Input Specification:
The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide.
Output Specification:
Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists.
Demo Input:
['5 5 3 2\n', '7 5 5 2\n']
Demo Output:
['2\n', '2\n']
Note:
In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3.
In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2. | ```python
n,a,b,c = list(map(int,input().split()))
l = [a,b,c]
l2 = [a,b,c,0]
l.sort()
cor =1
for i in l:
if n%i in l2:
if n%i ==0:
cor-=1
cor+=n//i
break
print(cor)
``` | 0 |
|
10 | A | Power Consumption Calculation | PROGRAMMING | 900 | [
"implementation"
] | A. Power Consumption Calculation | 1 | 256 | Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*]. | The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=1440, *r**i*<=<<=*l**i*<=+<=1 for *i*<=<<=*n*), which stand for the start and the end of the *i*-th period of work. | Output the answer to the problem. | [
"1 3 2 1 5 10\n0 10\n",
"2 8 4 2 5 10\n20 30\n50 100\n"
] | [
"30",
"570"
] | none | 0 | [
{
"input": "1 3 2 1 5 10\n0 10",
"output": "30"
},
{
"input": "2 8 4 2 5 10\n20 30\n50 100",
"output": "570"
},
{
"input": "3 15 9 95 39 19\n873 989\n1003 1137\n1172 1436",
"output": "8445"
},
{
"input": "4 73 2 53 58 16\n51 52\n209 242\n281 407\n904 945",
"output": "52870"
},
{
"input": "5 41 20 33 43 4\n46 465\n598 875\n967 980\n1135 1151\n1194 1245",
"output": "46995"
},
{
"input": "6 88 28 100 53 36\n440 445\n525 614\n644 844\n1238 1261\n1305 1307\n1425 1434",
"output": "85540"
},
{
"input": "7 46 61 55 28 59\n24 26\n31 61\n66 133\n161 612\n741 746\n771 849\n1345 1357",
"output": "67147"
},
{
"input": "8 83 18 30 28 5\n196 249\n313 544\n585 630\n718 843\n1040 1194\n1207 1246\n1268 1370\n1414 1422",
"output": "85876"
},
{
"input": "9 31 65 27 53 54\n164 176\n194 210\n485 538\n617 690\n875 886\n888 902\n955 957\n1020 1200\n1205 1282",
"output": "38570"
},
{
"input": "30 3 1 58 44 7\n11 13\n14 32\n37 50\n70 74\n101 106\n113 129\n184 195\n197 205\n213 228\n370 394\n443 446\n457 460\n461 492\n499 585\n602 627\n709 776\n812 818\n859 864\n910 913\n918 964\n1000 1010\n1051 1056\n1063 1075\n1106 1145\n1152 1189\n1211 1212\n1251 1259\n1272 1375\n1412 1417\n1430 1431",
"output": "11134"
},
{
"input": "30 42 3 76 28 26\n38 44\n55 66\n80 81\n84 283\n298 314\n331 345\n491 531\n569 579\n597 606\n612 617\n623 701\n723 740\n747 752\n766 791\n801 827\n842 846\n853 891\n915 934\n945 949\n955 964\n991 1026\n1051 1059\n1067 1179\n1181 1191\n1214 1226\n1228 1233\n1294 1306\n1321 1340\n1371 1374\n1375 1424",
"output": "59043"
},
{
"input": "30 46 5 93 20 46\n12 34\n40 41\n54 58\n100 121\n162 182\n220 349\n358 383\n390 398\n401 403\n408 409\n431 444\n466 470\n471 535\n556 568\n641 671\n699 709\n767 777\n786 859\n862 885\n912 978\n985 997\n1013 1017\n1032 1038\n1047 1048\n1062 1080\n1094 1097\n1102 1113\n1122 1181\n1239 1280\n1320 1369",
"output": "53608"
},
{
"input": "30 50 74 77 4 57\n17 23\n24 61\n67 68\n79 87\n93 101\n104 123\n150 192\n375 377\n398 414\n461 566\n600 633\n642 646\n657 701\n771 808\n812 819\n823 826\n827 833\n862 875\n880 891\n919 920\n928 959\n970 1038\n1057 1072\n1074 1130\n1165 1169\n1171 1230\n1265 1276\n1279 1302\n1313 1353\n1354 1438",
"output": "84067"
},
{
"input": "30 54 76 95 48 16\n9 11\n23 97\n112 116\n126 185\n214 223\n224 271\n278 282\n283 348\n359 368\n373 376\n452 463\n488 512\n532 552\n646 665\n681 685\n699 718\n735 736\n750 777\n791 810\n828 838\n841 858\n874 1079\n1136 1171\n1197 1203\n1210 1219\n1230 1248\n1280 1292\n1324 1374\n1397 1435\n1438 1439",
"output": "79844"
},
{
"input": "30 58 78 12 41 28\n20 26\n27 31\n35 36\n38 99\n103 104\n106 112\n133 143\n181 246\n248 251\n265 323\n350 357\n378 426\n430 443\n466 476\n510 515\n517 540\n542 554\n562 603\n664 810\n819 823\n826 845\n869 895\n921 973\n1002 1023\n1102 1136\n1143 1148\n1155 1288\n1316 1388\n1394 1403\n1434 1437",
"output": "82686"
},
{
"input": "30 62 80 97 25 47\n19 20\n43 75\n185 188\n199 242\n252 258\n277 310\n316 322\n336 357\n398 399\n404 436\n443 520\n549 617\n637 649\n679 694\n705 715\n725 730\n731 756\n768 793\n806 833\n834 967\n1003 1079\n1088 1097\n1100 1104\n1108 1121\n1127 1164\n1240 1263\n1274 1307\n1367 1407\n1419 1425\n1433 1437",
"output": "92356"
},
{
"input": "30 100 48 14 9 7\n26 55\n75 107\n145 146\n158 167\n197 199\n201 213\n222 238\n257 265\n271 338\n357 439\n454 462\n463 562\n633 660\n670 691\n696 829\n844 864\n880 888\n891 894\n895 900\n950 973\n1004 1007\n1018 1021\n1045 1049\n1062 1073\n1138 1184\n1240 1272\n1278 1315\n1403 1410\n1412 1418\n1426 1434",
"output": "107490"
},
{
"input": "30 3 50 32 1 18\n46 60\n66 94\n99 141\n162 239\n309 334\n400 550\n594 630\n659 663\n664 701\n735 736\n741 755\n756 801\n823 854\n865 915\n937 964\n984 986\n990 1007\n1008 1031\n1052 1064\n1073 1080\n1190 1191\n1192 1254\n1265 1266\n1272 1273\n1274 1277\n1284 1302\n1308 1312\n1358 1383\n1388 1389\n1390 1401",
"output": "25258"
},
{
"input": "30 7 52 49 46 37\n2 73\n129 130\n131 140\n143 150\n187 190\n217 238\n248 271\n375 426\n465 470\n475 503\n506 541\n569 571\n578 585\n680 683\n690 738\n742 761\n868 877\n890 892\n904 915\n935 961\n1076 1100\n1103 1114\n1232 1244\n1246 1247\n1257 1261\n1271 1276\n1280 1298\n1346 1360\n1373 1382\n1407 1419",
"output": "23992"
}
] | 1,687,395,759 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 92 | 0 | n, p1, p2, p3, t1, t2 = map(int, input().split())
l = []
for _ in range(n):
l.append(list(map(int, input().split())))
ans = 0
for i in range(n):
x = l[i][0]
y = l[i][1]
ans += (y - x) * p1
for i in range(n-1):
z = l[i+1][0] - l[i][1]
if z <= t1:
ans += p1 * z
elif t1 < z <= t2:
ans += p1 * t1 + p2 * (z - t1)
elif z > t2:
ans += p1 * t1 + p2 * t2 + p3 * (z - t2 - t1)
print(ans) | Title: Power Consumption Calculation
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Tom is interested in power consumption of his favourite laptop. His laptop has three modes. In normal mode laptop consumes *P*1 watt per minute. *T*1 minutes after Tom moved the mouse or touched the keyboard for the last time, a screensaver starts and power consumption changes to *P*2 watt per minute. Finally, after *T*2 minutes from the start of the screensaver, laptop switches to the "sleep" mode and consumes *P*3 watt per minute. If Tom moves the mouse or touches the keyboard when the laptop is in the second or in the third mode, it switches to the first (normal) mode. Tom's work with the laptop can be divided into *n* time periods [*l*1,<=*r*1],<=[*l*2,<=*r*2],<=...,<=[*l**n*,<=*r**n*]. During each interval Tom continuously moves the mouse and presses buttons on the keyboard. Between the periods Tom stays away from the laptop. Find out the total amount of power consumed by the laptop during the period [*l*1,<=*r**n*].
Input Specification:
The first line contains 6 integer numbers *n*, *P*1, *P*2, *P*3, *T*1, *T*2 (1<=≤<=*n*<=≤<=100,<=0<=≤<=*P*1,<=*P*2,<=*P*3<=≤<=100,<=1<=≤<=*T*1,<=*T*2<=≤<=60). The following *n* lines contain description of Tom's work. Each *i*-th of these lines contains two space-separated integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=1440, *r**i*<=<<=*l**i*<=+<=1 for *i*<=<<=*n*), which stand for the start and the end of the *i*-th period of work.
Output Specification:
Output the answer to the problem.
Demo Input:
['1 3 2 1 5 10\n0 10\n', '2 8 4 2 5 10\n20 30\n50 100\n']
Demo Output:
['30', '570']
Note:
none | ```python
n, p1, p2, p3, t1, t2 = map(int, input().split())
l = []
for _ in range(n):
l.append(list(map(int, input().split())))
ans = 0
for i in range(n):
x = l[i][0]
y = l[i][1]
ans += (y - x) * p1
for i in range(n-1):
z = l[i+1][0] - l[i][1]
if z <= t1:
ans += p1 * z
elif t1 < z <= t2:
ans += p1 * t1 + p2 * (z - t1)
elif z > t2:
ans += p1 * t1 + p2 * t2 + p3 * (z - t2 - t1)
print(ans)
``` | 0 |
0 | none | none | none | 0 | [
"none"
] | null | null | Sasha is taking part in a programming competition. In one of the problems she should check if some rooted trees are isomorphic or not. She has never seen this problem before, but, being an experienced participant, she guessed that she should match trees to some sequences and then compare these sequences instead of trees. Sasha wants to match each tree with a sequence *a*0,<=*a*1,<=...,<=*a**h*, where *h* is the height of the tree, and *a**i* equals to the number of vertices that are at distance of *i* edges from root.
Unfortunately, this time Sasha's intuition was wrong, and there could be several trees matching the same sequence. To show it, you need to write a program that, given the sequence *a**i*, builds two non-isomorphic rooted trees that match that sequence, or determines that there is only one such tree.
Two rooted trees are isomorphic, if you can reenumerate the vertices of the first one in such a way, that the index of the root becomes equal the index of the root of the second tree, and these two trees become equal.
The height of a rooted tree is the maximum number of edges on a path from the root to any other vertex. | The first line contains a single integer *h* (2<=≤<=*h*<=≤<=105) — the height of the tree.
The second line contains *h*<=+<=1 integers — the sequence *a*0,<=*a*1,<=...,<=*a**h* (1<=≤<=*a**i*<=≤<=2·105). The sum of all *a**i* does not exceed 2·105. It is guaranteed that there is at least one tree matching this sequence. | If there is only one tree matching this sequence, print "perfect".
Otherwise print "ambiguous" in the first line. In the second and in the third line print descriptions of two trees in the following format: in one line print integers, the *k*-th of them should be the parent of vertex *k* or be equal to zero, if the *k*-th vertex is the root.
These treese should be non-isomorphic and should match the given sequence. | [
"2\n1 1 1\n",
"2\n1 2 2\n"
] | [
"perfect\n",
"ambiguous\n0 1 1 3 3\n0 1 1 3 2\n"
] | The only tree in the first example and the two printed trees from the second example are shown on the picture:
<img class="tex-graphics" src="https://espresso.codeforces.com/ae5d1889e09854f9d8ad6e29ab7afbe690ca4702.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 0 | [
{
"input": "2\n1 1 1",
"output": "perfect"
},
{
"input": "2\n1 2 2",
"output": "ambiguous\n0 1 1 3 3\n0 1 1 3 2"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1 1",
"output": "perfect"
},
{
"input": "10\n1 1 1 1 1 2 1 1 1 1 1",
"output": "perfect"
},
{
"input": "10\n1 1 1 1 2 2 1 1 1 1 1",
"output": "ambiguous\n0 1 2 3 4 4 6 6 8 9 10 11 12\n0 1 2 3 4 4 6 5 8 9 10 11 12"
},
{
"input": "10\n1 1 1 1 1 1 1 2 1 1 2",
"output": "perfect"
},
{
"input": "10\n1 1 1 3 2 1 2 4 1 3 1",
"output": "ambiguous\n0 1 2 3 3 3 6 6 8 9 9 11 11 11 11 15 16 16 16 19\n0 1 2 3 3 3 6 5 8 9 9 11 10 10 10 15 16 16 16 19"
},
{
"input": "10\n1 1 1 4 1 1 2 1 5 1 2",
"output": "perfect"
},
{
"input": "10\n1 1 11 12 12 11 15 13 8 8 8",
"output": "ambiguous\n0 1 2 2 2 2 2 2 2 2 2 2 2 13 13 13 13 13 13 13 13 13 13 13 13 25 25 25 25 25 25 25 25 25 25 25 25 37 37 37 37 37 37 37 37 37 37 37 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 63 63 63 63 63 63 63 63 63 63 63 63 63 76 76 76 76 76 76 76 76 84 84 84 84 84 84 84 84 92 92 92 92 92 92 92 92\n0 1 2 2 2 2 2 2 2 2 2 2 2 13 12 12 12 12 12 12 12 12 12 12 12 25 24 24 24 24 24 24 24 24 24 24 24 37 36 36 36 36 36 36 36 36 36 36 48 47 47 47 47 47 47 47 47 47 47 47 47 47 47 63 62 62 62 62 62 62 62 62 62 62 62 ..."
},
{
"input": "10\n1 1 21 1 20 1 14 1 19 1 20",
"output": "perfect"
},
{
"input": "10\n1 1 93 121 112 103 114 112 112 122 109",
"output": "ambiguous\n0 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 9..."
},
{
"input": "10\n1 1 262 1 232 1 245 1 1 254 1",
"output": "perfect"
},
{
"input": "2\n1 1 199998",
"output": "perfect"
},
{
"input": "3\n1 1 199997 1",
"output": "perfect"
},
{
"input": "3\n1 1 100009 99989",
"output": "ambiguous\n0 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "123\n1 1 1 3714 1 3739 1 3720 1 1 3741 1 1 3726 1 3836 1 3777 1 1 3727 1 1 3866 1 3799 1 3785 1 3693 1 1 3667 1 3930 1 3849 1 1 3767 1 3792 1 3792 1 3808 1 3680 1 3798 1 3817 1 3636 1 3833 1 1 3765 1 3774 1 3747 1 1 3897 1 3773 1 3814 1 3739 1 1 3852 1 3759 1 3783 1 1 3836 1 3787 1 3752 1 1 3818 1 3794 1 3745 1 3785 1 3784 1 1 3765 1 3750 1 3690 1 1 3806 1 3781 1 3680 1 1 3748 1 3709 1 3793 1 3618 1 1 3893 1",
"output": "perfect"
},
{
"input": "13\n1 1 16677 16757 16710 16596 16512 16762 16859 16750 16658 16489 16594 16634",
"output": "ambiguous\n0 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "13\n1 1 40049 1 1 39777 1 1 40008 1 40060 1 40097 1",
"output": "perfect"
},
{
"input": "4\n1 2 1 2 2",
"output": "ambiguous\n0 1 1 3 4 4 6 6\n0 1 1 3 4 4 6 5"
},
{
"input": "16\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536",
"output": "ambiguous\n0 1 1 3 3 3 3 7 7 7 7 7 7 7 7 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 15 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 31 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 63 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 127 12..."
},
{
"input": "4\n1 2 1 2 3",
"output": "ambiguous\n0 1 1 3 4 4 6 6 6\n0 1 1 3 4 4 6 5 5"
},
{
"input": "2\n1 3 199969",
"output": "ambiguous\n0 1 1 1 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 ..."
},
{
"input": "2\n1 99999 99999",
"output": "ambiguous\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ..."
},
{
"input": "2\n1 3 2",
"output": "ambiguous\n0 1 1 1 4 4\n0 1 1 1 4 3"
}
] | 1,513,783,255 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 46 | 5,529,600 | n=int(input())
m=[]
p=list(map(int,input().split()))
if max(p[:-1])>1:
print('ambiguous')
x=1
z=0
s=['0']
for i in range(1,n+1):
a=x
for j in range(p[i]):
s.append(str(a))
x+=1
if p[i]>1 and not z:
z=len(s)+1
zx=x-1
print(' '.join(s))
s[z]=str(zx)
print(' '.join(s))
else:
print('perfect') | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sasha is taking part in a programming competition. In one of the problems she should check if some rooted trees are isomorphic or not. She has never seen this problem before, but, being an experienced participant, she guessed that she should match trees to some sequences and then compare these sequences instead of trees. Sasha wants to match each tree with a sequence *a*0,<=*a*1,<=...,<=*a**h*, where *h* is the height of the tree, and *a**i* equals to the number of vertices that are at distance of *i* edges from root.
Unfortunately, this time Sasha's intuition was wrong, and there could be several trees matching the same sequence. To show it, you need to write a program that, given the sequence *a**i*, builds two non-isomorphic rooted trees that match that sequence, or determines that there is only one such tree.
Two rooted trees are isomorphic, if you can reenumerate the vertices of the first one in such a way, that the index of the root becomes equal the index of the root of the second tree, and these two trees become equal.
The height of a rooted tree is the maximum number of edges on a path from the root to any other vertex.
Input Specification:
The first line contains a single integer *h* (2<=≤<=*h*<=≤<=105) — the height of the tree.
The second line contains *h*<=+<=1 integers — the sequence *a*0,<=*a*1,<=...,<=*a**h* (1<=≤<=*a**i*<=≤<=2·105). The sum of all *a**i* does not exceed 2·105. It is guaranteed that there is at least one tree matching this sequence.
Output Specification:
If there is only one tree matching this sequence, print "perfect".
Otherwise print "ambiguous" in the first line. In the second and in the third line print descriptions of two trees in the following format: in one line print integers, the *k*-th of them should be the parent of vertex *k* or be equal to zero, if the *k*-th vertex is the root.
These treese should be non-isomorphic and should match the given sequence.
Demo Input:
['2\n1 1 1\n', '2\n1 2 2\n']
Demo Output:
['perfect\n', 'ambiguous\n0 1 1 3 3\n0 1 1 3 2\n']
Note:
The only tree in the first example and the two printed trees from the second example are shown on the picture:
<img class="tex-graphics" src="https://espresso.codeforces.com/ae5d1889e09854f9d8ad6e29ab7afbe690ca4702.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
n=int(input())
m=[]
p=list(map(int,input().split()))
if max(p[:-1])>1:
print('ambiguous')
x=1
z=0
s=['0']
for i in range(1,n+1):
a=x
for j in range(p[i]):
s.append(str(a))
x+=1
if p[i]>1 and not z:
z=len(s)+1
zx=x-1
print(' '.join(s))
s[z]=str(zx)
print(' '.join(s))
else:
print('perfect')
``` | 0 |
|
1,004 | B | Sonya and Exhibition | PROGRAMMING | 1,300 | [
"constructive algorithms",
"greedy",
"implementation",
"math"
] | null | null | Sonya decided to organize an exhibition of flowers. Since the girl likes only roses and lilies, she decided that only these two kinds of flowers should be in this exhibition.
There are $n$ flowers in a row in the exhibition. Sonya can put either a rose or a lily in the $i$-th position. Thus each of $n$ positions should contain exactly one flower: a rose or a lily.
She knows that exactly $m$ people will visit this exhibition. The $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive. The girl knows that each segment has its own beauty that is equal to the product of the number of roses and the number of lilies.
Sonya wants her exhibition to be liked by a lot of people. That is why she wants to put the flowers in such way that the sum of beauties of all segments would be maximum possible. | The first line contains two integers $n$ and $m$ ($1\leq n, m\leq 10^3$) — the number of flowers and visitors respectively.
Each of the next $m$ lines contains two integers $l_i$ and $r_i$ ($1\leq l_i\leq r_i\leq n$), meaning that $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive. | Print the string of $n$ characters. The $i$-th symbol should be «0» if you want to put a rose in the $i$-th position, otherwise «1» if you want to put a lily.
If there are multiple answers, print any. | [
"5 3\n1 3\n2 4\n2 5\n",
"6 3\n5 6\n1 4\n4 6\n"
] | [
"01100",
"110010"
] | In the first example, Sonya can put roses in the first, fourth, and fifth positions, and lilies in the second and third positions;
- in the segment $[1\ldots3]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots4]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots5]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$.
The total beauty is equal to $2+2+4=8$.
In the second example, Sonya can put roses in the third, fourth, and sixth positions, and lilies in the first, second, and fifth positions;
- in the segment $[5\ldots6]$, there are one rose and one lily, so the beauty is equal to $1\cdot 1=1$; - in the segment $[1\ldots4]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$; - in the segment $[4\ldots6]$, there are two roses and one lily, so the beauty is equal to $2\cdot 1=2$.
The total beauty is equal to $1+4+2=7$. | 1,000 | [
{
"input": "5 3\n1 3\n2 4\n2 5",
"output": "01010"
},
{
"input": "6 3\n5 6\n1 4\n4 6",
"output": "010101"
},
{
"input": "10 4\n3 3\n1 6\n9 9\n10 10",
"output": "0101010101"
},
{
"input": "1 1\n1 1",
"output": "0"
},
{
"input": "1000 10\n3 998\n2 1000\n1 999\n2 1000\n3 998\n2 1000\n3 998\n1 1000\n2 1000\n3 999",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 20\n50 109\n317 370\n710 770\n440 488\n711 757\n236 278\n314 355\n131 190\n115 162\n784 834\n16 56\n677 730\n802 844\n632 689\n23 74\n647 702\n930 986\n926 983\n769 822\n508 558",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 10\n138 238\n160 260\n716 816\n504 604\n98 198\n26 126\n114 214\n217 317\n121 221\n489 589",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 5\n167 296\n613 753\n650 769\n298 439\n71 209",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "1000 5\n349 415\n714 773\n125 179\n1 80\n148 242",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "914 10\n587 646\n770 843\n825 875\n439 485\n465 521\n330 387\n405 480\n477 521\n336 376\n715 771",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "571 10\n13 94\n450 510\n230 293\n302 375\n304 354\n421 504\n24 87\n122 181\n221 296\n257 307",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "6 2\n1 6\n1 4",
"output": "010101"
},
{
"input": "2 1\n1 2",
"output": "01"
}
] | 1,530,813,810 | 5,310 | Python 3 | WRONG_ANSWER | PRETESTS | 3 | 108 | 0 | n,m = map(int,input().split())
a = ['0']*(n+1)
f = [1]*(n+1)
for _ in range(m):
l,r = map(int,input().split())
c0 = a[l:r+1].count('0')
c1 = a[l:r+1].count('1')
#print(c0,c1)
if(c0>c1):
x = c0-c1
x = x//2
c = 0
for i in range(l,r+1):
if(a[i]=='0' and c<x and f[i]):
a[i]='1'
c+=1
for i in range(l,r+1):
f[i] = 0
elif(c0<c1):
x = c1-c0
x = x//2
c = 0
for i in range(l,r+1):
if(a[i]=='1' and c<x and f[i]):
a[i]='0'
c+=1
for i in range(l,r+1):
f[i] = 0
print(''.join(a[1:]))
| Title: Sonya and Exhibition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided to organize an exhibition of flowers. Since the girl likes only roses and lilies, she decided that only these two kinds of flowers should be in this exhibition.
There are $n$ flowers in a row in the exhibition. Sonya can put either a rose or a lily in the $i$-th position. Thus each of $n$ positions should contain exactly one flower: a rose or a lily.
She knows that exactly $m$ people will visit this exhibition. The $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive. The girl knows that each segment has its own beauty that is equal to the product of the number of roses and the number of lilies.
Sonya wants her exhibition to be liked by a lot of people. That is why she wants to put the flowers in such way that the sum of beauties of all segments would be maximum possible.
Input Specification:
The first line contains two integers $n$ and $m$ ($1\leq n, m\leq 10^3$) — the number of flowers and visitors respectively.
Each of the next $m$ lines contains two integers $l_i$ and $r_i$ ($1\leq l_i\leq r_i\leq n$), meaning that $i$-th visitor will visit all flowers from $l_i$ to $r_i$ inclusive.
Output Specification:
Print the string of $n$ characters. The $i$-th symbol should be «0» if you want to put a rose in the $i$-th position, otherwise «1» if you want to put a lily.
If there are multiple answers, print any.
Demo Input:
['5 3\n1 3\n2 4\n2 5\n', '6 3\n5 6\n1 4\n4 6\n']
Demo Output:
['01100', '110010']
Note:
In the first example, Sonya can put roses in the first, fourth, and fifth positions, and lilies in the second and third positions;
- in the segment $[1\ldots3]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots4]$, there are one rose and two lilies, so the beauty is equal to $1\cdot 2=2$; - in the segment $[2\ldots5]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$.
The total beauty is equal to $2+2+4=8$.
In the second example, Sonya can put roses in the third, fourth, and sixth positions, and lilies in the first, second, and fifth positions;
- in the segment $[5\ldots6]$, there are one rose and one lily, so the beauty is equal to $1\cdot 1=1$; - in the segment $[1\ldots4]$, there are two roses and two lilies, so the beauty is equal to $2\cdot 2=4$; - in the segment $[4\ldots6]$, there are two roses and one lily, so the beauty is equal to $2\cdot 1=2$.
The total beauty is equal to $1+4+2=7$. | ```python
n,m = map(int,input().split())
a = ['0']*(n+1)
f = [1]*(n+1)
for _ in range(m):
l,r = map(int,input().split())
c0 = a[l:r+1].count('0')
c1 = a[l:r+1].count('1')
#print(c0,c1)
if(c0>c1):
x = c0-c1
x = x//2
c = 0
for i in range(l,r+1):
if(a[i]=='0' and c<x and f[i]):
a[i]='1'
c+=1
for i in range(l,r+1):
f[i] = 0
elif(c0<c1):
x = c1-c0
x = x//2
c = 0
for i in range(l,r+1):
if(a[i]=='1' and c<x and f[i]):
a[i]='0'
c+=1
for i in range(l,r+1):
f[i] = 0
print(''.join(a[1:]))
``` | 0 |
|
466 | C | Number of Ways | PROGRAMMING | 1,700 | [
"binary search",
"brute force",
"data structures",
"dp",
"two pointers"
] | null | null | You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same.
More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that . | The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*. | Print a single integer — the number of ways to split the array into three parts with the same sum. | [
"5\n1 2 3 0 3\n",
"4\n0 1 -1 0\n",
"2\n4 1\n"
] | [
"2\n",
"1\n",
"0\n"
] | none | 1,500 | [
{
"input": "5\n1 2 3 0 3",
"output": "2"
},
{
"input": "4\n0 1 -1 0",
"output": "1"
},
{
"input": "2\n4 1",
"output": "0"
},
{
"input": "9\n0 0 0 0 0 0 0 0 0",
"output": "28"
},
{
"input": "10\n2 5 -2 2 -3 -2 3 5 -5 -2",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "0"
},
{
"input": "100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "2030"
},
{
"input": "6\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "10\n1 0 0 0 1 1 1 0 1 1",
"output": "2"
},
{
"input": "10\n-2 2 -2 0 -2 -1 1 -1 2 0",
"output": "0"
},
{
"input": "4\n0 2 -1 2",
"output": "0"
},
{
"input": "5\n3 3 -3 3 3",
"output": "3"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "8\n-1 -1 -1 -1 -1 -1 -1 -1",
"output": "0"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "4\n1 -1 0 0",
"output": "1"
},
{
"input": "3\n6 -3 6",
"output": "0"
}
] | 1,699,352,910 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 577 | 62,464,000 | n=int(input())
a=[int(i) for i in input().split()]
s=sum(a)
s1=0
ai=[0]*500001
for i in range(n-1):
s1+=a[i]
if s1==s/3:
ai[i]=1
s2=0
aj=[]
for j in range(n-1):
s2+=a[n-j-1]
if s2==s/3:
aj.append(n-j-2)
for i in range(1,n):
ai[i]+=ai[i-1]
num=0
for j in range(len(aj)):
num+=ai[aj[j]-1]
print(num)
| Title: Number of Ways
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same.
More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that .
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*.
Output Specification:
Print a single integer — the number of ways to split the array into three parts with the same sum.
Demo Input:
['5\n1 2 3 0 3\n', '4\n0 1 -1 0\n', '2\n4 1\n']
Demo Output:
['2\n', '1\n', '0\n']
Note:
none | ```python
n=int(input())
a=[int(i) for i in input().split()]
s=sum(a)
s1=0
ai=[0]*500001
for i in range(n-1):
s1+=a[i]
if s1==s/3:
ai[i]=1
s2=0
aj=[]
for j in range(n-1):
s2+=a[n-j-1]
if s2==s/3:
aj.append(n-j-2)
for i in range(1,n):
ai[i]+=ai[i-1]
num=0
for j in range(len(aj)):
num+=ai[aj[j]-1]
print(num)
``` | 3 |
|
27 | C | Unordered Subsequence | PROGRAMMING | 1,900 | [
"constructive algorithms",
"greedy"
] | C. Unordered Subsequence | 2 | 256 | The sequence is called ordered if it is non-decreasing or non-increasing. For example, sequnces [3, 1, 1, 0] and [1, 2, 3, 100] are ordered, but the sequence [1, 3, 3, 1] is not. You are given a sequence of numbers. You are to find it's shortest subsequence which is not ordered.
A subsequence is a sequence that can be derived from the given sequence by deleting zero or more elements without changing the order of the remaining elements. | The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers — the given sequence. All numbers in this sequence do not exceed 106 by absolute value. | If the given sequence does not contain any unordered subsequences, output 0. Otherwise, output the length *k* of the shortest such subsequence. Then output *k* integers from the range [1..*n*] — indexes of the elements of this subsequence. If there are several solutions, output any of them. | [
"5\n67 499 600 42 23\n",
"3\n1 2 3\n",
"3\n2 3 1\n"
] | [
"3\n1 3 5\n",
"0\n",
"3\n1 2 3\n"
] | none | 1,500 | [
{
"input": "3\n3 1 2",
"output": "3\n1 2 3"
},
{
"input": "1\n-895376",
"output": "0"
},
{
"input": "2\n166442 61629",
"output": "0"
},
{
"input": "3\n-771740 -255752 -300809",
"output": "3\n1 2 3"
},
{
"input": "4\n-227347 -573134 -671045 11011",
"output": "3\n2 3 4"
},
{
"input": "5\n834472 -373089 441294 -633071 -957672",
"output": "3\n1 2 3"
},
{
"input": "2\n7 8",
"output": "0"
}
] | 1,554,039,572 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 1 | 218 | 0 | #!/usr/bin/env python3
n = int(input())
a = list(map(int, input().split()))
# Find the earliest number that differs from the first
first_different = 0
while ((first_different < n) and (a[first_different] == a[0])):
first_different+=1
if (first_different == n):
# All numbers in the sequence are the same
print(0)
exit
# Find an inflection point
descending = a[first_different] < a[0]
inflection_point = first_different
while ((inflection_point < n) and \
((descending and (a[inflection_point] <= a[inflection_point-1])) or \
((not descending) and (a[inflection_point] >= a[inflection_point-1])))):
inflection_point +=1
if (inflection_point != n):
print(3)
print("%d %d %d" % (1, inflection_point, inflection_point+1))
else:
print(0) | Title: Unordered Subsequence
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The sequence is called ordered if it is non-decreasing or non-increasing. For example, sequnces [3, 1, 1, 0] and [1, 2, 3, 100] are ordered, but the sequence [1, 3, 3, 1] is not. You are given a sequence of numbers. You are to find it's shortest subsequence which is not ordered.
A subsequence is a sequence that can be derived from the given sequence by deleting zero or more elements without changing the order of the remaining elements.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* space-separated integers — the given sequence. All numbers in this sequence do not exceed 106 by absolute value.
Output Specification:
If the given sequence does not contain any unordered subsequences, output 0. Otherwise, output the length *k* of the shortest such subsequence. Then output *k* integers from the range [1..*n*] — indexes of the elements of this subsequence. If there are several solutions, output any of them.
Demo Input:
['5\n67 499 600 42 23\n', '3\n1 2 3\n', '3\n2 3 1\n']
Demo Output:
['3\n1 3 5\n', '0\n', '3\n1 2 3\n']
Note:
none | ```python
#!/usr/bin/env python3
n = int(input())
a = list(map(int, input().split()))
# Find the earliest number that differs from the first
first_different = 0
while ((first_different < n) and (a[first_different] == a[0])):
first_different+=1
if (first_different == n):
# All numbers in the sequence are the same
print(0)
exit
# Find an inflection point
descending = a[first_different] < a[0]
inflection_point = first_different
while ((inflection_point < n) and \
((descending and (a[inflection_point] <= a[inflection_point-1])) or \
((not descending) and (a[inflection_point] >= a[inflection_point-1])))):
inflection_point +=1
if (inflection_point != n):
print(3)
print("%d %d %d" % (1, inflection_point, inflection_point+1))
else:
print(0)
``` | -1 |
208 | A | Dubstep | PROGRAMMING | 900 | [
"strings"
] | null | null | Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. | The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. | Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. | [
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] | [
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] | In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | 500 | [
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,689,066,052 | 2,147,483,647 | Python 3 | OK | TESTS | 71 | 92 | 0 | s=input()
s=s.replace("WUB"," ")
ans=""
for i in s.split():
if(i!=" "):
ans=ans+i+" "
print(ans) | Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | ```python
s=input()
s=s.replace("WUB"," ")
ans=""
for i in s.split():
if(i!=" "):
ans=ans+i+" "
print(ans)
``` | 3 |
|
357 | B | Flag Day | PROGRAMMING | 1,400 | [
"constructive algorithms",
"implementation"
] | null | null | In Berland, there is the national holiday coming — the Flag Day. In the honor of this event the president of the country decided to make a big dance party and asked your agency to organize it. He has several conditions:
- overall, there must be *m* dances;- exactly three people must take part in each dance;- each dance must have one dancer in white clothes, one dancer in red clothes and one dancer in blue clothes (these are the colors of the national flag of Berland).
The agency has *n* dancers, and their number can be less than 3*m*. That is, some dancers will probably have to dance in more than one dance. All of your dancers must dance on the party. However, if some dance has two or more dancers from a previous dance, then the current dance stops being spectacular. Your agency cannot allow that to happen, so each dance has at most one dancer who has danced in some previous dance.
You considered all the criteria and made the plan for the *m* dances: each dance had three dancers participating in it. Your task is to determine the clothes color for each of the *n* dancers so that the President's third condition fulfilled: each dance must have a dancer in white, a dancer in red and a dancer in blue. The dancers cannot change clothes between the dances. | The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=105) and *m* (1<=≤<=*m*<=≤<=105) — the number of dancers and the number of dances, correspondingly. Then *m* lines follow, describing the dances in the order of dancing them. The *i*-th line contains three distinct integers — the numbers of the dancers that take part in the *i*-th dance. The dancers are numbered from 1 to *n*. Each dancer takes part in at least one dance. | Print *n* space-separated integers: the *i*-th number must represent the color of the *i*-th dancer's clothes (1 for white, 2 for red, 3 for blue). If there are multiple valid solutions, print any of them. It is guaranteed that at least one solution exists. | [
"7 3\n1 2 3\n1 4 5\n4 6 7\n",
"9 3\n3 6 9\n2 5 8\n1 4 7\n",
"5 2\n4 1 5\n3 1 2\n"
] | [
"1 2 3 3 2 2 1 \n",
"1 1 1 2 2 2 3 3 3 \n",
"2 3 1 1 3 \n"
] | none | 1,000 | [
{
"input": "7 3\n1 2 3\n1 4 5\n4 6 7",
"output": "1 2 3 3 2 2 1 "
},
{
"input": "9 3\n3 6 9\n2 5 8\n1 4 7",
"output": "1 1 1 2 2 2 3 3 3 "
},
{
"input": "5 2\n4 1 5\n3 1 2",
"output": "2 3 1 1 3 "
},
{
"input": "14 5\n1 5 3\n13 10 11\n6 3 8\n14 9 2\n7 4 12",
"output": "1 3 3 2 2 2 1 1 2 2 3 3 1 1 "
},
{
"input": "14 6\n14 3 13\n10 14 5\n6 2 10\n7 13 9\n12 11 8\n1 4 9",
"output": "2 2 2 3 2 1 2 3 1 3 2 1 3 1 "
},
{
"input": "14 6\n11 13 10\n3 10 14\n2 7 12\n13 1 9\n5 11 4\n8 6 5",
"output": "1 1 2 2 3 2 2 1 3 3 1 3 2 1 "
},
{
"input": "13 5\n13 6 2\n13 3 8\n11 4 7\n10 9 5\n1 12 6",
"output": "3 3 3 2 3 2 3 2 2 1 1 1 1 "
},
{
"input": "14 6\n5 4 8\n5 7 12\n3 6 12\n7 11 14\n10 13 2\n10 1 9",
"output": "3 3 3 2 1 1 3 3 2 1 2 2 2 1 "
},
{
"input": "14 5\n4 13 2\n7 2 11\n6 1 5\n14 12 8\n10 3 9",
"output": "2 3 2 1 3 1 2 3 3 1 1 2 2 1 "
},
{
"input": "14 6\n2 14 5\n3 4 5\n6 13 14\n7 13 12\n8 10 11\n9 6 1",
"output": "1 1 1 2 3 3 3 1 2 2 3 2 1 2 "
},
{
"input": "14 6\n7 14 12\n6 1 12\n13 5 2\n2 3 9\n7 4 11\n5 8 10",
"output": "2 3 2 3 2 1 1 1 1 3 2 3 1 2 "
},
{
"input": "13 6\n8 7 6\n11 7 3\n13 9 3\n12 1 13\n8 10 4\n2 7 5",
"output": "3 1 3 2 3 3 2 1 2 3 1 2 1 "
},
{
"input": "13 5\n8 4 3\n1 9 5\n6 2 11\n12 10 4\n7 10 13",
"output": "1 2 3 2 3 1 3 1 2 1 3 3 2 "
},
{
"input": "20 8\n16 19 12\n13 3 5\n1 5 17\n10 19 7\n8 18 2\n3 11 14\n9 20 12\n4 15 6",
"output": "2 3 2 1 3 3 3 1 1 1 1 3 1 3 2 1 1 2 2 2 "
},
{
"input": "19 7\n10 18 14\n5 9 11\n9 17 7\n3 15 4\n6 8 12\n1 2 18\n13 16 19",
"output": "3 1 1 3 1 1 3 2 2 1 3 3 1 3 2 2 1 2 3 "
},
{
"input": "18 7\n17 4 13\n7 1 6\n16 9 13\n9 2 5\n11 12 17\n14 8 10\n3 15 18",
"output": "2 1 1 2 3 3 1 2 2 3 2 3 3 1 2 1 1 3 "
},
{
"input": "20 7\n8 5 11\n3 19 20\n16 1 17\n9 6 2\n7 18 13\n14 12 18\n10 4 15",
"output": "2 3 1 2 2 2 1 1 1 1 3 1 3 3 3 1 3 2 2 3 "
},
{
"input": "20 7\n6 11 20\n19 5 2\n15 10 12\n3 7 8\n9 1 6\n13 17 18\n14 16 4",
"output": "3 3 1 3 2 1 2 3 2 2 2 3 1 1 1 2 2 3 1 3 "
},
{
"input": "18 7\n15 5 1\n6 11 4\n14 8 17\n11 12 13\n3 8 16\n9 4 7\n2 18 10",
"output": "3 1 1 3 2 1 1 2 2 3 2 1 3 1 1 3 3 2 "
},
{
"input": "19 7\n3 10 8\n17 7 4\n1 19 18\n2 9 5\n12 11 15\n11 14 6\n13 9 16",
"output": "1 1 1 3 3 3 2 3 2 2 2 1 1 1 3 3 1 3 2 "
},
{
"input": "19 7\n18 14 4\n3 11 6\n8 10 7\n10 19 16\n17 13 15\n5 1 14\n12 9 2",
"output": "1 3 1 3 3 3 3 1 2 2 2 1 2 2 3 3 1 1 1 "
},
{
"input": "20 7\n18 7 15\n17 5 20\n9 19 12\n16 13 10\n3 6 1\n3 8 11\n4 2 14",
"output": "3 2 1 1 2 2 2 3 1 3 2 3 2 3 3 1 1 1 2 3 "
},
{
"input": "18 7\n8 4 6\n13 17 3\n9 8 12\n12 16 5\n18 2 7\n11 1 10\n5 15 14",
"output": "2 2 3 2 3 3 3 1 3 3 1 2 1 1 2 1 2 1 "
},
{
"input": "99 37\n40 10 7\n10 3 5\n10 31 37\n87 48 24\n33 47 38\n34 87 2\n2 35 28\n99 28 76\n66 51 97\n72 77 9\n18 17 67\n23 69 98\n58 89 99\n42 44 52\n65 41 80\n70 92 74\n62 88 45\n68 27 61\n6 83 95\n39 85 49\n57 75 77\n59 54 81\n56 20 82\n96 4 53\n90 7 11\n16 43 84\n19 25 59\n68 8 93\n73 94 78\n15 71 79\n26 12 50\n30 32 4\n14 22 29\n46 21 36\n60 55 86\n91 8 63\n13 1 64",
"output": "2 2 1 2 3 1 3 3 3 2 1 2 1 1 1 1 2 1 2 2 2 2 1 3 3 1 2 3 3 3 1 1 1 3 1 3 3 3 1 1 2 1 2 2 3 1 2 2 3 3 2 3 3 2 2 1 3 3 1 1 3 1 1 3 1 1 3 1 2 1 2 1 1 3 1 1 2 3 3 3 3 3 2 3 2 3 1 2 1 2 2 2 2 2 3 1 3 3 2 "
},
{
"input": "99 41\n11 70 20\n57 11 76\n52 11 64\n49 70 15\n19 61 17\n71 77 21\n77 59 39\n37 64 68\n17 84 36\n46 11 90\n35 11 14\n36 25 80\n12 43 48\n18 78 42\n82 94 15\n22 10 84\n63 86 4\n98 86 50\n92 60 9\n73 42 65\n21 5 27\n30 24 23\n7 88 49\n40 97 45\n81 56 17\n79 61 33\n13 3 77\n54 6 28\n99 58 8\n29 95 24\n89 74 32\n51 89 66\n87 91 96\n22 34 38\n1 53 72\n55 97 26\n41 16 44\n2 31 47\n83 67 91\n75 85 69\n93 47 62",
"output": "1 1 1 3 2 2 2 3 3 1 1 1 3 2 3 2 3 1 1 3 3 3 3 2 3 3 1 3 3 1 2 3 3 2 3 1 1 1 3 1 1 3 2 3 3 3 3 3 1 3 3 3 2 1 1 2 3 2 1 2 2 1 1 2 1 2 1 3 3 2 1 3 2 2 1 2 2 2 1 2 1 1 3 2 2 2 1 3 1 2 2 1 2 2 1 3 2 1 1 "
},
{
"input": "99 38\n70 56 92\n61 70 68\n18 92 91\n82 43 55\n37 5 43\n47 27 26\n64 63 40\n20 61 57\n69 80 59\n60 89 50\n33 25 86\n38 15 73\n96 85 90\n3 12 64\n95 23 48\n66 30 9\n38 99 45\n67 88 71\n74 11 81\n28 51 79\n72 92 34\n16 77 31\n65 18 94\n3 41 2\n36 42 81\n22 77 83\n44 24 52\n10 75 97\n54 21 53\n4 29 32\n58 39 98\n46 62 16\n76 5 84\n8 87 13\n6 41 14\n19 21 78\n7 49 93\n17 1 35",
"output": "2 3 2 1 1 3 1 1 3 1 2 3 3 2 2 1 1 2 1 2 2 1 2 2 2 3 2 1 2 2 3 3 1 1 3 1 3 1 2 3 1 2 2 1 2 2 1 3 2 3 2 3 3 1 3 2 1 1 3 1 3 3 2 1 1 1 1 2 1 1 3 2 3 1 2 3 2 3 3 2 3 1 3 2 2 3 2 2 2 3 1 3 3 3 1 1 3 3 3 "
},
{
"input": "98 38\n70 23 73\n73 29 86\n93 82 30\n6 29 10\n7 22 78\n55 61 87\n98 2 12\n11 5 54\n44 56 60\n89 76 50\n37 72 43\n47 41 61\n85 40 38\n48 93 20\n90 64 29\n31 68 25\n83 57 41\n51 90 3\n91 97 66\n96 95 1\n50 84 71\n53 19 5\n45 42 28\n16 17 89\n63 58 15\n26 47 39\n21 24 19\n80 74 38\n14 46 75\n88 65 36\n77 92 33\n17 59 34\n35 69 79\n13 94 39\n8 52 4\n67 27 9\n65 62 18\n81 32 49",
"output": "3 2 1 3 2 1 1 1 3 3 1 3 2 1 3 2 3 3 1 2 2 2 2 3 3 2 2 3 2 3 1 2 3 1 1 3 1 3 1 2 1 2 3 1 1 2 3 3 3 3 2 2 3 3 1 2 3 2 2 3 2 1 1 1 2 3 1 2 2 1 1 2 3 2 3 2 1 3 3 1 1 2 2 2 1 1 3 1 1 3 1 2 1 3 2 1 2 1 "
},
{
"input": "99 42\n61 66 47\n10 47 96\n68 86 67\n21 29 10\n55 44 47\n12 82 4\n45 71 55\n86 3 95\n16 99 93\n14 92 82\n12 59 20\n73 24 8\n79 72 48\n44 87 39\n87 84 97\n47 70 37\n49 77 95\n39 75 28\n75 25 5\n44 41 36\n76 86 78\n73 6 90\n8 22 58\n9 72 63\n81 42 14\n1 21 35\n91 54 15\n30 13 39\n56 89 79\n11 2 76\n19 65 52\n23 85 74\n7 38 24\n57 94 81\n43 34 60\n62 82 27\n69 64 53\n18 32 17\n24 31 88\n51 50 33\n40 80 98\n83 46 26",
"output": "2 3 1 3 3 3 3 3 1 2 2 1 2 3 3 1 3 1 1 2 3 2 1 2 1 3 3 1 1 1 1 2 3 2 1 3 1 1 3 1 1 2 1 2 2 2 3 3 1 2 1 3 3 2 1 2 2 1 3 3 1 1 3 2 2 2 3 1 1 2 3 2 1 3 2 1 2 3 1 2 1 2 1 3 2 2 1 3 3 2 1 1 3 3 3 1 2 3 2 "
}
] | 1,634,918,954 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 61 | 4,505,600 | a,b = map(int, input().split())
p = [0]*(n+1)
for i in range(b):
c,d,e = map(int, input().split())
t = [p[c], p[d], p[e]]
if temp == [0,0,0]:
p[c] = 1
p[d] = 2
p[e] = 3
else:
r = list(set([1,2,3]) - set(t))
if p[a] == 0:
p[c] = r.pop()
print(*p[1:])
| Title: Flag Day
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland, there is the national holiday coming — the Flag Day. In the honor of this event the president of the country decided to make a big dance party and asked your agency to organize it. He has several conditions:
- overall, there must be *m* dances;- exactly three people must take part in each dance;- each dance must have one dancer in white clothes, one dancer in red clothes and one dancer in blue clothes (these are the colors of the national flag of Berland).
The agency has *n* dancers, and their number can be less than 3*m*. That is, some dancers will probably have to dance in more than one dance. All of your dancers must dance on the party. However, if some dance has two or more dancers from a previous dance, then the current dance stops being spectacular. Your agency cannot allow that to happen, so each dance has at most one dancer who has danced in some previous dance.
You considered all the criteria and made the plan for the *m* dances: each dance had three dancers participating in it. Your task is to determine the clothes color for each of the *n* dancers so that the President's third condition fulfilled: each dance must have a dancer in white, a dancer in red and a dancer in blue. The dancers cannot change clothes between the dances.
Input Specification:
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=105) and *m* (1<=≤<=*m*<=≤<=105) — the number of dancers and the number of dances, correspondingly. Then *m* lines follow, describing the dances in the order of dancing them. The *i*-th line contains three distinct integers — the numbers of the dancers that take part in the *i*-th dance. The dancers are numbered from 1 to *n*. Each dancer takes part in at least one dance.
Output Specification:
Print *n* space-separated integers: the *i*-th number must represent the color of the *i*-th dancer's clothes (1 for white, 2 for red, 3 for blue). If there are multiple valid solutions, print any of them. It is guaranteed that at least one solution exists.
Demo Input:
['7 3\n1 2 3\n1 4 5\n4 6 7\n', '9 3\n3 6 9\n2 5 8\n1 4 7\n', '5 2\n4 1 5\n3 1 2\n']
Demo Output:
['1 2 3 3 2 2 1 \n', '1 1 1 2 2 2 3 3 3 \n', '2 3 1 1 3 \n']
Note:
none | ```python
a,b = map(int, input().split())
p = [0]*(n+1)
for i in range(b):
c,d,e = map(int, input().split())
t = [p[c], p[d], p[e]]
if temp == [0,0,0]:
p[c] = 1
p[d] = 2
p[e] = 3
else:
r = list(set([1,2,3]) - set(t))
if p[a] == 0:
p[c] = r.pop()
print(*p[1:])
``` | -1 |
|
716 | A | Crazy Computer | PROGRAMMING | 800 | [
"implementation"
] | null | null | ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. | The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. | Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. | [
"6 5\n1 3 8 14 19 20\n",
"6 1\n1 3 5 7 9 10\n"
] | [
"3",
"2"
] | The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1. | 500 | [
{
"input": "6 5\n1 3 8 14 19 20",
"output": "3"
},
{
"input": "6 1\n1 3 5 7 9 10",
"output": "2"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 7 12 13 14",
"output": "4"
},
{
"input": "2 1000000000\n1 1000000000",
"output": "2"
},
{
"input": "3 5\n1 10 20",
"output": "1"
},
{
"input": "3 10\n1 2 3",
"output": "3"
},
{
"input": "2 1\n1 100",
"output": "1"
},
{
"input": "3 1\n1 2 10",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
}
] | 1,572,554,170 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 140 | 0 | # cf 716 A 800
n, c = map(int, input().split())
A = [*map(int, input().split())]
ans = 0
for i in range(len(A)):
if i == 0:
ans += 1
elif A[i] - A[i - 1] <= c:
ans += 1
else:
ans = 0
print(ans + 1)
| Title: Crazy Computer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Output Specification:
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
Demo Input:
['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n']
Demo Output:
['3', '2']
Note:
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1. | ```python
# cf 716 A 800
n, c = map(int, input().split())
A = [*map(int, input().split())]
ans = 0
for i in range(len(A)):
if i == 0:
ans += 1
elif A[i] - A[i - 1] <= c:
ans += 1
else:
ans = 0
print(ans + 1)
``` | 0 |
|
312 | B | Archer | PROGRAMMING | 1,300 | [
"math",
"probabilities"
] | null | null | SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner.
Output the probability that SmallR will win the match. | A single line contains four integers . | Print a single real number, the probability that SmallR will win the match.
The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6. | [
"1 2 1 2\n"
] | [
"0.666666666667"
] | none | 1,000 | [
{
"input": "1 2 1 2",
"output": "0.666666666667"
},
{
"input": "1 3 1 3",
"output": "0.600000000000"
},
{
"input": "1 3 2 3",
"output": "0.428571428571"
},
{
"input": "3 4 3 4",
"output": "0.800000000000"
},
{
"input": "1 2 10 11",
"output": "0.523809523810"
},
{
"input": "4 5 4 5",
"output": "0.833333333333"
},
{
"input": "466 701 95 721",
"output": "0.937693791148"
},
{
"input": "268 470 444 885",
"output": "0.725614009325"
},
{
"input": "632 916 713 821",
"output": "0.719292895126"
},
{
"input": "269 656 918 992",
"output": "0.428937461623"
},
{
"input": "71 657 187 695",
"output": "0.310488463257"
},
{
"input": "435 852 973 978",
"output": "0.511844133157"
},
{
"input": "518 816 243 359",
"output": "0.719734031025"
},
{
"input": "882 962 311 811",
"output": "0.966386645447"
},
{
"input": "684 774 580 736",
"output": "0.906051574446"
},
{
"input": "486 868 929 999",
"output": "0.577723252958"
},
{
"input": "132 359 996 998",
"output": "0.368154532345"
},
{
"input": "933 977 266 450",
"output": "0.972879407907"
},
{
"input": "298 833 615 872",
"output": "0.441270817024"
},
{
"input": "34 554 14 958",
"output": "0.817324099167"
},
{
"input": "836 934 800 905",
"output": "0.906105535462"
},
{
"input": "482 815 69 509",
"output": "0.914365577772"
},
{
"input": "284 423 137 521",
"output": "0.885974839378"
},
{
"input": "648 881 486 703",
"output": "0.800911421248"
},
{
"input": "450 885 755 836",
"output": "0.533901011176"
},
{
"input": "533 773 823 998",
"output": "0.729222130525"
},
{
"input": "897 957 92 898",
"output": "0.993193806364"
},
{
"input": "699 925 441 928",
"output": "0.866816866175"
},
{
"input": "64 704 148 603",
"output": "0.289486317811"
},
{
"input": "719 735 626 990",
"output": "0.986124079764"
},
{
"input": "1 1000 1 1000",
"output": "0.500250125063"
}
] | 1,612,695,630 | 2,147,483,647 | PyPy 3 | OK | TESTS | 31 | 171 | 3,993,600 | import sys
input=sys.stdin.readline
from collections import defaultdict as dc
from collections import Counter
from bisect import bisect_right, bisect_left
import math
from operator import itemgetter
from heapq import heapify, heappop, heappush
from queue import PriorityQueue as pq
a,b,c,d=map(int,input().split())
x,y=a/b,c/d
z=(1-x)*(1-y)
s=1/(1-z)
print(x*s) | Title: Archer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner.
Output the probability that SmallR will win the match.
Input Specification:
A single line contains four integers .
Output Specification:
Print a single real number, the probability that SmallR will win the match.
The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
Demo Input:
['1 2 1 2\n']
Demo Output:
['0.666666666667']
Note:
none | ```python
import sys
input=sys.stdin.readline
from collections import defaultdict as dc
from collections import Counter
from bisect import bisect_right, bisect_left
import math
from operator import itemgetter
from heapq import heapify, heappop, heappush
from queue import PriorityQueue as pq
a,b,c,d=map(int,input().split())
x,y=a/b,c/d
z=(1-x)*(1-y)
s=1/(1-z)
print(x*s)
``` | 3 |
|
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
] | A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] | [
"word\nl10n\ni18n\np43s\n"
] | none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,677,430,381 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 31 | 0 | while True:
n = str(input())
x = 0
if len(n) > 10:
x = len(n)-2
print(str(n[0])+str(x)+str(n[len(n)-1:len(n)]))
else:
print(n) | Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
while True:
n = str(input())
x = 0
if len(n) > 10:
x = len(n)-2
print(str(n[0])+str(x)+str(n[len(n)-1:len(n)]))
else:
print(n)
``` | -1 |
52 | A | 123-sequence | PROGRAMMING | 900 | [
"implementation"
] | A. 123-sequence | 2 | 256 | There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3). | Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal. | [
"9\n1 3 2 2 2 1 1 2 3\n"
] | [
"5\n"
] | In the example all the numbers equal to 1 and 3 should be replaced by 2. | 500 | [
{
"input": "9\n1 3 2 2 2 1 1 2 3",
"output": "5"
},
{
"input": "6\n3 3 2 2 1 3",
"output": "3"
},
{
"input": "12\n3 1 3 1 2 1 3 2 2 1 2 1",
"output": "7"
},
{
"input": "15\n3 2 1 1 1 1 3 2 2 3 3 1 2 3 2",
"output": "10"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n3 2",
"output": "1"
},
{
"input": "2\n3 1",
"output": "1"
},
{
"input": "18\n2 3 2 1 2 3 2 1 2 3 3 3 1 2 3 3 3 2",
"output": "10"
},
{
"input": "30\n2 1 3 2 3 2 2 2 2 3 2 2 3 2 1 1 3 1 3 2 1 2 3 1 1 3 3 1 3 1",
"output": "19"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
}
] | 1,596,642,434 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 5 | 280 | 20,172,800 | n=int(input())
l=[int(x) for x in input().split()]
one=l.count(1)
two=l.count(2)
three=l.count(3)
if three>one and three>two:
print(n-three)
elif two>three and two>one:
print(n-two)
elif one>two and one>three:
print(n-one)
elif one==two and two==three:
print(n-one)
elif one==two and one>three:
print(n-one)
elif one==three and one>two:
print(n-one)
elif two==three and two>one:
print(n-one) | Title: 123-sequence
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a given sequence of integers *a*1,<=*a*2,<=...,<=*a**n*, where every number is from 1 to 3 inclusively. You have to replace the minimum number of numbers in it so that all the numbers in the sequence are equal to each other.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106). The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3).
Output Specification:
Print the minimum number of replacements needed to be performed to make all the numbers in the sequence equal.
Demo Input:
['9\n1 3 2 2 2 1 1 2 3\n']
Demo Output:
['5\n']
Note:
In the example all the numbers equal to 1 and 3 should be replaced by 2. | ```python
n=int(input())
l=[int(x) for x in input().split()]
one=l.count(1)
two=l.count(2)
three=l.count(3)
if three>one and three>two:
print(n-three)
elif two>three and two>one:
print(n-two)
elif one>two and one>three:
print(n-one)
elif one==two and two==three:
print(n-one)
elif one==two and one>three:
print(n-one)
elif one==three and one>two:
print(n-one)
elif two==three and two>one:
print(n-one)
``` | 0 |
660 | A | Co-prime Array | PROGRAMMING | 1,200 | [
"greedy",
"implementation",
"math",
"number theory"
] | null | null | You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1. | The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*. | Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them. | [
"3\n2 7 28\n"
] | [
"1\n2 7 9 28\n"
] | none | 0 | [
{
"input": "3\n2 7 28",
"output": "1\n2 7 1 28"
},
{
"input": "1\n1",
"output": "0\n1"
},
{
"input": "1\n548",
"output": "0\n548"
},
{
"input": "1\n963837006",
"output": "0\n963837006"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0\n1 1 1 1 1 1 1 1 1 1"
},
{
"input": "10\n26 723 970 13 422 968 875 329 234 983",
"output": "2\n26 723 970 13 422 1 968 875 1 329 234 983"
},
{
"input": "10\n319645572 758298525 812547177 459359946 355467212 304450522 807957797 916787906 239781206 242840396",
"output": "7\n319645572 1 758298525 1 812547177 1 459359946 1 355467212 1 304450522 807957797 916787906 1 239781206 1 242840396"
},
{
"input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1",
"output": "19\n1 1 1 1 2 1 1 1 1 1 2 1 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 1 2 1 2 1 1 2 1 1 1 2 1 2 1 2 1 1 1 2 1 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 2 1"
},
{
"input": "100\n591 417 888 251 792 847 685 3 182 461 102 348 555 956 771 901 712 878 580 631 342 333 285 899 525 725 537 718 929 653 84 788 104 355 624 803 253 853 201 995 536 184 65 205 540 652 549 777 248 405 677 950 431 580 600 846 328 429 134 983 526 103 500 963 400 23 276 704 570 757 410 658 507 620 984 244 486 454 802 411 985 303 635 283 96 597 855 775 139 839 839 61 219 986 776 72 729 69 20 917",
"output": "38\n591 1 417 1 888 251 792 1 847 685 3 182 461 102 1 348 1 555 956 771 901 712 1 878 1 580 631 342 1 333 1 285 899 525 1 725 537 718 929 653 84 1 788 1 104 355 624 803 1 253 853 201 995 536 1 184 65 1 205 1 540 1 652 549 1 777 248 405 677 950 431 580 1 600 1 846 1 328 429 134 983 526 103 500 963 400 23 1 276 1 704 1 570 757 410 1 658 507 620 1 984 1 244 1 486 1 454 1 802 411 985 303 635 283 96 1 597 1 855 1 775 139 839 1 839 61 219 986 1 776 1 72 1 729 1 69 20 917"
},
{
"input": "5\n472882027 472882027 472882027 472882027 472882027",
"output": "4\n472882027 1 472882027 1 472882027 1 472882027 1 472882027"
},
{
"input": "2\n1000000000 1000000000",
"output": "1\n1000000000 1 1000000000"
},
{
"input": "2\n8 6",
"output": "1\n8 1 6"
},
{
"input": "3\n100000000 1000000000 1000000000",
"output": "2\n100000000 1 1000000000 1 1000000000"
},
{
"input": "5\n1 2 3 4 5",
"output": "0\n1 2 3 4 5"
},
{
"input": "20\n2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000",
"output": "19\n2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000"
},
{
"input": "2\n223092870 23",
"output": "1\n223092870 1 23"
},
{
"input": "2\n100000003 100000003",
"output": "1\n100000003 1 100000003"
},
{
"input": "2\n999999937 999999937",
"output": "1\n999999937 1 999999937"
},
{
"input": "4\n999 999999937 999999937 999",
"output": "1\n999 999999937 1 999999937 999"
},
{
"input": "2\n999999929 999999929",
"output": "1\n999999929 1 999999929"
},
{
"input": "2\n1049459 2098918",
"output": "1\n1049459 1 2098918"
},
{
"input": "2\n352229 704458",
"output": "1\n352229 1 704458"
},
{
"input": "2\n7293 4011",
"output": "1\n7293 1 4011"
},
{
"input": "2\n5565651 3999930",
"output": "1\n5565651 1 3999930"
},
{
"input": "2\n997 997",
"output": "1\n997 1 997"
},
{
"input": "3\n9994223 9994223 9994223",
"output": "2\n9994223 1 9994223 1 9994223"
},
{
"input": "2\n99999998 1000000000",
"output": "1\n99999998 1 1000000000"
},
{
"input": "3\n1000000000 1000000000 1000000000",
"output": "2\n1000000000 1 1000000000 1 1000000000"
},
{
"input": "2\n130471 130471",
"output": "1\n130471 1 130471"
},
{
"input": "3\n1000000000 2 2",
"output": "2\n1000000000 1 2 1 2"
},
{
"input": "2\n223092870 66526",
"output": "1\n223092870 1 66526"
},
{
"input": "14\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491 436077930 570018449",
"output": "10\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491 436077930 1 570018449"
},
{
"input": "2\n3996017 3996017",
"output": "1\n3996017 1 3996017"
},
{
"input": "2\n999983 999983",
"output": "1\n999983 1 999983"
},
{
"input": "2\n618575685 773990454",
"output": "1\n618575685 1 773990454"
},
{
"input": "3\n9699690 3 7",
"output": "1\n9699690 1 3 7"
},
{
"input": "2\n999999999 999999996",
"output": "1\n999999999 1 999999996"
},
{
"input": "2\n99999910 99999910",
"output": "1\n99999910 1 99999910"
},
{
"input": "12\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491",
"output": "9\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491"
},
{
"input": "3\n999999937 999999937 999999937",
"output": "2\n999999937 1 999999937 1 999999937"
},
{
"input": "2\n99839 99839",
"output": "1\n99839 1 99839"
},
{
"input": "3\n19999909 19999909 19999909",
"output": "2\n19999909 1 19999909 1 19999909"
},
{
"input": "4\n1 1000000000 1 1000000000",
"output": "0\n1 1000000000 1 1000000000"
},
{
"input": "2\n64006 64006",
"output": "1\n64006 1 64006"
},
{
"input": "2\n1956955 1956955",
"output": "1\n1956955 1 1956955"
},
{
"input": "3\n1 1000000000 1000000000",
"output": "1\n1 1000000000 1 1000000000"
},
{
"input": "2\n982451707 982451707",
"output": "1\n982451707 1 982451707"
},
{
"input": "2\n999999733 999999733",
"output": "1\n999999733 1 999999733"
},
{
"input": "3\n999999733 999999733 999999733",
"output": "2\n999999733 1 999999733 1 999999733"
},
{
"input": "2\n3257 3257",
"output": "1\n3257 1 3257"
},
{
"input": "2\n223092870 181598",
"output": "1\n223092870 1 181598"
},
{
"input": "3\n959919409 105935 105935",
"output": "2\n959919409 1 105935 1 105935"
},
{
"input": "2\n510510 510510",
"output": "1\n510510 1 510510"
},
{
"input": "3\n223092870 1000000000 1000000000",
"output": "2\n223092870 1 1000000000 1 1000000000"
},
{
"input": "14\n1000000000 2 1000000000 3 1000000000 6 1000000000 1000000000 15 1000000000 1000000000 1000000000 100000000 1000",
"output": "11\n1000000000 1 2 1 1000000000 3 1000000000 1 6 1 1000000000 1 1000000000 1 15 1 1000000000 1 1000000000 1 1000000000 1 100000000 1 1000"
},
{
"input": "7\n1 982451653 982451653 1 982451653 982451653 982451653",
"output": "3\n1 982451653 1 982451653 1 982451653 1 982451653 1 982451653"
},
{
"input": "2\n100000007 100000007",
"output": "1\n100000007 1 100000007"
},
{
"input": "3\n999999757 999999757 999999757",
"output": "2\n999999757 1 999999757 1 999999757"
},
{
"input": "3\n99999989 99999989 99999989",
"output": "2\n99999989 1 99999989 1 99999989"
},
{
"input": "5\n2 4 982451707 982451707 3",
"output": "2\n2 1 4 982451707 1 982451707 3"
},
{
"input": "2\n20000014 20000014",
"output": "1\n20000014 1 20000014"
},
{
"input": "2\n99999989 99999989",
"output": "1\n99999989 1 99999989"
},
{
"input": "2\n111546435 111546435",
"output": "1\n111546435 1 111546435"
},
{
"input": "2\n55288874 33538046",
"output": "1\n55288874 1 33538046"
},
{
"input": "5\n179424673 179424673 179424673 179424673 179424673",
"output": "4\n179424673 1 179424673 1 179424673 1 179424673 1 179424673"
},
{
"input": "2\n199999978 199999978",
"output": "1\n199999978 1 199999978"
},
{
"input": "2\n1000000000 2",
"output": "1\n1000000000 1 2"
},
{
"input": "3\n19999897 19999897 19999897",
"output": "2\n19999897 1 19999897 1 19999897"
},
{
"input": "2\n19999982 19999982",
"output": "1\n19999982 1 19999982"
},
{
"input": "2\n10000007 10000007",
"output": "1\n10000007 1 10000007"
},
{
"input": "3\n999999937 999999937 2",
"output": "1\n999999937 1 999999937 2"
},
{
"input": "5\n2017 2017 2017 2017 2017",
"output": "4\n2017 1 2017 1 2017 1 2017 1 2017"
},
{
"input": "2\n19999909 39999818",
"output": "1\n19999909 1 39999818"
},
{
"input": "2\n62615533 7919",
"output": "1\n62615533 1 7919"
},
{
"input": "5\n39989 39989 33 31 29",
"output": "1\n39989 1 39989 33 31 29"
},
{
"input": "2\n1000000000 100000",
"output": "1\n1000000000 1 100000"
},
{
"input": "2\n1938 10010",
"output": "1\n1938 1 10010"
},
{
"input": "2\n199999 199999",
"output": "1\n199999 1 199999"
},
{
"input": "2\n107273 107273",
"output": "1\n107273 1 107273"
},
{
"input": "3\n49999 49999 49999",
"output": "2\n49999 1 49999 1 49999"
},
{
"input": "2\n1999966 1999958",
"output": "1\n1999966 1 1999958"
},
{
"input": "2\n86020 300846",
"output": "1\n86020 1 300846"
},
{
"input": "2\n999999997 213",
"output": "1\n999999997 1 213"
},
{
"input": "2\n200000014 200000434",
"output": "1\n200000014 1 200000434"
}
] | 1,463,573,892 | 2,147,483,647 | Python 3 | OK | TESTS | 93 | 77 | 5,222,400 | n = int(input())
numbers = iter(map(int, input().split()))
from math import gcd
insert_counter = 0
b = next(numbers)
result = [b]
for _ in range(n - 1):
a = b
b = next(numbers)
if gcd(a, b) != 1:
insert_counter += 1
result.append(1)
result.append(b)
print(insert_counter)
[print(number, end=' ') for number in result]
| Title: Co-prime Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
Output Specification:
Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them.
Demo Input:
['3\n2 7 28\n']
Demo Output:
['1\n2 7 9 28\n']
Note:
none | ```python
n = int(input())
numbers = iter(map(int, input().split()))
from math import gcd
insert_counter = 0
b = next(numbers)
result = [b]
for _ in range(n - 1):
a = b
b = next(numbers)
if gcd(a, b) != 1:
insert_counter += 1
result.append(1)
result.append(b)
print(insert_counter)
[print(number, end=' ') for number in result]
``` | 3 |
|
527 | A | Playing with Paper | PROGRAMMING | 1,100 | [
"implementation",
"math"
] | null | null | One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson? | The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper. | Print a single integer — the number of ships that Vasya will make. | [
"2 1\n",
"10 7\n",
"1000000000000 1\n"
] | [
"2\n",
"6\n",
"1000000000000\n"
] | Pictures to the first and second sample test. | 500 | [
{
"input": "2 1",
"output": "2"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "1000000000000 1",
"output": "1000000000000"
},
{
"input": "3 1",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "3 2",
"output": "3"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "1000 700",
"output": "6"
},
{
"input": "959986566087 524054155168",
"output": "90"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "7 6",
"output": "7"
},
{
"input": "1000 999",
"output": "1000"
},
{
"input": "1000 998",
"output": "500"
},
{
"input": "1000 997",
"output": "336"
},
{
"input": "42 1",
"output": "42"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "13 8",
"output": "6"
},
{
"input": "987 610",
"output": "15"
},
{
"input": "442 42",
"output": "22"
},
{
"input": "754 466",
"output": "13"
},
{
"input": "1000000000000 999999999999",
"output": "1000000000000"
},
{
"input": "1000000000000 999999999998",
"output": "500000000000"
},
{
"input": "941 14",
"output": "74"
},
{
"input": "998 2",
"output": "499"
},
{
"input": "1000 42",
"output": "32"
},
{
"input": "1000 17",
"output": "66"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "4"
},
{
"input": "5 3",
"output": "4"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "293 210",
"output": "17"
},
{
"input": "787878787878 424242424242",
"output": "8"
},
{
"input": "956722026041 591286729879",
"output": "58"
},
{
"input": "956722026041 365435296162",
"output": "58"
},
{
"input": "628625247282 464807889701",
"output": "102"
},
{
"input": "695928431619 424778620208",
"output": "167"
},
{
"input": "1000000000000 42",
"output": "23809523821"
},
{
"input": "987654345678 23",
"output": "42941493300"
},
{
"input": "10000000001 2",
"output": "5000000002"
},
{
"input": "1000000000000 2",
"output": "500000000000"
},
{
"input": "1000000000000 3",
"output": "333333333336"
},
{
"input": "100000000000 3",
"output": "33333333336"
},
{
"input": "100000000000 23",
"output": "4347826109"
},
{
"input": "999999999997 7",
"output": "142857142861"
},
{
"input": "8589934592 4294967296",
"output": "2"
}
] | 1,589,656,709 | 2,147,483,647 | PyPy 3 | OK | TESTS | 46 | 140 | 20,172,800 | a, b = [int(i) for i in input().split()]
q = a//b
ans = q
while (a - q*b != 0):
x = a - q*b
a = b
b = x
q = a//b
ans += q
print(ans)
| Title: Playing with Paper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
Input Specification:
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
Output Specification:
Print a single integer — the number of ships that Vasya will make.
Demo Input:
['2 1\n', '10 7\n', '1000000000000 1\n']
Demo Output:
['2\n', '6\n', '1000000000000\n']
Note:
Pictures to the first and second sample test. | ```python
a, b = [int(i) for i in input().split()]
q = a//b
ans = q
while (a - q*b != 0):
x = a - q*b
a = b
b = x
q = a//b
ans += q
print(ans)
``` | 3 |
|
361 | B | Levko and Permutation | PROGRAMMING | 1,200 | [
"constructive algorithms",
"math",
"number theory"
] | null | null | Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them. | The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*). | In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them. | [
"4 2\n",
"1 1\n"
] | [
"2 4 3 1",
"-1\n"
] | In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations. | 1,000 | [
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "7 4",
"output": "3 1 2 4 5 6 7 "
},
{
"input": "10 9",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10000 5000",
"output": "5000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "7 0",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1 0",
"output": "1 "
},
{
"input": "7 7",
"output": "-1"
},
{
"input": "100000 47",
"output": "99953 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 100000",
"output": "-1"
},
{
"input": "100000 43425",
"output": "56575 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "7 6",
"output": "1 2 3 4 5 6 7 "
},
{
"input": "100000 99999",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "47 46",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 "
},
{
"input": "5 0",
"output": "5 1 2 3 4 "
},
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1533 1052",
"output": "481 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "81314 52747",
"output": "28567 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "17767 145",
"output": "17622 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "18168 7942",
"output": "10226 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 15915",
"output": "10678 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 8877",
"output": "17716 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "13852 12727",
"output": "1125 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "8834 8834",
"output": "-1"
},
{
"input": "8485 8484",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "14564 14564",
"output": "-1"
},
{
"input": "8254 8253",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "81314 81312",
"output": "2 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "5795 5792",
"output": "3 1 2 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "6417 3",
"output": "6414 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6896 0",
"output": "6896 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6778 1",
"output": "6777 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "9448 1",
"output": "9447 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "5938 2",
"output": "5936 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "3072 0",
"output": "3072 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "8576 0",
"output": "8576 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "2 1",
"output": "1 2 "
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "5 5",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "100000 1",
"output": "99999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 50000",
"output": "50000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "100000 9999",
"output": "90001 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 99000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "100000 12347",
"output": "87653 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
}
] | 1,625,725,292 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 61 | 0 | n, k = [int(x) for x in input().split()]
if n == k or k == 0:
print(-1)
else:
list1 = [0] * (n+1)
list1[1] = 1
i = 2
temp = k
while temp > 0:
list1[i] = i
i += 1
temp -= 1
if (n % 2 == 0 and k % 2 == 0) or (n % 2 != 0 and k % 2 != 0):
for i in range(k+2, n+1, 2):
list1[i], list1[(i+1) % n] = (i+1)%n, i
else:
for i in range(k+2, n+1, 2):
list1[i], list1[i+1] = i+1, i
print(*list1[1:])
| Title: Levko and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them.
Input Specification:
The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*).
Output Specification:
In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them.
Demo Input:
['4 2\n', '1 1\n']
Demo Output:
['2 4 3 1', '-1\n']
Note:
In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations. | ```python
n, k = [int(x) for x in input().split()]
if n == k or k == 0:
print(-1)
else:
list1 = [0] * (n+1)
list1[1] = 1
i = 2
temp = k
while temp > 0:
list1[i] = i
i += 1
temp -= 1
if (n % 2 == 0 and k % 2 == 0) or (n % 2 != 0 and k % 2 != 0):
for i in range(k+2, n+1, 2):
list1[i], list1[(i+1) % n] = (i+1)%n, i
else:
for i in range(k+2, n+1, 2):
list1[i], list1[i+1] = i+1, i
print(*list1[1:])
``` | 0 |
|
385 | B | Bear and Strings | PROGRAMMING | 1,200 | [
"brute force",
"greedy",
"implementation",
"math",
"strings"
] | null | null | The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem. | The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters. | Print a single number — the answer to the problem. | [
"bearbtear\n",
"bearaabearc\n"
] | [
"6\n",
"20\n"
] | In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | 1,000 | [
{
"input": "bearbtear",
"output": "6"
},
{
"input": "bearaabearc",
"output": "20"
},
{
"input": "pbearbearhbearzqbearjkterasjhy",
"output": "291"
},
{
"input": "pbearjbearbebearnbabcffbearbearwubearjezpiorrbearbearjbdlbearbearqbearjbearwipmsbearoaftrsebearzsnqb",
"output": "4419"
},
{
"input": "bear",
"output": "1"
},
{
"input": "a",
"output": "0"
},
{
"input": "be",
"output": "0"
}
] | 1,662,430,962 | 2,147,483,647 | Python 3 | OK | TESTS | 43 | 46 | 0 | word = "bear"
my_word = input()
ans = 0
last_b = 0
for i in range(len(my_word) - 3):
if my_word[i:i + 4] == word:
before = i - last_b
after = len(my_word) - (i + 4)
ans += (before + 1) * (after + 1)
last_b = i + 1
print(ans)
| Title: Bear and Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
Input Specification:
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['bearbtear\n', 'bearaabearc\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | ```python
word = "bear"
my_word = input()
ans = 0
last_b = 0
for i in range(len(my_word) - 3):
if my_word[i:i + 4] == word:
before = i - last_b
after = len(my_word) - (i + 4)
ans += (before + 1) * (after + 1)
last_b = i + 1
print(ans)
``` | 3 |
|
161 | A | Dress'em in Vests! | PROGRAMMING | 1,300 | [
"binary search",
"brute force",
"greedy",
"two pointers"
] | null | null | The Two-dimensional kingdom is going through hard times... This morning the Three-Dimensional kingdom declared war on the Two-dimensional one. This (possibly armed) conflict will determine the ultimate owner of the straight line.
The Two-dimensional kingdom has a regular army of *n* people. Each soldier registered himself and indicated the desired size of the bulletproof vest: the *i*-th soldier indicated size *a**i*. The soldiers are known to be unpretentious, so the command staff assumes that the soldiers are comfortable in any vests with sizes from *a**i*<=-<=*x* to *a**i*<=+<=*y*, inclusive (numbers *x*,<=*y*<=≥<=0 are specified).
The Two-dimensional kingdom has *m* vests at its disposal, the *j*-th vest's size equals *b**j*. Help mobilize the Two-dimensional kingdom's army: equip with vests as many soldiers as possible. Each vest can be used only once. The *i*-th soldier can put on the *j*-th vest, if *a**i*<=-<=*x*<=≤<=*b**j*<=≤<=*a**i*<=+<=*y*. | The first input line contains four integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=≤<=*x*,<=*y*<=≤<=109) — the number of soldiers, the number of vests and two numbers that specify the soldiers' unpretentiousness, correspondingly.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) in non-decreasing order, separated by single spaces — the desired sizes of vests.
The third line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=109) in non-decreasing order, separated by single spaces — the sizes of the available vests. | In the first line print a single integer *k* — the maximum number of soldiers equipped with bulletproof vests.
In the next *k* lines print *k* pairs, one pair per line, as "*u**i* *v**i*" (without the quotes). Pair (*u**i*, *v**i*) means that soldier number *u**i* must wear vest number *v**i*. Soldiers and vests are numbered starting from one in the order in which they are specified in the input. All numbers of soldiers in the pairs should be pairwise different, all numbers of vests in the pairs also should be pairwise different. You can print the pairs in any order.
If there are multiple optimal answers, you are allowed to print any of them. | [
"5 3 0 0\n1 2 3 3 4\n1 3 5\n",
"3 3 2 2\n1 5 9\n3 5 7\n"
] | [
"2\n1 1\n3 2\n",
"3\n1 1\n2 2\n3 3\n"
] | In the first sample you need the vests' sizes to match perfectly: the first soldier gets the first vest (size 1), the third soldier gets the second vest (size 3). This sample allows another answer, which gives the second vest to the fourth soldier instead of the third one.
In the second sample the vest size can differ from the desired size by at most 2 sizes, so all soldiers can be equipped. | 1,000 | [
{
"input": "5 3 0 0\n1 2 3 3 4\n1 3 5",
"output": "2\n1 1\n3 2"
},
{
"input": "3 3 2 2\n1 5 9\n3 5 7",
"output": "3\n1 1\n2 2\n3 3"
},
{
"input": "1 1 0 0\n1\n1",
"output": "1\n1 1"
},
{
"input": "1 1 0 0\n1\n2",
"output": "0"
},
{
"input": "2 3 1 4\n1 5\n1 2 2",
"output": "1\n1 1"
},
{
"input": "20 30 1 4\n1 1 1 1 2 2 2 2 3 3 3 3 4 4 4 4 4 4 4 5\n1 1 1 1 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 4 4 4 4 4 4 4 4 5 5",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 15\n14 16\n15 17\n16 18\n17 19\n18 20\n19 21\n20 22"
},
{
"input": "33 23 17 2\n1 1 2 2 2 3 3 3 3 3 3 4 4 4 4 4 5 5 5 6 6 7 7 7 8 8 8 8 8 9 9 10 10\n1 1 3 3 4 4 4 5 5 6 6 6 7 8 8 8 8 8 8 9 9 10 10",
"output": "23\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n12 10\n13 11\n14 12\n17 13\n20 14\n21 15\n22 16\n23 17\n24 18\n25 19\n26 20\n27 21\n28 22\n29 23"
},
{
"input": "2 2 1 4\n1 4\n3 6",
"output": "2\n1 1\n2 2"
},
{
"input": "20 20 1 4\n1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 5 5\n3 3 3 3 3 4 4 4 4 4 4 4 4 5 5 5 6 6 7 7",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "33 23 17 2\n1 1 1 2 3 3 3 3 3 4 4 4 4 5 6 6 6 6 6 6 7 7 7 7 7 8 8 8 8 8 8 10 10\n10 10 10 11 12 12 12 12 12 13 13 13 13 14 15 15 15 15 15 15 16 16 16",
"output": "5\n26 1\n27 2\n28 3\n32 4\n33 5"
},
{
"input": "1 1 1 2\n783266931\n783266932",
"output": "1\n1 1"
},
{
"input": "2 3 1 4\n1 1\n3 3 4",
"output": "2\n1 1\n2 2"
},
{
"input": "20 30 1 4\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "33 23 17 2\n1 1 1 1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 4 4 4 4 4 4 5 5 5 5 5 5\n10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 13 13 13",
"output": "0"
},
{
"input": "10 1 1 1\n1 1 1 5 5 7 7 8 8 8\n3",
"output": "0"
},
{
"input": "10 1 2 1\n1 2 5 8 9 9 9 10 10 10\n7",
"output": "1\n4 1"
},
{
"input": "1 1 2 1\n7\n8",
"output": "1\n1 1"
},
{
"input": "1 1 0 2\n9\n7",
"output": "0"
},
{
"input": "2 2 0 2\n2 8\n3 5",
"output": "1\n1 1"
},
{
"input": "2 2 1 0\n5 5\n6 7",
"output": "0"
},
{
"input": "2 2 3 0\n8 9\n1 5",
"output": "1\n1 2"
}
] | 1,502,892,238 | 2,147,483,647 | Python 3 | OK | TESTS | 84 | 1,590 | 16,486,400 | n,m,x,y = map(int,input().split())
a = list(map(int,input().split()))
b = list(map(int,input().split()))
j = 0
V=[]
for i in range(m):
while (j<n and a[j]+y<b[i]):
j += 1
if j == n:
break
if (j<n and a[j]-x<=b[i]<=a[j]+y):
V+=[[j+1,i+1]]
j+=1
print(len(V))
for x in V:
print(x[0],x[1]) | Title: Dress'em in Vests!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Two-dimensional kingdom is going through hard times... This morning the Three-Dimensional kingdom declared war on the Two-dimensional one. This (possibly armed) conflict will determine the ultimate owner of the straight line.
The Two-dimensional kingdom has a regular army of *n* people. Each soldier registered himself and indicated the desired size of the bulletproof vest: the *i*-th soldier indicated size *a**i*. The soldiers are known to be unpretentious, so the command staff assumes that the soldiers are comfortable in any vests with sizes from *a**i*<=-<=*x* to *a**i*<=+<=*y*, inclusive (numbers *x*,<=*y*<=≥<=0 are specified).
The Two-dimensional kingdom has *m* vests at its disposal, the *j*-th vest's size equals *b**j*. Help mobilize the Two-dimensional kingdom's army: equip with vests as many soldiers as possible. Each vest can be used only once. The *i*-th soldier can put on the *j*-th vest, if *a**i*<=-<=*x*<=≤<=*b**j*<=≤<=*a**i*<=+<=*y*.
Input Specification:
The first input line contains four integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=≤<=*x*,<=*y*<=≤<=109) — the number of soldiers, the number of vests and two numbers that specify the soldiers' unpretentiousness, correspondingly.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) in non-decreasing order, separated by single spaces — the desired sizes of vests.
The third line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=109) in non-decreasing order, separated by single spaces — the sizes of the available vests.
Output Specification:
In the first line print a single integer *k* — the maximum number of soldiers equipped with bulletproof vests.
In the next *k* lines print *k* pairs, one pair per line, as "*u**i* *v**i*" (without the quotes). Pair (*u**i*, *v**i*) means that soldier number *u**i* must wear vest number *v**i*. Soldiers and vests are numbered starting from one in the order in which they are specified in the input. All numbers of soldiers in the pairs should be pairwise different, all numbers of vests in the pairs also should be pairwise different. You can print the pairs in any order.
If there are multiple optimal answers, you are allowed to print any of them.
Demo Input:
['5 3 0 0\n1 2 3 3 4\n1 3 5\n', '3 3 2 2\n1 5 9\n3 5 7\n']
Demo Output:
['2\n1 1\n3 2\n', '3\n1 1\n2 2\n3 3\n']
Note:
In the first sample you need the vests' sizes to match perfectly: the first soldier gets the first vest (size 1), the third soldier gets the second vest (size 3). This sample allows another answer, which gives the second vest to the fourth soldier instead of the third one.
In the second sample the vest size can differ from the desired size by at most 2 sizes, so all soldiers can be equipped. | ```python
n,m,x,y = map(int,input().split())
a = list(map(int,input().split()))
b = list(map(int,input().split()))
j = 0
V=[]
for i in range(m):
while (j<n and a[j]+y<b[i]):
j += 1
if j == n:
break
if (j<n and a[j]-x<=b[i]<=a[j]+y):
V+=[[j+1,i+1]]
j+=1
print(len(V))
for x in V:
print(x[0],x[1])
``` | 3 |
|
25 | A | IQ test | PROGRAMMING | 1,300 | [
"brute force"
] | A. IQ test | 2 | 256 | Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. | Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. | [
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] | [
"3\n",
"2\n"
] | none | 0 | [
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,608,495,251 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 218 | 307,200 | n=int(input())
output=0
a=input().split()
for i in range(n):
a[i]=int(a[i])
for i in range(1,n-1):
if a[i]%2!=a[i+1]%2 and a[i]%2!=a[i-1]%2:
print(i+1)
output=1
break
if output==0 and (a[0]%2!=a[1]%2):
print("1")
elif output==0 and (a[n-1]%2!=a[1]%2):
print(n) | Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
n=int(input())
output=0
a=input().split()
for i in range(n):
a[i]=int(a[i])
for i in range(1,n-1):
if a[i]%2!=a[i+1]%2 and a[i]%2!=a[i-1]%2:
print(i+1)
output=1
break
if output==0 and (a[0]%2!=a[1]%2):
print("1")
elif output==0 and (a[n-1]%2!=a[1]%2):
print(n)
``` | 3.944928 |
731 | A | Night at the Museum | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it. | The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters. | Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input. | [
"zeus\n",
"map\n",
"ares\n"
] | [
"18\n",
"35\n",
"34\n"
] | To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | 500 | [
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,627,222,955 | 2,147,483,647 | Python 3 | OK | TESTS | 44 | 77 | 6,758,400 | word = input()
sum = 0
table = 'abcdefghijklmnopqrstuvwxyz'
bias = 0
for step in word:
num = abs(bias - table.find(step))
bias = table.find(step)
if num <= (26-num):
sum += num
else:
sum += 26-num
print(sum) | Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | ```python
word = input()
sum = 0
table = 'abcdefghijklmnopqrstuvwxyz'
bias = 0
for step in word:
num = abs(bias - table.find(step))
bias = table.find(step)
if num <= (26-num):
sum += num
else:
sum += 26-num
print(sum)
``` | 3 |
|
706 | B | Interesting drink | PROGRAMMING | 1,100 | [
"binary search",
"dp",
"implementation"
] | null | null | Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins.
Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola". | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink.
The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop.
The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink.
Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day. | Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day. | [
"5\n3 10 8 6 11\n4\n1\n10\n3\n11\n"
] | [
"0\n4\n1\n5\n"
] | On the first day, Vasiliy won't be able to buy a drink in any of the shops.
On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4.
On the third day, Vasiliy can buy a drink only in the shop number 1.
Finally, on the last day Vasiliy can buy a drink in any shop. | 1,000 | [
{
"input": "5\n3 10 8 6 11\n4\n1\n10\n3\n11",
"output": "0\n4\n1\n5"
},
{
"input": "5\n868 987 714 168 123\n10\n424\n192\n795\n873\n117\n914\n735\n158\n631\n471",
"output": "2\n2\n3\n4\n0\n4\n3\n1\n2\n2"
},
{
"input": "3\n435 482 309\n7\n245\n241\n909\n745\n980\n29\n521",
"output": "0\n0\n3\n3\n3\n0\n3"
},
{
"input": "1\n653\n9\n903\n980\n80\n770\n965\n874\n381\n657\n969",
"output": "1\n1\n0\n1\n1\n1\n0\n1\n1"
},
{
"input": "12\n35345 58181 32223 84621 35905 73863 99537 30666 67771 39229 36847 29038\n23\n55052824\n82504840\n35160556\n78141700\n73401989\n86305919\n39430705\n31939373\n23501765\n4406029\n61436920\n14295390\n34275309\n28028753\n85724689\n70158847\n2396455\n66994588\n84024224\n30175981\n65622319\n76517111\n76605341",
"output": "12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12"
},
{
"input": "4\n698 193 1584 76192\n4\n553640\n310518\n274280\n429192",
"output": "4\n4\n4\n4"
},
{
"input": "1\n1\n1\n1000000000",
"output": "1"
},
{
"input": "1\n1\n1\n100005",
"output": "1"
},
{
"input": "3\n1 2 3\n1\n100005",
"output": "3"
},
{
"input": "2\n1 2\n3\n100004\n100005\n100006",
"output": "2\n2\n2"
},
{
"input": "3\n1 1 1\n1\n1",
"output": "3"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "3\n1 2 3\n1\n100000",
"output": "3"
},
{
"input": "5\n1 1 1 1 10\n2\n1\n10",
"output": "4\n5"
},
{
"input": "5\n3 10 8 6 11\n1\n10000000",
"output": "5"
}
] | 1,694,166,715 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 10 | 2,000 | 13,721,600 | def binary_search(ls,target):
ls.sort()
low=0
high=len(ls)-1
while low<=high:
mid=(low+high)//2
if ls[mid]<=target:
low=mid+1
else:
high=mid-1
return high
t=int(input())
ls=list(map(int,input().split()))
q=int(input())
for i in range(q):
key=int(input())
print(binary_search(ls,key)+1) | Title: Interesting drink
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins.
Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola".
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink.
The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop.
The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink.
Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day.
Output Specification:
Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day.
Demo Input:
['5\n3 10 8 6 11\n4\n1\n10\n3\n11\n']
Demo Output:
['0\n4\n1\n5\n']
Note:
On the first day, Vasiliy won't be able to buy a drink in any of the shops.
On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4.
On the third day, Vasiliy can buy a drink only in the shop number 1.
Finally, on the last day Vasiliy can buy a drink in any shop. | ```python
def binary_search(ls,target):
ls.sort()
low=0
high=len(ls)-1
while low<=high:
mid=(low+high)//2
if ls[mid]<=target:
low=mid+1
else:
high=mid-1
return high
t=int(input())
ls=list(map(int,input().split()))
q=int(input())
for i in range(q):
key=int(input())
print(binary_search(ls,key)+1)
``` | 0 |
|
384 | A | Coder | PROGRAMMING | 800 | [
"implementation"
] | null | null | Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). | On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any. | [
"2\n"
] | [
"2\nC.\n.C\n"
] | none | 500 | [
{
"input": "2",
"output": "2\nC.\n.C"
},
{
"input": "3",
"output": "5\nC.C\n.C.\nC.C"
},
{
"input": "4",
"output": "8\nC.C.\n.C.C\nC.C.\n.C.C"
},
{
"input": "10",
"output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C"
},
{
"input": "15",
"output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C"
},
{
"input": "100",
"output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "101",
"output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "500",
"output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...."
},
{
"input": "501",
"output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..."
},
{
"input": "755",
"output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "888",
"output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "998",
"output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "999",
"output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1000",
"output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1",
"output": "1\nC"
}
] | 1,551,345,481 | 2,147,483,647 | Python 3 | OK | TESTS | 15 | 108 | 0 | k=0
c=0
s=''
ss=''
n=int(input())
for i in range(n):
if k%2==0:
s+='C'
ss+='.'
else:
s+='.'
ss+='C'
k+=1
k=0
for i in range(n):
if k%2==0:
c+=s.count('C')
else:
c+=ss.count('C')
k+=1
k=0
print(c)
for i in range(n):
if k%2==0:
print(s)
else:
print(ss)
k+=1 | Title: Coder
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
Demo Input:
['2\n']
Demo Output:
['2\nC.\n.C\n']
Note:
none | ```python
k=0
c=0
s=''
ss=''
n=int(input())
for i in range(n):
if k%2==0:
s+='C'
ss+='.'
else:
s+='.'
ss+='C'
k+=1
k=0
for i in range(n):
if k%2==0:
c+=s.count('C')
else:
c+=ss.count('C')
k+=1
k=0
print(c)
for i in range(n):
if k%2==0:
print(s)
else:
print(ss)
k+=1
``` | 3 |
|
746 | B | Decoding | PROGRAMMING | 900 | [
"implementation",
"strings"
] | null | null | Polycarp is mad about coding, that is why he writes Sveta encoded messages. He calls the median letter in a word the letter which is in the middle of the word. If the word's length is even, the median letter is the left of the two middle letters. In the following examples, the median letter is highlighted: contest, info. If the word consists of single letter, then according to above definition this letter is the median letter.
Polycarp encodes each word in the following way: he writes down the median letter of the word, then deletes it and repeats the process until there are no letters left. For example, he encodes the word volga as logva.
You are given an encoding *s* of some word, your task is to decode it. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2000) — the length of the encoded word.
The second line contains the string *s* of length *n* consisting of lowercase English letters — the encoding. | Print the word that Polycarp encoded. | [
"5\nlogva\n",
"2\nno\n",
"4\nabba\n"
] | [
"volga\n",
"no\n",
"baba\n"
] | In the first example Polycarp encoded the word volga. At first, he wrote down the letter l from the position 3, after that his word looked like voga. After that Polycarp wrote down the letter o from the position 2, his word became vga. Then Polycarp wrote down the letter g which was at the second position, the word became va. Then he wrote down the letter v, then the letter a. Thus, the encoding looked like logva.
In the second example Polycarp encoded the word no. He wrote down the letter n, the word became o, and he wrote down the letter o. Thus, in this example, the word and its encoding are the same.
In the third example Polycarp encoded the word baba. At first, he wrote down the letter a, which was at the position 2, after that the word looked like bba. Then he wrote down the letter b, which was at the position 2, his word looked like ba. After that he wrote down the letter b, which was at the position 1, the word looked like a, and he wrote down that letter a. Thus, the encoding is abba. | 1,000 | [
{
"input": "5\nlogva",
"output": "volga"
},
{
"input": "2\nno",
"output": "no"
},
{
"input": "4\nabba",
"output": "baba"
},
{
"input": "51\nkfsmpaeviowvkdbuhdagquxxqniselafnfbrgbhmsugcbbnlrvv",
"output": "vlbcumbrfflsnxugdudvovamfkspeiwkbhaqxqieanbghsgbnrv"
},
{
"input": "1\nw",
"output": "w"
},
{
"input": "2\ncb",
"output": "cb"
},
{
"input": "3\nqok",
"output": "oqk"
},
{
"input": "4\naegi",
"output": "gaei"
},
{
"input": "5\noqquy",
"output": "uqoqy"
},
{
"input": "6\nulhpnm",
"output": "nhulpm"
},
{
"input": "7\nijvxljt",
"output": "jxjivlt"
},
{
"input": "8\nwwmiwkeo",
"output": "ewmwwiko"
},
{
"input": "9\ngmwqmpfow",
"output": "opqmgwmfw"
},
{
"input": "10\nhncmexsslh",
"output": "lsechnmxsh"
},
{
"input": "20\nrtcjbjlbtjfmvzdqutuw",
"output": "uudvftlbcrtjjbjmzqtw"
},
{
"input": "21\ngjyiqoebcnpsdegxnsauh",
"output": "usxesnboijgyqecpdgnah"
},
{
"input": "30\nudotcwvcwxajkadxqvxvwgmwmnqrby",
"output": "bqmmwxqdkawvcoudtwcxjaxvvgwnry"
},
{
"input": "31\nipgfrxxcgckksfgexlicjvtnhvrfbmb",
"output": "mfvnvclefkccxfpigrxgksgxijthrbb"
},
{
"input": "50\nwobervhvvkihcuyjtmqhaaigvahheoqleromusrartldojsjvy",
"output": "vsolrruoeqehviaqtycivhrbwoevvkhujmhagaholrmsatdjjy"
},
{
"input": "200\nhvayscqiwpcfykibwyudkzuzdkgqqvbnrfeupjefevlvojngmlcjwzijrkzbsaovabkvvwmjgoonyhuiphwmqdoiuueuyqtychbsklflnvghipdgaxhuhiiqlqocpvhldgvnsrtcwxpidrjffwvwcirluyyxzxrglheczeuouklzkvnyubsvgvmdbrylimztotdbmjph",
"output": "pmdoziybmgsunkluuzelrzyurcvfjdpwtsvdhpolihhadignfkbctyeuoqwpuyogmvkaoszriwcmnoleeperbqgdukuwiycwqsahvycipfkbydzzkqvnfujfvvjgljzjkbavbvwjonhihmdiuuqyhsllvhpgxuiqqcvlgnrcxirfwwilyxxghceokzvybvvdrlmttbjh"
},
{
"input": "201\nrpkghhfibtmlkpdiklegblbuyshfirheatjkfoqkfayfbxeeqijwqdwkkrkbdxlhzkhyiifemsghwovorlqedngldskfbhmwrnzmtjuckxoqdszmsdnbuqnlqzswdfhagasmfswanifrjjcuwdsplytvmnfarchgqteedgfpumkssindxndliozojzlpznwedodzwrrus",
"output": "urzoenpzoolndismpgetgcanvypdujriasmaafwzlqbdmsqxcjmnwhfslneloohseiykhxbrkdwiexfakokterfsulglipltihgprkhfbmkdkebbyhihajfqfybeqjqwkkdlzhifmgwvrqdgdkbmrztukodzsnunqsdhgsfwnfjcwsltmfrhqedfuksnxdizjlzwddwrs"
},
{
"input": "500\naopxumqciwxewxvlxzebsztskjvjzwyewjztqrsuvamtvklhqrbodtncqdchjrlpywvmtgnkkwtvpggktewdgvnhydkexwoxkgltaesrtifbwpciqsvrgjtqrdnyqkgqwrryacluaqmgdwxinqieiblolyekcbzahlhxdwqcgieyfgmicvgbbitbzhejkshjunzjteyyfngigjwyqqndtjrdykzrnrpinkwtrlchhxvycrhstpecadszilicrqdeyyidohqvzfnsqfyuemigacysxvtrgxyjcvejkjstsnatfqlkeytxgsksgpcooypsmqgcluzwofaupegxppbupvtumjerohdteuenwcmqaoazohkilgpkjavcrjcslhzkyjcgfzxxzjfufichxcodcawonkxhbqgfimmlycswdzwbnmjwhbwihfoftpcqplncavmbxuwnsabiyvpcrhfgtqyaguoaigknushbqjwqmmyvsxwabrub",
"output": "ubwsymwqhukiogytfrpybswxmanpctohwhjnwdsymigbxnwcoxcffzxfcyzlcrvjplkoaamweedoemtpbpgpaozlgmpocgkgtelfasskecygtxyaieyqnzqoiydriisaethcvhcrwnpnzyrtnqwggfytzuhkeztbgcmfegqdhhzcelliinxdmalarwgqnrtgvqcwftsalkoxkyngwtgptkntvyljcqndbqlvmvsqzwyzvktsexvwxiqupaoxmcwexlzbzsjjwejtruatkhrotcdhrpwmgkwvgkedvhdewxgteribpisrjqdykqrycuqgwiqeboykbalxwciygivbibhjsjnjeynijyqdjdkrriktlhxyrspcdzlcqeydhvfsfumgcsvrxjvjjtntqkyxsspoysqcuwfuexpuvujrhtuncqozhigkacjshkjgzxjuihcdaokhqfmlcwzbmwbiffpqlcvbunaivchgqauagnsbjqmvxarb"
},
{
"input": "501\noilesjbgowlnayckhpoaitijewsyhgavnthycaecwnvzpxgjqfjyxnjcjknvvsmjbjwtcoyfbegmnnheeamvtfjkigqoanhvgdfrjchdqgowrstlmrjmcsuuwvvoeucfyhnxivosrxblfoqwikfxjnnyejdiihpenfcahtjwcnzwvxxseicvdfgqhtvefswznuyohmmljlnxubhevywpmnitnkhecsgccpstxkmdzabsnwxkokdfsogzbpnfvgudvqlstxojzfzugxbfrozveaiofrzksegdelxsdhcjlqwqlgjcqiujptoenxozhkqhcpkarretqzfkwuvbmfdcdoqliyzmlfrfhzrnkbhofuctkpeacqejwvdrlyvepudrlzncbhwrgmxrczphsoymvtuzqjscvbtqpymogupgzctepccravjcrfsadueyraqvwasravkubebojqspdntewnjohvccamvoxdauyakvehjhabpdyzyme",
"output": "mzdbhhvaudomcvonenpqoeuvravayuafcvrcecguoyqbcjztmohzrmrhczrueyrvjqaptuobnzffmylocfbukztraphkzxetjicgqqjhsldekroavofxufjxsqdgfpzofkkwsadktpcsektnpyebxllmouzsetqfvisxwnwtafehijynxkwolxsvxhfuovusmrlswgdcrdvnogkfvaenmefotjjsvkcnyfjxzncaytvgywjtapkynwgjeiolsbolachoiieshanhcewvpgqjxjjnvmbwcybgnhemtjiqahgfjhqortmjcuwvecyniorbfqifjnedipnchjczvxecdghvfwnyhmjnuhvwminhcgcsxmzbnxodsgbnvuvltozzgbrzeifzsgexdclwljquponohqckreqfwvmddqizlrhrkhfckecewdlvpdlnbwgxcpsyvuqsvtpmgpztpcajrsderqwsakbbjsdtwjhcavxaykejapyye"
}
] | 1,631,547,948 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 93 | 6,963,200 | # decoding.py
def main():
# Read input length
length = int(input())
# Read in encrypted string
source = input()
direction = 'r' if (length % 2 == 0) else 'l'
out = []
out.append(source[0])
source = source[1:]
for c in source:
if direction == 'l':
out.insert(0, c)
else:
out.append(c)
direction = 'l' if direction == 'r' else 'r'
for p in out:
print(p, end='')
if __name__ == '__main__':
main()
| Title: Decoding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is mad about coding, that is why he writes Sveta encoded messages. He calls the median letter in a word the letter which is in the middle of the word. If the word's length is even, the median letter is the left of the two middle letters. In the following examples, the median letter is highlighted: contest, info. If the word consists of single letter, then according to above definition this letter is the median letter.
Polycarp encodes each word in the following way: he writes down the median letter of the word, then deletes it and repeats the process until there are no letters left. For example, he encodes the word volga as logva.
You are given an encoding *s* of some word, your task is to decode it.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2000) — the length of the encoded word.
The second line contains the string *s* of length *n* consisting of lowercase English letters — the encoding.
Output Specification:
Print the word that Polycarp encoded.
Demo Input:
['5\nlogva\n', '2\nno\n', '4\nabba\n']
Demo Output:
['volga\n', 'no\n', 'baba\n']
Note:
In the first example Polycarp encoded the word volga. At first, he wrote down the letter l from the position 3, after that his word looked like voga. After that Polycarp wrote down the letter o from the position 2, his word became vga. Then Polycarp wrote down the letter g which was at the second position, the word became va. Then he wrote down the letter v, then the letter a. Thus, the encoding looked like logva.
In the second example Polycarp encoded the word no. He wrote down the letter n, the word became o, and he wrote down the letter o. Thus, in this example, the word and its encoding are the same.
In the third example Polycarp encoded the word baba. At first, he wrote down the letter a, which was at the position 2, after that the word looked like bba. Then he wrote down the letter b, which was at the position 2, his word looked like ba. After that he wrote down the letter b, which was at the position 1, the word looked like a, and he wrote down that letter a. Thus, the encoding is abba. | ```python
# decoding.py
def main():
# Read input length
length = int(input())
# Read in encrypted string
source = input()
direction = 'r' if (length % 2 == 0) else 'l'
out = []
out.append(source[0])
source = source[1:]
for c in source:
if direction == 'l':
out.insert(0, c)
else:
out.append(c)
direction = 'l' if direction == 'r' else 'r'
for p in out:
print(p, end='')
if __name__ == '__main__':
main()
``` | 3 |
|
877 | F | Ann and Books | PROGRAMMING | 2,300 | [
"data structures",
"flows",
"hashing"
] | null | null | In Ann's favorite book shop are as many as *n* books on math and economics. Books are numbered from 1 to *n*. Each of them contains non-negative number of problems.
Today there is a sale: any subsegment of a segment from *l* to *r* can be bought at a fixed price.
Ann decided that she wants to buy such non-empty subsegment that the sale operates on it and the number of math problems is greater than the number of economics problems exactly by *k*. Note that *k* may be positive, negative or zero.
Unfortunately, Ann is not sure on which segment the sale operates, but she has *q* assumptions. For each of them she wants to know the number of options to buy a subsegment satisfying the condition (because the time she spends on choosing depends on that).
Currently Ann is too busy solving other problems, she asks you for help. For each her assumption determine the number of subsegments of the given segment such that the number of math problems is greaten than the number of economics problems on that subsegment exactly by *k*. | The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000, <=-<=109<=≤<=*k*<=≤<=109) — the number of books and the needed difference between the number of math problems and the number of economics problems.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2), where *t**i* is 1 if the *i*-th book is on math or 2 if the *i*-th is on economics.
The third line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109), where *a**i* is the number of problems in the *i*-th book.
The fourth line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of assumptions.
Each of the next *q* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) describing the *i*-th Ann's assumption. | Print *q* lines, in the *i*-th of them print the number of subsegments for the *i*-th Ann's assumption. | [
"4 1\n1 1 1 2\n1 1 1 1\n4\n1 2\n1 3\n1 4\n3 4\n",
"4 0\n1 2 1 2\n0 0 0 0\n1\n1 4\n"
] | [
"2\n3\n4\n1\n",
"10\n"
] | In the first sample Ann can buy subsegments [1;1], [2;2], [3;3], [2;4] if they fall into the sales segment, because the number of math problems is greater by 1 on them that the number of economics problems. So we should count for each assumption the number of these subsegments that are subsegments of the given segment.
Segments [1;1] and [2;2] are subsegments of [1;2].
Segments [1;1], [2;2] and [3;3] are subsegments of [1;3].
Segments [1;1], [2;2], [3;3], [2;4] are subsegments of [1;4].
Segment [3;3] is subsegment of [3;4]. | 2,750 | [
{
"input": "4 1\n1 1 1 2\n1 1 1 1\n4\n1 2\n1 3\n1 4\n3 4",
"output": "2\n3\n4\n1"
},
{
"input": "4 0\n1 2 1 2\n0 0 0 0\n1\n1 4",
"output": "10"
},
{
"input": "10 10\n2 1 1 1 1 1 1 1 1 2\n0 10 10 0 0 10 10 10 10 0\n10\n4 10\n3 7\n9 9\n2 9\n10 10\n5 5\n2 2\n6 8\n3 4\n1 3",
"output": "7\n7\n1\n10\n0\n0\n1\n3\n2\n3"
},
{
"input": "10 -10\n1 2 1 2 1 1 2 2 2 1\n7 7 10 3 7 10 6 8 0 1\n10\n2 6\n10 10\n6 9\n5 8\n7 10\n2 7\n2 9\n2 7\n5 6\n2 8",
"output": "0\n0\n0\n0\n0\n0\n0\n0\n0\n0"
},
{
"input": "10 10\n1 1 1 1 1 2 1 2 1 2\n7 10 2 5 0 1 8 10 1 8\n10\n4 5\n1 3\n6 7\n8 10\n5 10\n1 8\n5 6\n1 5\n2 8\n9 10",
"output": "0\n1\n0\n0\n0\n1\n0\n1\n1\n0"
},
{
"input": "2 0\n1 2\n43 43\n3\n1 2\n2 2\n1 1",
"output": "1\n0\n0"
}
] | 1,509,025,231 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <bits/stdc++.h>
using namespace std;
int n,k,q,sn;
const int maxn = 100007;
int a[maxn];
int sum[maxn],res[maxn];
int qcnt = 0;
struct work{
int id,l,r;
bool operator<(const work &q)const{
int bk1 = l/sn,bk2 = q.l/sn;
if(bk1 == bk2)return r < q.r;
return bk1 < bk2;
}
}qs[maxn];
int main(){
scanf("%d%d",&n,&k);
sn = (int)sqrt(n+0.5);
for(int i = 1;i <= n;++i) {
int tmp;
scanf("%d",&tmp);
a[i] = tmp == 1?1:-1;
}
for(int i = 1;i <= n;++i){
int tp;scanf("%d",&tp);
a[i] *= tp;
sum[i] = sum[i-1] + a[i];
}
scanf("%d",&q);
while(q--){
int l,r;
scanf("%d%d",&l,&r);
qs[qcnt] = (work){qcnt,l,r};
qcnt++;
}
sort(qs,qs+qcnt);
int l = -1,r = -1;
int ans = 0;
map<int,int> mp;
//mp[0] = 1;
for(int i = 0;i < qcnt;++i){
if(l == -1) l = qs[i].l,r = qs[i].l-1,mp[sum[qs[i].l-1]] ++;
for(;l < qs[i].l;l++){
mp[sum[l-1]] --;
ans -= mp[sum[l-1]+k];
}
for(r++;r <= qs[i].r;r++){
ans += mp[sum[r]-k];
mp[sum[r]]++;
}
--r;
for(--l;l >= qs[i].l;--l){
ans += mp[sum[l-1]+k];
mp[sum[l-1]]++;
}
++l;
for(r;r > qs[i].r;--r){
mp[sum[r]]--;
ans -= mp[sum[r]-k];
}
res[qs[i].id] = ans;
}
for(int i = 0;i < qcnt;i++){
printf("%d\n",res[i]);
}
return 0;
}
/*
4 1
1 1 1 2
1 1 1 1
1
3 4
*/
| Title: Ann and Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Ann's favorite book shop are as many as *n* books on math and economics. Books are numbered from 1 to *n*. Each of them contains non-negative number of problems.
Today there is a sale: any subsegment of a segment from *l* to *r* can be bought at a fixed price.
Ann decided that she wants to buy such non-empty subsegment that the sale operates on it and the number of math problems is greater than the number of economics problems exactly by *k*. Note that *k* may be positive, negative or zero.
Unfortunately, Ann is not sure on which segment the sale operates, but she has *q* assumptions. For each of them she wants to know the number of options to buy a subsegment satisfying the condition (because the time she spends on choosing depends on that).
Currently Ann is too busy solving other problems, she asks you for help. For each her assumption determine the number of subsegments of the given segment such that the number of math problems is greaten than the number of economics problems on that subsegment exactly by *k*.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000, <=-<=109<=≤<=*k*<=≤<=109) — the number of books and the needed difference between the number of math problems and the number of economics problems.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2), where *t**i* is 1 if the *i*-th book is on math or 2 if the *i*-th is on economics.
The third line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109), where *a**i* is the number of problems in the *i*-th book.
The fourth line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of assumptions.
Each of the next *q* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) describing the *i*-th Ann's assumption.
Output Specification:
Print *q* lines, in the *i*-th of them print the number of subsegments for the *i*-th Ann's assumption.
Demo Input:
['4 1\n1 1 1 2\n1 1 1 1\n4\n1 2\n1 3\n1 4\n3 4\n', '4 0\n1 2 1 2\n0 0 0 0\n1\n1 4\n']
Demo Output:
['2\n3\n4\n1\n', '10\n']
Note:
In the first sample Ann can buy subsegments [1;1], [2;2], [3;3], [2;4] if they fall into the sales segment, because the number of math problems is greater by 1 on them that the number of economics problems. So we should count for each assumption the number of these subsegments that are subsegments of the given segment.
Segments [1;1] and [2;2] are subsegments of [1;2].
Segments [1;1], [2;2] and [3;3] are subsegments of [1;3].
Segments [1;1], [2;2], [3;3], [2;4] are subsegments of [1;4].
Segment [3;3] is subsegment of [3;4]. | ```python
#include <bits/stdc++.h>
using namespace std;
int n,k,q,sn;
const int maxn = 100007;
int a[maxn];
int sum[maxn],res[maxn];
int qcnt = 0;
struct work{
int id,l,r;
bool operator<(const work &q)const{
int bk1 = l/sn,bk2 = q.l/sn;
if(bk1 == bk2)return r < q.r;
return bk1 < bk2;
}
}qs[maxn];
int main(){
scanf("%d%d",&n,&k);
sn = (int)sqrt(n+0.5);
for(int i = 1;i <= n;++i) {
int tmp;
scanf("%d",&tmp);
a[i] = tmp == 1?1:-1;
}
for(int i = 1;i <= n;++i){
int tp;scanf("%d",&tp);
a[i] *= tp;
sum[i] = sum[i-1] + a[i];
}
scanf("%d",&q);
while(q--){
int l,r;
scanf("%d%d",&l,&r);
qs[qcnt] = (work){qcnt,l,r};
qcnt++;
}
sort(qs,qs+qcnt);
int l = -1,r = -1;
int ans = 0;
map<int,int> mp;
//mp[0] = 1;
for(int i = 0;i < qcnt;++i){
if(l == -1) l = qs[i].l,r = qs[i].l-1,mp[sum[qs[i].l-1]] ++;
for(;l < qs[i].l;l++){
mp[sum[l-1]] --;
ans -= mp[sum[l-1]+k];
}
for(r++;r <= qs[i].r;r++){
ans += mp[sum[r]-k];
mp[sum[r]]++;
}
--r;
for(--l;l >= qs[i].l;--l){
ans += mp[sum[l-1]+k];
mp[sum[l-1]]++;
}
++l;
for(r;r > qs[i].r;--r){
mp[sum[r]]--;
ans -= mp[sum[r]-k];
}
res[qs[i].id] = ans;
}
for(int i = 0;i < qcnt;i++){
printf("%d\n",res[i]);
}
return 0;
}
/*
4 1
1 1 1 2
1 1 1 1
1
3 4
*/
``` | -1 |
|
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
] | A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] | [
"word\nl10n\ni18n\np43s\n"
] | none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,681,325,440 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | n=int(input())
long_word=[]
for i in range(n):
x=input()
long_word.append(x)
for i in long_word:
if len(i)<=4:
print(i)
else:
print(i[0],end='')
print(len(i[1:len(i)-1]),end='')
print(i[len(i)-1])
| Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
n=int(input())
long_word=[]
for i in range(n):
x=input()
long_word.append(x)
for i in long_word:
if len(i)<=4:
print(i)
else:
print(i[0],end='')
print(len(i[1:len(i)-1]),end='')
print(i[len(i)-1])
``` | 0 |
270 | A | Fancy Fence | PROGRAMMING | 1,100 | [
"geometry",
"implementation",
"math"
] | null | null | Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? | The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees. | For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. | [
"3\n30\n60\n90\n"
] | [
"NO\nYES\nYES\n"
] | In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | 500 | [
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,697,192,027 | 2,147,483,647 | Python 3 | OK | TESTS | 3 | 60 | 0 | #王铭健，工学院 2300011118
t = int(input())
result_list = []
for i in range(t):
angle = int(input())
if 360 % (180 - angle) == 0:
result_list.append('YES')
else:
result_list.append('NO')
for j in result_list:
print(j) | Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | ```python
#王铭健，工学院 2300011118
t = int(input())
result_list = []
for i in range(t):
angle = int(input())
if 360 % (180 - angle) == 0:
result_list.append('YES')
else:
result_list.append('NO')
for j in result_list:
print(j)
``` | 3 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,653,331,081 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 92 | 0 | m, n= map(int,input().split())
total = int(m*n / 2)
print(total) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
m, n= map(int,input().split())
total = int(m*n / 2)
print(total)
``` | 3.977 |
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,649,590,934 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 0 | 124 | 3,379,200 | w = input()
s = 0
d = 0
for char in w:
if char.isupper():
d += 1
else:
s += 1
if d > s:
w = w.d()
else:
w = w.s()
print(w) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
w = input()
s = 0
d = 0
for char in w:
if char.isupper():
d += 1
else:
s += 1
if d > s:
w = w.d()
else:
w = w.s()
print(w)
``` | -1 |
90 | A | Cableway | PROGRAMMING | 1,000 | [
"greedy",
"math"
] | A. Cableway | 2 | 256 | A group of university students wants to get to the top of a mountain to have a picnic there. For that they decided to use a cableway.
A cableway is represented by some cablecars, hanged onto some cable stations by a cable. A cable is scrolled cyclically between the first and the last cable stations (the first of them is located at the bottom of the mountain and the last one is located at the top). As the cable moves, the cablecar attached to it move as well.
The number of cablecars is divisible by three and they are painted three colors: red, green and blue, in such manner that after each red cablecar goes a green one, after each green cablecar goes a blue one and after each blue cablecar goes a red one. Each cablecar can transport no more than two people, the cablecars arrive with the periodicity of one minute (i. e. every minute) and it takes exactly 30 minutes for a cablecar to get to the top.
All students are divided into three groups: *r* of them like to ascend only in the red cablecars, *g* of them prefer only the green ones and *b* of them prefer only the blue ones. A student never gets on a cablecar painted a color that he doesn't like,
The first cablecar to arrive (at the moment of time 0) is painted red. Determine the least time it will take all students to ascend to the mountain top. | The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=100). It is guaranteed that *r*<=+<=*g*<=+<=*b*<=><=0, it means that the group consists of at least one student. | Print a single number — the minimal time the students need for the whole group to ascend to the top of the mountain. | [
"1 3 2\n",
"3 2 1\n"
] | [
"34",
"33"
] | Let's analyze the first sample.
At the moment of time 0 a red cablecar comes and one student from the *r* group get on it and ascends to the top at the moment of time 30.
At the moment of time 1 a green cablecar arrives and two students from the *g* group get on it; they get to the top at the moment of time 31.
At the moment of time 2 comes the blue cablecar and two students from the *b* group get on it. They ascend to the top at the moment of time 32.
At the moment of time 3 a red cablecar arrives but the only student who is left doesn't like red and the cablecar leaves empty.
At the moment of time 4 a green cablecar arrives and one student from the *g* group gets on it. He ascends to top at the moment of time 34.
Thus, all the students are on the top, overall the ascension took exactly 34 minutes. | 500 | [
{
"input": "1 3 2",
"output": "34"
},
{
"input": "3 2 1",
"output": "33"
},
{
"input": "3 5 2",
"output": "37"
},
{
"input": "10 10 10",
"output": "44"
},
{
"input": "29 7 24",
"output": "72"
},
{
"input": "28 94 13",
"output": "169"
},
{
"input": "90 89 73",
"output": "163"
},
{
"input": "0 0 1",
"output": "32"
},
{
"input": "0 0 2",
"output": "32"
},
{
"input": "0 1 0",
"output": "31"
},
{
"input": "0 1 1",
"output": "32"
},
{
"input": "0 1 2",
"output": "32"
},
{
"input": "0 2 0",
"output": "31"
},
{
"input": "0 2 1",
"output": "32"
},
{
"input": "0 2 2",
"output": "32"
},
{
"input": "1 0 0",
"output": "30"
},
{
"input": "1 0 1",
"output": "32"
},
{
"input": "1 0 2",
"output": "32"
},
{
"input": "1 1 0",
"output": "31"
},
{
"input": "1 1 1",
"output": "32"
},
{
"input": "1 1 2",
"output": "32"
},
{
"input": "1 2 0",
"output": "31"
},
{
"input": "1 2 1",
"output": "32"
},
{
"input": "1 2 2",
"output": "32"
},
{
"input": "2 0 0",
"output": "30"
},
{
"input": "2 0 1",
"output": "32"
},
{
"input": "2 0 2",
"output": "32"
},
{
"input": "2 1 0",
"output": "31"
},
{
"input": "2 1 1",
"output": "32"
},
{
"input": "2 1 2",
"output": "32"
},
{
"input": "2 2 0",
"output": "31"
},
{
"input": "2 2 1",
"output": "32"
},
{
"input": "2 2 2",
"output": "32"
},
{
"input": "4 5 2",
"output": "37"
},
{
"input": "5 7 8",
"output": "41"
},
{
"input": "13 25 19",
"output": "67"
},
{
"input": "29 28 30",
"output": "74"
},
{
"input": "45 52 48",
"output": "106"
},
{
"input": "68 72 58",
"output": "136"
},
{
"input": "89 92 90",
"output": "166"
},
{
"input": "99 97 98",
"output": "177"
},
{
"input": "89 97 2",
"output": "175"
},
{
"input": "96 3 92",
"output": "171"
},
{
"input": "1 99 87",
"output": "178"
},
{
"input": "95 2 3",
"output": "171"
},
{
"input": "2 97 3",
"output": "175"
},
{
"input": "2 2 99",
"output": "179"
},
{
"input": "100 100 100",
"output": "179"
},
{
"input": "100 0 100",
"output": "179"
},
{
"input": "0 100 100",
"output": "179"
},
{
"input": "100 100 0",
"output": "178"
},
{
"input": "100 0 0",
"output": "177"
},
{
"input": "0 100 0",
"output": "178"
},
{
"input": "0 0 100",
"output": "179"
},
{
"input": "5 4 5",
"output": "38"
}
] | 1,555,107,452 | 2,147,483,647 | Python 3 | OK | TESTS | 55 | 218 | 0 | import math
m = 0
p = 0
for pos, i in enumerate(map(int, input().split())):
if math.ceil(i/2) >= m:
m = math.ceil(i/2)
p = pos
res = 0
m -= 1
while m > 0:
res += 3
m -= 1
print(res + p + 30) | Title: Cableway
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A group of university students wants to get to the top of a mountain to have a picnic there. For that they decided to use a cableway.
A cableway is represented by some cablecars, hanged onto some cable stations by a cable. A cable is scrolled cyclically between the first and the last cable stations (the first of them is located at the bottom of the mountain and the last one is located at the top). As the cable moves, the cablecar attached to it move as well.
The number of cablecars is divisible by three and they are painted three colors: red, green and blue, in such manner that after each red cablecar goes a green one, after each green cablecar goes a blue one and after each blue cablecar goes a red one. Each cablecar can transport no more than two people, the cablecars arrive with the periodicity of one minute (i. e. every minute) and it takes exactly 30 minutes for a cablecar to get to the top.
All students are divided into three groups: *r* of them like to ascend only in the red cablecars, *g* of them prefer only the green ones and *b* of them prefer only the blue ones. A student never gets on a cablecar painted a color that he doesn't like,
The first cablecar to arrive (at the moment of time 0) is painted red. Determine the least time it will take all students to ascend to the mountain top.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=100). It is guaranteed that *r*<=+<=*g*<=+<=*b*<=><=0, it means that the group consists of at least one student.
Output Specification:
Print a single number — the minimal time the students need for the whole group to ascend to the top of the mountain.
Demo Input:
['1 3 2\n', '3 2 1\n']
Demo Output:
['34', '33']
Note:
Let's analyze the first sample.
At the moment of time 0 a red cablecar comes and one student from the *r* group get on it and ascends to the top at the moment of time 30.
At the moment of time 1 a green cablecar arrives and two students from the *g* group get on it; they get to the top at the moment of time 31.
At the moment of time 2 comes the blue cablecar and two students from the *b* group get on it. They ascend to the top at the moment of time 32.
At the moment of time 3 a red cablecar arrives but the only student who is left doesn't like red and the cablecar leaves empty.
At the moment of time 4 a green cablecar arrives and one student from the *g* group gets on it. He ascends to top at the moment of time 34.
Thus, all the students are on the top, overall the ascension took exactly 34 minutes. | ```python
import math
m = 0
p = 0
for pos, i in enumerate(map(int, input().split())):
if math.ceil(i/2) >= m:
m = math.ceil(i/2)
p = pos
res = 0
m -= 1
while m > 0:
res += 3
m -= 1
print(res + p + 30)
``` | 3.9455 |
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,650,377,596 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 0 | 154 | 3,379,200 | s = input()
x = 0
y = 0
for z in s:
if isupper(z) == True:
y += 1
else:
x += 1
if x >= y:
print(lower(s))
else:
print(upper(s)) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
s = input()
x = 0
y = 0
for z in s:
if isupper(z) == True:
y += 1
else:
x += 1
if x >= y:
print(lower(s))
else:
print(upper(s))
``` | -1 |
414 | B | Mashmokh and ACM | PROGRAMMING | 1,400 | [
"combinatorics",
"dp",
"number theory"
] | null | null | Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following.
A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1).
Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7). | The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000). | Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7). | [
"3 2\n",
"6 4\n",
"2 1\n"
] | [
"5\n",
"39\n",
"2\n"
] | In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3]. | 1,000 | [
{
"input": "3 2",
"output": "5"
},
{
"input": "6 4",
"output": "39"
},
{
"input": "2 1",
"output": "2"
},
{
"input": "1478 194",
"output": "312087753"
},
{
"input": "1415 562",
"output": "953558593"
},
{
"input": "1266 844",
"output": "735042656"
},
{
"input": "680 1091",
"output": "351905328"
},
{
"input": "1229 1315",
"output": "100240813"
},
{
"input": "1766 1038",
"output": "435768250"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "2000 100",
"output": "983281065"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2000 1000",
"output": "228299266"
},
{
"input": "1928 1504",
"output": "81660104"
},
{
"input": "2000 2000",
"output": "585712681"
},
{
"input": "29 99",
"output": "23125873"
},
{
"input": "56 48",
"output": "20742237"
},
{
"input": "209 370",
"output": "804680894"
},
{
"input": "83 37",
"output": "22793555"
},
{
"input": "49 110",
"output": "956247348"
},
{
"input": "217 3",
"output": "4131"
},
{
"input": "162 161",
"output": "591739753"
},
{
"input": "273 871",
"output": "151578252"
},
{
"input": "43 1640",
"output": "173064407"
},
{
"input": "1472 854",
"output": "748682383"
},
{
"input": "1639 1056",
"output": "467464129"
},
{
"input": "359 896",
"output": "770361185"
},
{
"input": "1544 648",
"output": "9278889"
},
{
"input": "436 1302",
"output": "874366220"
},
{
"input": "1858 743",
"output": "785912917"
},
{
"input": "991 1094",
"output": "483493131"
},
{
"input": "1013 1550",
"output": "613533467"
},
{
"input": "675 741",
"output": "474968598"
},
{
"input": "1420 1223",
"output": "922677437"
},
{
"input": "1544 1794",
"output": "933285446"
},
{
"input": "1903 1612",
"output": "620810276"
},
{
"input": "500 1304",
"output": "706176027"
},
{
"input": "525 314",
"output": "245394744"
},
{
"input": "39 1930",
"output": "992125404"
},
{
"input": "1895 753",
"output": "180474828"
},
{
"input": "1722 1474",
"output": "742424590"
},
{
"input": "1153 1823",
"output": "791493066"
},
{
"input": "1409 734",
"output": "627413973"
},
{
"input": "478 1301",
"output": "476483030"
},
{
"input": "1887 1729",
"output": "730033374"
},
{
"input": "1610 774",
"output": "50897314"
},
{
"input": "1770 679",
"output": "235295539"
},
{
"input": "987 1292",
"output": "560110556"
},
{
"input": "1707 1117",
"output": "237674323"
},
{
"input": "1424 1431",
"output": "184145444"
},
{
"input": "86 1078",
"output": "252515343"
},
{
"input": "1066 995",
"output": "180753612"
},
{
"input": "1024 133",
"output": "392603027"
},
{
"input": "659 974",
"output": "397026719"
},
{
"input": "1349 1606",
"output": "522392901"
},
{
"input": "473 211",
"output": "809550224"
},
{
"input": "634 1825",
"output": "438513382"
},
{
"input": "22 373",
"output": "907321755"
},
{
"input": "531 147",
"output": "242883376"
},
{
"input": "1307 1247",
"output": "21512331"
},
{
"input": "415 735",
"output": "393705804"
},
{
"input": "1659 1501",
"output": "225266660"
},
{
"input": "1454 296",
"output": "750032659"
},
{
"input": "158 772",
"output": "850911301"
},
{
"input": "2000 1",
"output": "2000"
}
] | 1,544,274,973 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 186 | 2,150,400 | import math
n, k = [*map(int, input().split())]
prime = [1]
f = [False] * 2000
for i in range(2, 2000):
if f[i]:
continue
f[i] = True
prime.append(i)
j = 1
while i * j < 2000:
f[i * j] = True
j += 1
f = [[0] * (n + 1) if i != 1 else [1] * (n + 1) for i in range(k + 1)]
div = [[]]
f[1][0] = 0
for i in range(1, n + 1):
j = 0
div.append([])
while prime[j] <= math.sqrt(i):
if not (i % prime[j]):
div[i] += [prime[j]]
if i // prime[j] != prime[j]:
div[i] += [i // prime[j]]
j += 1
for j in range(2, k + 1):
for l in div[i]:
f[j][i] += f[j - 1][i // l]
f[j][i] %= 10 ** 9 + 7
ans = 0
for i in f[k]:
ans += i
ans %= 10 ** 9 + 7
print(ans)
| Title: Mashmokh and ACM
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following.
A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1).
Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7).
Input Specification:
The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000).
Output Specification:
Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7).
Demo Input:
['3 2\n', '6 4\n', '2 1\n']
Demo Output:
['5\n', '39\n', '2\n']
Note:
In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3]. | ```python
import math
n, k = [*map(int, input().split())]
prime = [1]
f = [False] * 2000
for i in range(2, 2000):
if f[i]:
continue
f[i] = True
prime.append(i)
j = 1
while i * j < 2000:
f[i * j] = True
j += 1
f = [[0] * (n + 1) if i != 1 else [1] * (n + 1) for i in range(k + 1)]
div = [[]]
f[1][0] = 0
for i in range(1, n + 1):
j = 0
div.append([])
while prime[j] <= math.sqrt(i):
if not (i % prime[j]):
div[i] += [prime[j]]
if i // prime[j] != prime[j]:
div[i] += [i // prime[j]]
j += 1
for j in range(2, k + 1):
for l in div[i]:
f[j][i] += f[j - 1][i // l]
f[j][i] %= 10 ** 9 + 7
ans = 0
for i in f[k]:
ans += i
ans %= 10 ** 9 + 7
print(ans)
``` | 0 |
|
895 | A | Pizza Separation | PROGRAMMING | 1,200 | [
"brute force",
"implementation"
] | null | null | Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty. | The first line contains one integer *n* (1<=≤<=*n*<=≤<=360) — the number of pieces into which the delivered pizza was cut.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360) — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360. | Print one integer — the minimal difference between angles of sectors that will go to Vasya and Petya. | [
"4\n90 90 90 90\n",
"3\n100 100 160\n",
"1\n360\n",
"4\n170 30 150 10\n"
] | [
"0\n",
"40\n",
"360\n",
"0\n"
] | In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0.
In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360.
In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0.
Picture explaning fourth sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector. | 500 | [
{
"input": "4\n90 90 90 90",
"output": "0"
},
{
"input": "3\n100 100 160",
"output": "40"
},
{
"input": "1\n360",
"output": "360"
},
{
"input": "4\n170 30 150 10",
"output": "0"
},
{
"input": "5\n10 10 10 10 320",
"output": "280"
},
{
"input": "8\n45 45 45 45 45 45 45 45",
"output": "0"
},
{
"input": "3\n120 120 120",
"output": "120"
},
{
"input": "5\n110 90 70 50 40",
"output": "40"
},
{
"input": "2\n170 190",
"output": "20"
},
{
"input": "15\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 10",
"output": "10"
},
{
"input": "5\n30 60 180 60 30",
"output": "0"
},
{
"input": "2\n359 1",
"output": "358"
},
{
"input": "5\n100 100 30 100 30",
"output": "40"
},
{
"input": "5\n36 34 35 11 244",
"output": "128"
},
{
"input": "5\n96 94 95 71 4",
"output": "18"
},
{
"input": "2\n85 275",
"output": "190"
},
{
"input": "3\n281 67 12",
"output": "202"
},
{
"input": "5\n211 113 25 9 2",
"output": "62"
},
{
"input": "13\n286 58 6 1 1 1 1 1 1 1 1 1 1",
"output": "212"
},
{
"input": "15\n172 69 41 67 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "20\n226 96 2 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "92"
},
{
"input": "50\n148 53 32 11 4 56 8 2 5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n1 1 358",
"output": "356"
},
{
"input": "20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 341",
"output": "322"
},
{
"input": "33\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 328",
"output": "296"
},
{
"input": "70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 291",
"output": "222"
},
{
"input": "130\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 231",
"output": "102"
},
{
"input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 161",
"output": "0"
},
{
"input": "222\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 139",
"output": "0"
},
{
"input": "10\n8 3 11 4 1 10 10 1 8 304",
"output": "248"
},
{
"input": "12\n8 7 7 3 11 2 10 1 10 8 10 283",
"output": "206"
},
{
"input": "13\n10 8 9 10 5 9 4 1 10 11 1 7 275",
"output": "190"
},
{
"input": "14\n1 6 3 11 9 5 9 8 5 6 7 3 7 280",
"output": "200"
},
{
"input": "15\n10 11 5 4 11 5 4 1 5 4 5 5 9 6 275",
"output": "190"
},
{
"input": "30\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 189",
"output": "18"
},
{
"input": "70\n5 3 6 8 9 2 8 9 11 5 2 8 9 11 7 6 6 9 7 11 7 6 3 8 2 4 4 8 4 3 2 2 3 5 6 5 11 2 7 7 5 8 10 5 2 1 10 9 4 10 7 1 8 10 9 1 5 1 1 1 2 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "29\n2 10 1 5 7 2 9 11 9 9 10 8 4 11 2 5 4 1 4 9 6 10 8 3 1 3 8 9 189",
"output": "18"
},
{
"input": "35\n3 4 11 4 4 2 3 4 3 9 7 10 2 7 8 3 11 3 6 4 6 7 11 10 8 7 6 7 2 8 5 3 2 2 168",
"output": "0"
},
{
"input": "60\n4 10 3 10 6 3 11 8 11 9 3 5 9 2 6 5 6 9 4 10 1 1 3 7 2 10 5 5 3 10 5 2 1 2 9 11 11 9 11 4 11 7 5 6 10 9 3 4 7 8 7 3 6 7 8 5 1 1 1 5",
"output": "0"
},
{
"input": "71\n3 11 8 1 10 1 7 9 6 4 11 10 11 2 4 1 11 7 9 10 11 4 8 7 11 3 8 4 1 8 4 2 9 9 7 10 10 9 5 7 9 7 2 1 7 6 5 11 5 9 4 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "63\n2 11 5 8 7 9 9 8 10 5 9 10 11 8 10 2 3 5 3 7 5 10 2 9 4 8 1 8 5 9 7 7 1 8 7 7 9 10 10 10 8 7 7 2 2 8 9 7 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "81\n5 8 7 11 2 7 1 1 5 8 7 2 3 11 4 9 7 6 4 4 2 1 1 7 9 4 1 8 3 1 4 10 7 9 9 8 11 3 4 3 10 8 6 4 7 2 4 3 6 11 11 10 7 10 2 10 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "47\n5 3 7 4 2 7 8 1 9 10 5 11 10 7 7 5 1 3 2 11 3 8 6 1 6 10 8 3 2 10 5 6 8 6 9 7 10 9 7 4 8 11 10 1 5 11 68",
"output": "0"
},
{
"input": "100\n5 8 9 3 2 3 9 8 11 10 4 8 1 1 1 1 6 5 10 9 5 3 7 7 2 11 10 2 3 2 2 8 7 3 5 5 10 9 2 5 10 6 7 7 4 7 7 8 2 8 9 9 2 4 1 1 3 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "120\n9 11 3 7 3 7 9 1 10 7 11 4 1 5 3 5 6 3 1 11 8 8 11 7 3 5 1 9 1 7 10 10 10 10 9 5 4 8 2 8 2 1 4 5 3 11 3 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "200\n7 7 9 8 2 8 5 8 3 9 7 10 2 9 11 8 11 7 5 2 6 3 11 9 5 1 10 2 1 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "220\n3 2 8 1 3 5 5 11 1 5 2 6 9 2 2 6 8 10 7 1 3 2 10 9 10 10 4 10 9 5 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "6\n27 15 28 34 41 215",
"output": "70"
},
{
"input": "7\n41 38 41 31 22 41 146",
"output": "14"
},
{
"input": "8\n24 27 34 23 29 23 30 170",
"output": "20"
},
{
"input": "9\n11 11 20 20 33 32 35 26 172",
"output": "6"
},
{
"input": "10\n36 13 28 13 33 34 23 25 34 121",
"output": "0"
},
{
"input": "11\n19 37 13 41 37 15 32 12 19 35 100",
"output": "10"
},
{
"input": "12\n37 25 34 38 21 24 34 38 11 29 28 41",
"output": "2"
},
{
"input": "13\n24 40 20 26 25 29 39 29 35 28 19 18 28",
"output": "2"
},
{
"input": "14\n11 21 40 19 28 34 13 16 23 30 34 22 25 44",
"output": "4"
},
{
"input": "3\n95 91 174",
"output": "12"
},
{
"input": "4\n82 75 78 125",
"output": "46"
},
{
"input": "6\n87 75 88 94 15 1",
"output": "4"
},
{
"input": "10\n27 52 58 64 45 64 1 19 2 28",
"output": "12"
},
{
"input": "50\n14 12 11 8 1 6 11 6 7 8 4 11 4 5 7 3 5 4 7 24 10 2 3 4 6 13 2 1 8 7 5 13 10 8 5 20 1 2 23 7 14 3 4 4 2 8 8 2 6 1",
"output": "0"
},
{
"input": "100\n3 3 4 3 3 6 3 2 8 2 13 3 1 1 2 1 3 4 1 7 1 2 2 6 3 2 10 3 1 2 5 6 2 3 3 2 3 11 8 3 2 6 1 3 3 4 7 7 2 2 1 2 6 3 3 2 3 1 3 8 2 6 4 2 1 12 2 2 2 1 4 1 4 1 3 1 3 1 5 2 6 6 7 1 2 3 2 4 4 2 5 9 8 2 4 6 5 1 1 3",
"output": "0"
},
{
"input": "150\n1 5 1 2 2 2 1 4 2 2 2 3 1 2 1 2 2 2 2 1 2 2 2 1 5 3 4 1 3 4 5 2 4 2 1 2 2 1 1 2 3 2 4 2 2 3 3 1 1 5 2 3 2 1 9 2 1 1 2 1 4 1 1 3 2 2 2 1 2 2 2 1 3 3 4 2 2 1 3 3 3 1 4 3 4 1 2 2 1 1 1 2 2 5 4 1 1 1 2 1 2 3 2 2 6 3 3 3 1 2 1 1 2 8 2 2 4 3 4 5 3 1 4 2 2 2 2 1 4 4 1 1 2 2 4 9 6 3 1 1 2 1 3 4 1 3 2 2 2 1",
"output": "0"
},
{
"input": "200\n1 2 1 3 1 3 1 2 1 4 6 1 2 2 2 2 1 1 1 1 3 2 1 2 2 2 1 2 2 2 2 1 1 1 3 2 3 1 1 2 1 1 2 1 1 1 1 1 1 2 1 2 2 4 1 3 1 2 1 2 2 1 2 1 3 1 1 2 2 1 1 1 1 2 4 1 2 1 1 1 2 1 3 1 1 3 1 2 2 4 1 1 2 1 2 1 2 2 2 2 1 1 2 1 2 1 3 3 1 1 1 2 1 3 3 1 2 1 3 1 3 3 1 2 2 1 4 1 2 2 1 2 2 4 2 5 1 2 2 1 2 1 2 1 5 2 1 2 2 1 2 4 1 2 2 4 2 3 2 3 1 2 1 1 2 2 2 1 1 2 1 4 1 2 1 1 2 1 2 3 1 1 1 2 2 3 1 3 2 2 3 1 2 1 2 1 1 2 1 2",
"output": "0"
},
{
"input": "5\n35 80 45 100 100",
"output": "40"
},
{
"input": "4\n90 179 90 1",
"output": "2"
},
{
"input": "5\n50 50 20 160 80",
"output": "0"
},
{
"input": "5\n30 175 30 5 120",
"output": "10"
},
{
"input": "4\n170 30 10 150",
"output": "20"
},
{
"input": "6\n90 30 90 30 90 30",
"output": "60"
},
{
"input": "4\n70 80 110 100",
"output": "20"
},
{
"input": "7\n35 45 70 100 10 10 90",
"output": "0"
},
{
"input": "6\n50 90 10 90 20 100",
"output": "20"
},
{
"input": "6\n10 155 162 1 26 6",
"output": "18"
},
{
"input": "7\n80 90 80 45 10 10 45",
"output": "20"
},
{
"input": "4\n18 36 162 144",
"output": "36"
},
{
"input": "5\n20 50 50 160 80",
"output": "40"
},
{
"input": "5\n10 30 140 20 160",
"output": "0"
},
{
"input": "6\n90 80 60 50 40 40",
"output": "20"
},
{
"input": "9\n40 20 20 20 20 20 20 40 160",
"output": "40"
},
{
"input": "4\n90 54 90 126",
"output": "72"
},
{
"input": "4\n150 170 30 10",
"output": "20"
},
{
"input": "8\n130 12 13 85 41 67 5 7",
"output": "26"
},
{
"input": "7\n70 170 20 10 30 30 30",
"output": "20"
},
{
"input": "8\n100 100 50 50 15 15 15 15",
"output": "40"
},
{
"input": "4\n100 70 80 110",
"output": "20"
},
{
"input": "5\n160 130 40 20 10",
"output": "20"
},
{
"input": "4\n20 149 151 40",
"output": "22"
},
{
"input": "4\n100 10 100 150",
"output": "60"
},
{
"input": "6\n19 64 105 168 1 3",
"output": "16"
},
{
"input": "8\n10 10 70 70 90 90 10 10",
"output": "0"
}
] | 1,532,456,711 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 108 | 0 | # your code goes here
n = int(input())
a = list(input().split(' '))
for i in range(len(a)):
a[i] = int(a[i])
mid = len(a)//2
if len(a)%2 == 0:
v = a[:mid]
p = a[mid:]
else:
v = a[:mid + 1]
p = a[mid + 1:]
sumv = sum(v);
sump = sum(p);
print(abs(sumv-sump)) | Title: Pizza Separation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Students Vasya and Petya are studying at the BSU (Byteland State University). At one of the breaks they decided to order a pizza. In this problem pizza is a circle of some radius. The pizza was delivered already cut into *n* pieces. The *i*-th piece is a sector of angle equal to *a**i*. Vasya and Petya want to divide all pieces of pizza into two continuous sectors in such way that the difference between angles of these sectors is minimal. Sector angle is sum of angles of all pieces in it. Pay attention, that one of sectors can be empty.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=360) — the number of pieces into which the delivered pizza was cut.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=360) — the angles of the sectors into which the pizza was cut. The sum of all *a**i* is 360.
Output Specification:
Print one integer — the minimal difference between angles of sectors that will go to Vasya and Petya.
Demo Input:
['4\n90 90 90 90\n', '3\n100 100 160\n', '1\n360\n', '4\n170 30 150 10\n']
Demo Output:
['0\n', '40\n', '360\n', '0\n']
Note:
In first sample Vasya can take 1 and 2 pieces, Petya can take 3 and 4 pieces. Then the answer is |(90 + 90) - (90 + 90)| = 0.
In third sample there is only one piece of pizza that can be taken by only one from Vasya and Petya. So the answer is |360 - 0| = 360.
In fourth sample Vasya can take 1 and 4 pieces, then Petya will take 2 and 3 pieces. So the answer is |(170 + 10) - (30 + 150)| = 0.
Picture explaning fourth sample:
<img class="tex-graphics" src="https://espresso.codeforces.com/4bb3450aca241f92fedcba5479bf1b6d22cf813d.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Both red and green sectors consist of two adjacent pieces of pizza. So Vasya can take green sector, then Petya will take red sector. | ```python
# your code goes here
n = int(input())
a = list(input().split(' '))
for i in range(len(a)):
a[i] = int(a[i])
mid = len(a)//2
if len(a)%2 == 0:
v = a[:mid]
p = a[mid:]
else:
v = a[:mid + 1]
p = a[mid + 1:]
sumv = sum(v);
sump = sum(p);
print(abs(sumv-sump))
``` | 0 |
|
814 | B | An express train to reveries | PROGRAMMING | 1,300 | [
"constructive algorithms"
] | null | null | Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night. | The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds. | Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists. | [
"5\n1 2 3 4 3\n1 2 5 4 5\n",
"5\n4 4 2 3 1\n5 4 5 3 1\n",
"4\n1 1 3 4\n1 4 3 4\n"
] | [
"1 2 5 4 3\n",
"5 4 2 3 1\n",
"1 2 3 4\n"
] | In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints. | 1,000 | [
{
"input": "5\n1 2 3 4 3\n1 2 5 4 5",
"output": "1 2 5 4 3"
},
{
"input": "5\n4 4 2 3 1\n5 4 5 3 1",
"output": "5 4 2 3 1"
},
{
"input": "4\n1 1 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "10\n1 2 3 4 7 6 7 8 9 10\n1 2 3 4 5 6 5 8 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 7 10\n1 2 3 4 5 6 7 8 9 9",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n1 2 3 4 5 6 7 8 4 10\n1 2 3 4 5 6 7 6 9 10",
"output": "1 2 3 4 5 6 7 8 9 10"
},
{
"input": "10\n8 6 1 7 9 3 5 2 10 9\n8 6 1 7 4 3 5 2 10 4",
"output": "8 6 1 7 4 3 5 2 10 9"
},
{
"input": "10\n2 9 7 7 8 5 4 10 6 1\n2 8 7 3 8 5 4 10 6 1",
"output": "2 9 7 3 8 5 4 10 6 1"
},
{
"input": "2\n2 2\n1 1",
"output": "1 2"
},
{
"input": "3\n1 2 2\n1 3 3",
"output": "1 3 2"
},
{
"input": "3\n2 2 3\n1 2 1",
"output": "1 2 3"
},
{
"input": "3\n1 3 3\n1 1 3",
"output": "1 2 3"
},
{
"input": "3\n2 1 1\n2 3 3",
"output": "2 3 1"
},
{
"input": "3\n3 3 2\n1 1 2",
"output": "1 3 2"
},
{
"input": "3\n1 3 3\n3 3 2",
"output": "1 3 2"
},
{
"input": "4\n3 2 3 4\n1 2 1 4",
"output": "1 2 3 4"
},
{
"input": "4\n2 2 3 4\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 4 4\n2 2 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n4 1 3 4\n2 1 3 2",
"output": "2 1 3 4"
},
{
"input": "4\n3 2 1 3\n4 2 1 2",
"output": "4 2 1 3"
},
{
"input": "4\n1 4 1 3\n2 4 1 4",
"output": "2 4 1 3"
},
{
"input": "4\n1 3 4 4\n3 3 2 4",
"output": "1 3 2 4"
},
{
"input": "5\n5 4 5 3 1\n4 4 2 3 1",
"output": "5 4 2 3 1"
},
{
"input": "5\n4 1 2 4 5\n3 1 2 5 5",
"output": "3 1 2 4 5"
},
{
"input": "3\n2 2 3\n1 3 3",
"output": "1 2 3"
},
{
"input": "3\n1 1 3\n2 3 3",
"output": "2 1 3"
},
{
"input": "5\n5 4 5 3 1\n2 4 4 3 1",
"output": "2 4 5 3 1"
},
{
"input": "3\n3 3 1\n2 1 1",
"output": "2 3 1"
},
{
"input": "5\n5 4 3 5 2\n5 4 1 1 2",
"output": "5 4 3 1 2"
},
{
"input": "6\n1 2 3 4 2 5\n1 6 3 4 4 5",
"output": "1 6 3 4 2 5"
},
{
"input": "4\n1 3 2 1\n2 3 2 1",
"output": "4 3 2 1"
},
{
"input": "4\n1 3 3 4\n1 4 3 4",
"output": "1 2 3 4"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 10 10\n1 2 3 4 5 6 7 8 9 10 3",
"output": "1 2 3 4 5 6 7 8 9 10 11"
},
{
"input": "5\n1 2 3 2 5\n1 4 3 3 5",
"output": "1 4 3 2 5"
},
{
"input": "5\n1 2 3 4 3\n1 2 5 4 2",
"output": "1 2 5 4 3"
},
{
"input": "5\n1 2 3 4 4\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n1 3 1 4\n1 3 4 4",
"output": "1 3 2 4"
},
{
"input": "5\n2 5 3 2 1\n4 5 3 3 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 2 5\n1 3 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 2 3 4 5\n2 2 3 4 5",
"output": "1 2 3 4 5"
},
{
"input": "5\n5 4 1 1 2\n5 4 3 5 2",
"output": "5 4 3 1 2"
},
{
"input": "4\n1 4 3 4\n1 3 3 4",
"output": "1 2 3 4"
},
{
"input": "4\n1 2 3 1\n1 2 3 2",
"output": "1 2 3 4"
},
{
"input": "5\n4 5 3 3 1\n2 5 3 2 1",
"output": "4 5 3 2 1"
},
{
"input": "5\n1 2 3 5 5\n1 2 3 4 3",
"output": "1 2 3 4 5"
},
{
"input": "4\n2 3 3 4\n2 4 3 4",
"output": "2 1 3 4"
}
] | 1,518,530,147 | 3,947 | Python 3 | OK | TESTS | 54 | 62 | 5,734,400 | from sys import stdin, stdout
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
l = [0] * n
o = list(range(1, n+1))
for i in range(n):
if a[i] == b[i]:
l[i] = a[i]
o.pop(o.index(a[i]))
u = 0
pl = list(l)
for i in range(n):
if a[i] != b[i]:
l[i] = o[u]
u += 1
da, db = 0, 0
for f in range(n):
if a[f] != l[f]:
da+=1
if b[f] != l[f]:
db+=1
if da > 1 or db > 1:
u = len(o) - 1
for i in range(n):
if a[i] != b[i]:
pl[i] = o[u]
u -= 1
l = list(pl)
for j in l:
stdout.write(str(j) + " ")
print()
| Title: An express train to reveries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sengoku still remembers the mysterious "colourful meteoroids" she discovered with Lala-chan when they were little. In particular, one of the nights impressed her deeply, giving her the illusion that all her fancies would be realized.
On that night, Sengoku constructed a permutation *p*1,<=*p*2,<=...,<=*p**n* of integers from 1 to *n* inclusive, with each integer representing a colour, wishing for the colours to see in the coming meteor outburst. Two incredible outbursts then arrived, each with *n* meteorids, colours of which being integer sequences *a*1,<=*a*2,<=...,<=*a**n* and *b*1,<=*b*2,<=...,<=*b**n* respectively. Meteoroids' colours were also between 1 and *n* inclusive, and the two sequences were not identical, that is, at least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Well, she almost had it all — each of the sequences *a* and *b* matched exactly *n*<=-<=1 elements in Sengoku's permutation. In other words, there is exactly one *i* (1<=≤<=*i*<=≤<=*n*) such that *a**i*<=≠<=*p**i*, and exactly one *j* (1<=≤<=*j*<=≤<=*n*) such that *b**j*<=≠<=*p**j*.
For now, Sengoku is able to recover the actual colour sequences *a* and *b* through astronomical records, but her wishes have been long forgotten. You are to reconstruct any possible permutation Sengoku could have had on that night.
Input Specification:
The first line of input contains a positive integer *n* (2<=≤<=*n*<=≤<=1<=000) — the length of Sengoku's permutation, being the length of both meteor outbursts at the same time.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the sequence of colours in the first meteor outburst.
The third line contains *n* space-separated integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=*n*) — the sequence of colours in the second meteor outburst. At least one *i* (1<=≤<=*i*<=≤<=*n*) exists, such that *a**i*<=≠<=*b**i* holds.
Output Specification:
Output *n* space-separated integers *p*1,<=*p*2,<=...,<=*p**n*, denoting a possible permutation Sengoku could have had. If there are more than one possible answer, output any one of them.
Input guarantees that such permutation exists.
Demo Input:
['5\n1 2 3 4 3\n1 2 5 4 5\n', '5\n4 4 2 3 1\n5 4 5 3 1\n', '4\n1 1 3 4\n1 4 3 4\n']
Demo Output:
['1 2 5 4 3\n', '5 4 2 3 1\n', '1 2 3 4\n']
Note:
In the first sample, both 1, 2, 5, 4, 3 and 1, 2, 3, 4, 5 are acceptable outputs.
In the second sample, 5, 4, 2, 3, 1 is the only permutation to satisfy the constraints. | ```python
from sys import stdin, stdout
n = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
l = [0] * n
o = list(range(1, n+1))
for i in range(n):
if a[i] == b[i]:
l[i] = a[i]
o.pop(o.index(a[i]))
u = 0
pl = list(l)
for i in range(n):
if a[i] != b[i]:
l[i] = o[u]
u += 1
da, db = 0, 0
for f in range(n):
if a[f] != l[f]:
da+=1
if b[f] != l[f]:
db+=1
if da > 1 or db > 1:
u = len(o) - 1
for i in range(n):
if a[i] != b[i]:
pl[i] = o[u]
u -= 1
l = list(pl)
for j in l:
stdout.write(str(j) + " ")
print()
``` | 3 |
|
912 | A | Tricky Alchemy | PROGRAMMING | 800 | [
"implementation"
] | null | null | During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls. | The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained. | Print a single integer — the minimum number of crystals that Grisha should acquire in addition. | [
"4 3\n2 1 1\n",
"3 9\n1 1 3\n",
"12345678 87654321\n43043751 1000000000 53798715\n"
] | [
"2\n",
"1\n",
"2147483648\n"
] | In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue. | 500 | [
{
"input": "4 3\n2 1 1",
"output": "2"
},
{
"input": "3 9\n1 1 3",
"output": "1"
},
{
"input": "12345678 87654321\n43043751 1000000000 53798715",
"output": "2147483648"
},
{
"input": "12 12\n3 5 2",
"output": "0"
},
{
"input": "770 1390\n170 442 311",
"output": "12"
},
{
"input": "3555165 6693472\n1499112 556941 3075290",
"output": "3089339"
},
{
"input": "0 0\n1000000000 1000000000 1000000000",
"output": "7000000000"
},
{
"input": "1 1\n0 1 0",
"output": "0"
},
{
"input": "117708228 562858833\n118004008 360437130 154015822",
"output": "738362681"
},
{
"input": "999998118 700178721\n822106746 82987112 547955384",
"output": "1753877029"
},
{
"input": "566568710 765371101\n60614022 80126928 809950465",
"output": "1744607222"
},
{
"input": "448858599 829062060\n764716760 97644201 203890025",
"output": "1178219122"
},
{
"input": "626115781 966381948\n395190569 820194184 229233367",
"output": "1525971878"
},
{
"input": "803372962 103701834\n394260597 837711458 623172928",
"output": "3426388098"
},
{
"input": "980630143 241021722\n24734406 928857659 312079781",
"output": "1624075280"
},
{
"input": "862920032 378341609\n360240924 241342224 337423122",
"output": "974174021"
},
{
"input": "40177212 515661496\n64343660 963892207 731362684",
"output": "3694721078"
},
{
"input": "217434393 579352456\n694817470 981409480 756706026",
"output": "4825785129"
},
{
"input": "394691574 716672343\n398920207 72555681 150645586",
"output": "475704521"
},
{
"input": "276981463 853992230\n29394015 90072954 839552440",
"output": "1754738044"
},
{
"input": "843552056 919184611\n341530221 423649259 101547519",
"output": "263157645"
},
{
"input": "20809236 56504497\n972004030 441166533 495487081",
"output": "4235488636"
},
{
"input": "198066417 825228166\n602477839 532312735 520830423",
"output": "2808777834"
},
{
"input": "80356306 962548053\n601547868 549830008 914769984",
"output": "4004161345"
},
{
"input": "257613487 394835231\n642087093 567347282 308709545",
"output": "2692548667"
},
{
"input": "139903376 532155119\n641157122 289897263 629020178",
"output": "3077110809"
},
{
"input": "612127849 669475006\n271630930 676010757 22959739",
"output": "682559736"
},
{
"input": "0 0\n0 0 0",
"output": "0"
},
{
"input": "1000000000 1000000000\n499999998 4 333333332",
"output": "0"
},
{
"input": "1000000000 1000000000\n1000000000 1000000000 1000000000",
"output": "5000000000"
},
{
"input": "4 3\n1 0 1",
"output": "0"
},
{
"input": "4 12\n1 2 3",
"output": "0"
},
{
"input": "4 20\n1 2 1",
"output": "0"
},
{
"input": "100 10\n2 3 4",
"output": "5"
},
{
"input": "6 0\n1 1 1",
"output": "4"
},
{
"input": "25 5\n3 3 3",
"output": "7"
},
{
"input": "48 27\n22 39 20",
"output": "107"
},
{
"input": "4 0\n1 1 1",
"output": "4"
}
] | 1,579,332,610 | 2,147,483,647 | PyPy 3 | OK | TESTS | 38 | 170 | 0 | import sys
import math
import bisect
import itertools
def main():
A = list(map(int, input().split()))
B = list(map(int, input().split()))
#print('A: ' + str(A))
#print('B: ' + str(B))
yellow = B[0] * 2 + B[1] * 1
blue = B[1] * 1 + B[2] * 3
ans = 0
#print('yellow: %d, blue: %d' % (yellow, blue))
if A[0] < yellow:
ans += yellow - A[0]
if A[1] < blue:
ans += blue - A[1]
print(ans)
if __name__ == "__main__":
main()
| Title: Tricky Alchemy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls.
Input Specification:
The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained.
Output Specification:
Print a single integer — the minimum number of crystals that Grisha should acquire in addition.
Demo Input:
['4 3\n2 1 1\n', '3 9\n1 1 3\n', '12345678 87654321\n43043751 1000000000 53798715\n']
Demo Output:
['2\n', '1\n', '2147483648\n']
Note:
In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue. | ```python
import sys
import math
import bisect
import itertools
def main():
A = list(map(int, input().split()))
B = list(map(int, input().split()))
#print('A: ' + str(A))
#print('B: ' + str(B))
yellow = B[0] * 2 + B[1] * 1
blue = B[1] * 1 + B[2] * 3
ans = 0
#print('yellow: %d, blue: %d' % (yellow, blue))
if A[0] < yellow:
ans += yellow - A[0]
if A[1] < blue:
ans += blue - A[1]
print(ans)
if __name__ == "__main__":
main()
``` | 3 |
|
230 | B | T-primes | PROGRAMMING | 1,300 | [
"binary search",
"implementation",
"math",
"number theory"
] | null | null | We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not. | The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier. | Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't. | [
"3\n4 5 6\n"
] | [
"YES\nNO\nNO\n"
] | The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO". | 500 | [
{
"input": "3\n4 5 6",
"output": "YES\nNO\nNO"
},
{
"input": "2\n48 49",
"output": "NO\nYES"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "NO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO"
},
{
"input": "1\n36",
"output": "NO"
},
{
"input": "1\n999966000289",
"output": "YES"
},
{
"input": "1\n999993399999",
"output": "NO"
},
{
"input": "9\n111 121 131 111 121 131 111 121 131",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nNO"
},
{
"input": "1\n1",
"output": "NO"
},
{
"input": "1\n10",
"output": "NO"
},
{
"input": "1\n976197352729",
"output": "NO"
},
{
"input": "1\n1000000000000",
"output": "NO"
},
{
"input": "1\n9",
"output": "YES"
},
{
"input": "6\n549755813888 847288609443 762939453125 678223072849 285311670611 137858491849",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "3\n223092870 6469693230 200560490130",
"output": "NO\nNO\nNO"
},
{
"input": "2\n81 25",
"output": "NO\nYES"
},
{
"input": "1\n16",
"output": "NO"
},
{
"input": "22\n1 2 3 4 5 6 7 8 9 10 12752041 64 121 144 27550356289 124 24657 23756 135153365 25235235235 42351351 81",
"output": "NO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "1\n225",
"output": "NO"
},
{
"input": "1\n1521",
"output": "NO"
},
{
"input": "1\n81",
"output": "NO"
}
] | 1,697,047,131 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 60 | 0 | s = int(input())
a = list(map(int,input().split()))
for i in a :
g = int((i)**0.5)
if (g*g) == i :
if (g%2 == 0 or g%3 == 0 or g%5 == 0 or g%7 == 0 or g%11 == 0 or g%13 == 0 ) and (g == 4 or g == 9 or g == 25 or g == 49 or g == 121 or g == 169) :
print("NO")
else :
print("YES")
elif (g*g) != i or g == 1 :
print("NO")
| Title: T-primes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not.
Input Specification:
The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't.
Demo Input:
['3\n4 5 6\n']
Demo Output:
['YES\nNO\nNO\n']
Note:
The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO". | ```python
s = int(input())
a = list(map(int,input().split()))
for i in a :
g = int((i)**0.5)
if (g*g) == i :
if (g%2 == 0 or g%3 == 0 or g%5 == 0 or g%7 == 0 or g%11 == 0 or g%13 == 0 ) and (g == 4 or g == 9 or g == 25 or g == 49 or g == 121 or g == 169) :
print("NO")
else :
print("YES")
elif (g*g) != i or g == 1 :
print("NO")
``` | 0 |
|
834 | A | The Useless Toy | PROGRAMMING | 900 | [
"implementation"
] | null | null | Walking through the streets of Marshmallow City, Slastyona have spotted some merchants selling a kind of useless toy which is very popular nowadays – caramel spinner! Wanting to join the craze, she has immediately bought the strange contraption.
Spinners in Sweetland have the form of V-shaped pieces of caramel. Each spinner can, well, spin around an invisible magic axis. At a specific point in time, a spinner can take 4 positions shown below (each one rotated 90 degrees relative to the previous, with the fourth one followed by the first one):
After the spinner was spun, it starts its rotation, which is described by a following algorithm: the spinner maintains its position for a second then majestically switches to the next position in clockwise or counter-clockwise order, depending on the direction the spinner was spun in.
Slastyona managed to have spinner rotating for exactly *n* seconds. Being fascinated by elegance of the process, she completely forgot the direction the spinner was spun in! Lucky for her, she managed to recall the starting position, and wants to deduct the direction given the information she knows. Help her do this. | There are two characters in the first string – the starting and the ending position of a spinner. The position is encoded with one of the following characters: v (ASCII code 118, lowercase v), < (ASCII code 60), ^ (ASCII code 94) or > (ASCII code 62) (see the picture above for reference). Characters are separated by a single space.
In the second strings, a single number *n* is given (0<=≤<=*n*<=≤<=109) – the duration of the rotation.
It is guaranteed that the ending position of a spinner is a result of a *n* second spin in any of the directions, assuming the given starting position. | Output cw, if the direction is clockwise, ccw – if counter-clockwise, and undefined otherwise. | [
"^ >\n1\n",
"< ^\n3\n",
"^ v\n6\n"
] | [
"cw\n",
"ccw\n",
"undefined\n"
] | none | 500 | [
{
"input": "^ >\n1",
"output": "cw"
},
{
"input": "< ^\n3",
"output": "ccw"
},
{
"input": "^ v\n6",
"output": "undefined"
},
{
"input": "^ >\n999999999",
"output": "ccw"
},
{
"input": "> v\n1",
"output": "cw"
},
{
"input": "v <\n1",
"output": "cw"
},
{
"input": "< ^\n1",
"output": "cw"
},
{
"input": "v <\n422435957",
"output": "cw"
},
{
"input": "v >\n139018901",
"output": "ccw"
},
{
"input": "v ^\n571728018",
"output": "undefined"
},
{
"input": "^ ^\n0",
"output": "undefined"
},
{
"input": "< >\n2",
"output": "undefined"
},
{
"input": "> >\n1000000000",
"output": "undefined"
},
{
"input": "v v\n8",
"output": "undefined"
},
{
"input": "< <\n1568",
"output": "undefined"
},
{
"input": "^ v\n2",
"output": "undefined"
},
{
"input": "^ <\n1",
"output": "ccw"
},
{
"input": "< v\n1",
"output": "ccw"
},
{
"input": "v >\n1",
"output": "ccw"
},
{
"input": "> ^\n1",
"output": "ccw"
},
{
"input": "v <\n422435957",
"output": "cw"
},
{
"input": "v v\n927162384",
"output": "undefined"
},
{
"input": "v ^\n571728018",
"output": "undefined"
},
{
"input": "^ <\n467441155",
"output": "cw"
},
{
"input": "^ >\n822875521",
"output": "cw"
},
{
"input": "^ <\n821690113",
"output": "ccw"
},
{
"input": "^ <\n171288453",
"output": "ccw"
},
{
"input": "^ <\n110821381",
"output": "ccw"
},
{
"input": "^ ^\n539580280",
"output": "undefined"
},
{
"input": "^ >\n861895563",
"output": "ccw"
},
{
"input": "v v\n4",
"output": "undefined"
},
{
"input": "^ ^\n4",
"output": "undefined"
},
{
"input": "> >\n4",
"output": "undefined"
},
{
"input": "< <\n8",
"output": "undefined"
},
{
"input": "v v\n0",
"output": "undefined"
},
{
"input": "^ <\n11",
"output": "cw"
},
{
"input": "< <\n4",
"output": "undefined"
},
{
"input": "< <\n0",
"output": "undefined"
},
{
"input": "< v\n3",
"output": "cw"
},
{
"input": "^ <\n3",
"output": "cw"
},
{
"input": "^ <\n7",
"output": "cw"
},
{
"input": "< >\n6",
"output": "undefined"
},
{
"input": "v >\n3",
"output": "cw"
},
{
"input": "> >\n300",
"output": "undefined"
},
{
"input": "> >\n0",
"output": "undefined"
},
{
"input": "v <\n3",
"output": "ccw"
},
{
"input": "> >\n12",
"output": "undefined"
}
] | 1,501,722,209 | 2,147,483,647 | Python 3 | OK | TESTS | 47 | 77 | 4,608,000 | # Description of the problem can be found at http://codeforces.com/problemset/problem/834/A
d = {"v": 0, "<": 1, "^": 2, ">": 3}
f1, f2 = input().split()
s = int(input())
x1 = (d[f1] + s) % 4 == d[f2]
x2 = (d[f1] - s) % 4 == d[f2]
if x1 and x2:
print("undefined")
elif x1:
print("cw")
else:
print("ccw")
| Title: The Useless Toy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Walking through the streets of Marshmallow City, Slastyona have spotted some merchants selling a kind of useless toy which is very popular nowadays – caramel spinner! Wanting to join the craze, she has immediately bought the strange contraption.
Spinners in Sweetland have the form of V-shaped pieces of caramel. Each spinner can, well, spin around an invisible magic axis. At a specific point in time, a spinner can take 4 positions shown below (each one rotated 90 degrees relative to the previous, with the fourth one followed by the first one):
After the spinner was spun, it starts its rotation, which is described by a following algorithm: the spinner maintains its position for a second then majestically switches to the next position in clockwise or counter-clockwise order, depending on the direction the spinner was spun in.
Slastyona managed to have spinner rotating for exactly *n* seconds. Being fascinated by elegance of the process, she completely forgot the direction the spinner was spun in! Lucky for her, she managed to recall the starting position, and wants to deduct the direction given the information she knows. Help her do this.
Input Specification:
There are two characters in the first string – the starting and the ending position of a spinner. The position is encoded with one of the following characters: v (ASCII code 118, lowercase v), < (ASCII code 60), ^ (ASCII code 94) or > (ASCII code 62) (see the picture above for reference). Characters are separated by a single space.
In the second strings, a single number *n* is given (0<=≤<=*n*<=≤<=109) – the duration of the rotation.
It is guaranteed that the ending position of a spinner is a result of a *n* second spin in any of the directions, assuming the given starting position.
Output Specification:
Output cw, if the direction is clockwise, ccw – if counter-clockwise, and undefined otherwise.
Demo Input:
['^ >\n1\n', '< ^\n3\n', '^ v\n6\n']
Demo Output:
['cw\n', 'ccw\n', 'undefined\n']
Note:
none | ```python
# Description of the problem can be found at http://codeforces.com/problemset/problem/834/A
d = {"v": 0, "<": 1, "^": 2, ">": 3}
f1, f2 = input().split()
s = int(input())
x1 = (d[f1] + s) % 4 == d[f2]
x2 = (d[f1] - s) % 4 == d[f2]
if x1 and x2:
print("undefined")
elif x1:
print("cw")
else:
print("ccw")
``` | 3 |
|
85 | A | Domino | PROGRAMMING | 1,300 | [
"constructive algorithms",
"implementation"
] | A. Domino | 1 | 256 | We all know the problem about the number of ways one can tile a 2<=×<=*n* field by 1<=×<=2 dominoes. You probably remember that it goes down to Fibonacci numbers. We will talk about some other problem below, there you also are going to deal with tiling a rectangular field with dominoes.
You are given a 4<=×<=*n* rectangular field, that is the field that contains four lines and *n* columns. You have to find for it any tiling by 1<=×<=2 dominoes such that each of the *n*<=-<=1 potential vertical cuts along the grid lines intersects at least one domino, splitting it in two. No two dominoes in the sought tiling should overlap, each square of the field should be covered by exactly one domino. It is allowed to rotate the dominoes, that is, you can use 2<=×<=1 as well as 1<=×<=2 dominoes.
Write a program that finds an arbitrary sought tiling. | The input contains one positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of the field's columns. | If there's no solution, print "-1" (without the quotes). Otherwise, print four lines containing *n* characters each — that's the description of tiling, where each vertical cut intersects at least one domino. You should print the tiling, having painted the field in no more than 26 colors. Each domino should be painted a color. Different dominoes can be painted the same color, but dominoes of the same color should not be side-neighbouring. To indicate colors you should use lowercase Latin letters. Print any of the acceptable ways of tiling. | [
"4\n"
] | [
"yyzz\nbccd\nbxxd\nyyaa\n"
] | none | 500 | [
{
"input": "4",
"output": "aacc\nbbdd\nzkkz\nzllz"
},
{
"input": "2",
"output": "aa\nbb\naa\nbb"
},
{
"input": "3",
"output": "aab\nccb\nbaa\nbcc"
},
{
"input": "5",
"output": "aaccz\nbbddz\nzkkmm\nzllnn"
},
{
"input": "1",
"output": "a\na\nb\nb"
},
{
"input": "6",
"output": "aaccee\nbbddff\nzkkmmz\nzllnnz"
},
{
"input": "7",
"output": "aacceez\nbbddffz\nzkkmmoo\nzllnnpp"
},
{
"input": "8",
"output": "aacceegg\nbbddffhh\nzkkmmooz\nzllnnppz"
},
{
"input": "9",
"output": "aacceeggz\nbbddffhhz\nzkkmmooqq\nzllnnpprr"
},
{
"input": "10",
"output": "aacceeggii\nbbddffhhjj\nzkkmmooqqz\nzllnnpprrz"
},
{
"input": "11",
"output": "aacceeggiiz\nbbddffhhjjz\nzkkmmooqqss\nzllnnpprrtt"
},
{
"input": "12",
"output": "aacceeggiiaa\nbbddffhhjjbb\nzkkmmooqqssz\nzllnnpprrttz"
},
{
"input": "13",
"output": "aacceeggiiaaz\nbbddffhhjjbbz\nzkkmmooqqsskk\nzllnnpprrttll"
},
{
"input": "14",
"output": "aacceeggiiaacc\nbbddffhhjjbbdd\nzkkmmooqqsskkz\nzllnnpprrttllz"
},
{
"input": "15",
"output": "aacceeggiiaaccz\nbbddffhhjjbbddz\nzkkmmooqqsskkmm\nzllnnpprrttllnn"
},
{
"input": "16",
"output": "aacceeggiiaaccee\nbbddffhhjjbbddff\nzkkmmooqqsskkmmz\nzllnnpprrttllnnz"
},
{
"input": "17",
"output": "aacceeggiiaacceez\nbbddffhhjjbbddffz\nzkkmmooqqsskkmmoo\nzllnnpprrttllnnpp"
},
{
"input": "18",
"output": "aacceeggiiaacceegg\nbbddffhhjjbbddffhh\nzkkmmooqqsskkmmooz\nzllnnpprrttllnnppz"
},
{
"input": "19",
"output": "aacceeggiiaacceeggz\nbbddffhhjjbbddffhhz\nzkkmmooqqsskkmmooqq\nzllnnpprrttllnnpprr"
},
{
"input": "20",
"output": "aacceeggiiaacceeggii\nbbddffhhjjbbddffhhjj\nzkkmmooqqsskkmmooqqz\nzllnnpprrttllnnpprrz"
},
{
"input": "21",
"output": "aacceeggiiaacceeggiiz\nbbddffhhjjbbddffhhjjz\nzkkmmooqqsskkmmooqqss\nzllnnpprrttllnnpprrtt"
},
{
"input": "22",
"output": "aacceeggiiaacceeggiiaa\nbbddffhhjjbbddffhhjjbb\nzkkmmooqqsskkmmooqqssz\nzllnnpprrttllnnpprrttz"
},
{
"input": "23",
"output": "aacceeggiiaacceeggiiaaz\nbbddffhhjjbbddffhhjjbbz\nzkkmmooqqsskkmmooqqsskk\nzllnnpprrttllnnpprrttll"
},
{
"input": "24",
"output": "aacceeggiiaacceeggiiaacc\nbbddffhhjjbbddffhhjjbbdd\nzkkmmooqqsskkmmooqqsskkz\nzllnnpprrttllnnpprrttllz"
},
{
"input": "25",
"output": "aacceeggiiaacceeggiiaaccz\nbbddffhhjjbbddffhhjjbbddz\nzkkmmooqqsskkmmooqqsskkmm\nzllnnpprrttllnnpprrttllnn"
},
{
"input": "26",
"output": "aacceeggiiaacceeggiiaaccee\nbbddffhhjjbbddffhhjjbbddff\nzkkmmooqqsskkmmooqqsskkmmz\nzllnnpprrttllnnpprrttllnnz"
},
{
"input": "27",
"output": "aacceeggiiaacceeggiiaacceez\nbbddffhhjjbbddffhhjjbbddffz\nzkkmmooqqsskkmmooqqsskkmmoo\nzllnnpprrttllnnpprrttllnnpp"
},
{
"input": "28",
"output": "aacceeggiiaacceeggiiaacceegg\nbbddffhhjjbbddffhhjjbbddffhh\nzkkmmooqqsskkmmooqqsskkmmooz\nzllnnpprrttllnnpprrttllnnppz"
},
{
"input": "29",
"output": "aacceeggiiaacceeggiiaacceeggz\nbbddffhhjjbbddffhhjjbbddffhhz\nzkkmmooqqsskkmmooqqsskkmmooqq\nzllnnpprrttllnnpprrttllnnpprr"
},
{
"input": "30",
"output": "aacceeggiiaacceeggiiaacceeggii\nbbddffhhjjbbddffhhjjbbddffhhjj\nzkkmmooqqsskkmmooqqsskkmmooqqz\nzllnnpprrttllnnpprrttllnnpprrz"
},
{
"input": "91",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqss\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrtt"
},
{
"input": "92",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaa\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbb\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqssz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttz"
},
{
"input": "93",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaaz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskk\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttll"
},
{
"input": "94",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacc\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbdd\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllz"
},
{
"input": "95",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaaccz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmm\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnn"
},
{
"input": "96",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaaccee\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddff\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnz"
},
{
"input": "97",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceez\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmoo\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpp"
},
{
"input": "98",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceegg\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhh\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnppz"
},
{
"input": "99",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqq\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprr"
},
{
"input": "100",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggii\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjj\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrz"
}
] | 1,623,183,958 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 248 | 512,000 | import re
h=input()
if re.match('(\w+)?h+?e+?ll+?o+?',h):
print('YES')
else:
print('NO')
| Title: Domino
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
We all know the problem about the number of ways one can tile a 2<=×<=*n* field by 1<=×<=2 dominoes. You probably remember that it goes down to Fibonacci numbers. We will talk about some other problem below, there you also are going to deal with tiling a rectangular field with dominoes.
You are given a 4<=×<=*n* rectangular field, that is the field that contains four lines and *n* columns. You have to find for it any tiling by 1<=×<=2 dominoes such that each of the *n*<=-<=1 potential vertical cuts along the grid lines intersects at least one domino, splitting it in two. No two dominoes in the sought tiling should overlap, each square of the field should be covered by exactly one domino. It is allowed to rotate the dominoes, that is, you can use 2<=×<=1 as well as 1<=×<=2 dominoes.
Write a program that finds an arbitrary sought tiling.
Input Specification:
The input contains one positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of the field's columns.
Output Specification:
If there's no solution, print "-1" (without the quotes). Otherwise, print four lines containing *n* characters each — that's the description of tiling, where each vertical cut intersects at least one domino. You should print the tiling, having painted the field in no more than 26 colors. Each domino should be painted a color. Different dominoes can be painted the same color, but dominoes of the same color should not be side-neighbouring. To indicate colors you should use lowercase Latin letters. Print any of the acceptable ways of tiling.
Demo Input:
['4\n']
Demo Output:
['yyzz\nbccd\nbxxd\nyyaa\n']
Note:
none | ```python
import re
h=input()
if re.match('(\w+)?h+?e+?ll+?o+?',h):
print('YES')
else:
print('NO')
``` | 0 |
938 | B | Run For Your Prize | PROGRAMMING | 1,100 | [
"brute force",
"greedy"
] | null | null | You and your friend are participating in a TV show "Run For Your Prize".
At the start of the show *n* prizes are located on a straight line. *i*-th prize is located at position *a**i*. Positions of all prizes are distinct. You start at position 1, your friend — at position 106 (and there is no prize in any of these two positions). You have to work as a team and collect all prizes in minimum possible time, in any order.
You know that it takes exactly 1 second to move from position *x* to position *x*<=+<=1 or *x*<=-<=1, both for you and your friend. You also have trained enough to instantly pick up any prize, if its position is equal to your current position (and the same is true for your friend). Carrying prizes does not affect your speed (or your friend's speed) at all.
Now you may discuss your strategy with your friend and decide who will pick up each prize. Remember that every prize must be picked up, either by you or by your friend.
What is the minimum number of seconds it will take to pick up all the prizes? | The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of prizes.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (2<=≤<=*a**i*<=≤<=106<=-<=1) — the positions of the prizes. No two prizes are located at the same position. Positions are given in ascending order. | Print one integer — the minimum number of seconds it will take to collect all prizes. | [
"3\n2 3 9\n",
"2\n2 999995\n"
] | [
"8\n",
"5\n"
] | In the first example you take all the prizes: take the first at 1, the second at 2 and the third at 8.
In the second example you take the first prize in 1 second and your friend takes the other in 5 seconds, you do this simultaneously, so the total time is 5. | 0 | [
{
"input": "3\n2 3 9",
"output": "8"
},
{
"input": "2\n2 999995",
"output": "5"
},
{
"input": "1\n20",
"output": "19"
},
{
"input": "6\n2 3 500000 999997 999998 999999",
"output": "499999"
},
{
"input": "1\n999999",
"output": "1"
},
{
"input": "1\n510000",
"output": "490000"
},
{
"input": "3\n2 5 27",
"output": "26"
},
{
"input": "2\n600000 800000",
"output": "400000"
},
{
"input": "5\n2 5 6 27 29",
"output": "28"
},
{
"input": "1\n500001",
"output": "499999"
},
{
"input": "10\n3934 38497 42729 45023 51842 68393 77476 82414 91465 98055",
"output": "98054"
},
{
"input": "1\n900000",
"output": "100000"
},
{
"input": "1\n500000",
"output": "499999"
},
{
"input": "1\n999998",
"output": "2"
},
{
"input": "3\n999997 999998 999999",
"output": "3"
},
{
"input": "2\n999997 999999",
"output": "3"
},
{
"input": "2\n2 999998",
"output": "2"
},
{
"input": "2\n500000 500001",
"output": "499999"
},
{
"input": "1\n500002",
"output": "499998"
},
{
"input": "1\n700000",
"output": "300000"
},
{
"input": "2\n2 999999",
"output": "1"
},
{
"input": "2\n999998 999999",
"output": "2"
},
{
"input": "1\n999995",
"output": "5"
},
{
"input": "2\n499999 500001",
"output": "499999"
},
{
"input": "1\n499999",
"output": "499998"
},
{
"input": "2\n100 999900",
"output": "100"
},
{
"input": "2\n499999 500000",
"output": "499999"
},
{
"input": "2\n500001 999999",
"output": "499999"
},
{
"input": "3\n500000 500001 500002",
"output": "499999"
},
{
"input": "2\n2 500001",
"output": "499999"
},
{
"input": "2\n499999 999999",
"output": "499998"
},
{
"input": "2\n2 500000",
"output": "499999"
},
{
"input": "4\n2 3 4 999999",
"output": "3"
},
{
"input": "2\n100000 500001",
"output": "499999"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n800000",
"output": "200000"
},
{
"input": "1\n505050",
"output": "494950"
},
{
"input": "1\n753572",
"output": "246428"
},
{
"input": "2\n576696 760487",
"output": "423304"
},
{
"input": "10\n3 4 5 6 7 8 9 10 11 12",
"output": "11"
},
{
"input": "4\n2 3 4 5",
"output": "4"
},
{
"input": "4\n999996 999997 999998 999999",
"output": "4"
}
] | 1,520,526,179 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 93 | 12,902,400 | n=int(input())
ar=[int(x) for x in input().split()]
key=ar[n-1]
ans1=key-1
ans2=10**6-key
t=min(ans1,ans2)
print(t) | Title: Run For Your Prize
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You and your friend are participating in a TV show "Run For Your Prize".
At the start of the show *n* prizes are located on a straight line. *i*-th prize is located at position *a**i*. Positions of all prizes are distinct. You start at position 1, your friend — at position 106 (and there is no prize in any of these two positions). You have to work as a team and collect all prizes in minimum possible time, in any order.
You know that it takes exactly 1 second to move from position *x* to position *x*<=+<=1 or *x*<=-<=1, both for you and your friend. You also have trained enough to instantly pick up any prize, if its position is equal to your current position (and the same is true for your friend). Carrying prizes does not affect your speed (or your friend's speed) at all.
Now you may discuss your strategy with your friend and decide who will pick up each prize. Remember that every prize must be picked up, either by you or by your friend.
What is the minimum number of seconds it will take to pick up all the prizes?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of prizes.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (2<=≤<=*a**i*<=≤<=106<=-<=1) — the positions of the prizes. No two prizes are located at the same position. Positions are given in ascending order.
Output Specification:
Print one integer — the minimum number of seconds it will take to collect all prizes.
Demo Input:
['3\n2 3 9\n', '2\n2 999995\n']
Demo Output:
['8\n', '5\n']
Note:
In the first example you take all the prizes: take the first at 1, the second at 2 and the third at 8.
In the second example you take the first prize in 1 second and your friend takes the other in 5 seconds, you do this simultaneously, so the total time is 5. | ```python
n=int(input())
ar=[int(x) for x in input().split()]
key=ar[n-1]
ans1=key-1
ans2=10**6-key
t=min(ans1,ans2)
print(t)
``` | 0 |
|
330 | B | Road Construction | PROGRAMMING | 1,300 | [
"constructive algorithms",
"graphs"
] | null | null | A country has *n* cities. Initially, there is no road in the country. One day, the king decides to construct some roads connecting pairs of cities. Roads can be traversed either way. He wants those roads to be constructed in such a way that it is possible to go from each city to any other city by traversing at most two roads. You are also given *m* pairs of cities — roads cannot be constructed between these pairs of cities.
Your task is to construct the minimum number of roads that still satisfy the above conditions. The constraints will guarantee that this is always possible. | The first line consists of two integers *n* and *m* .
Then *m* lines follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which means that it is not possible to construct a road connecting cities *a**i* and *b**i*. Consider the cities are numbered from 1 to *n*.
It is guaranteed that every pair of cities will appear at most once in the input. | You should print an integer *s*: the minimum number of roads that should be constructed, in the first line. Then *s* lines should follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*), which means that a road should be constructed between cities *a**i* and *b**i*.
If there are several solutions, you may print any of them. | [
"4 1\n1 3\n"
] | [
"3\n1 2\n4 2\n2 3\n"
] | This is one possible solution of the example:
These are examples of wrong solutions: | 1,000 | [
{
"input": "4 1\n1 3",
"output": "3\n1 2\n4 2\n2 3"
},
{
"input": "1000 0",
"output": "999\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "484 11\n414 97\n414 224\n444 414\n414 483\n414 399\n414 484\n414 189\n414 246\n414 115\n89 414\n14 414",
"output": "483\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "150 3\n112 30\n61 45\n37 135",
"output": "149\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "34 7\n10 28\n10 19\n10 13\n24 10\n10 29\n20 10\n10 26",
"output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34"
},
{
"input": "1000 48\n816 885\n576 357\n878 659\n610 647\n37 670\n192 184\n393 407\n598 160\n547 995\n177 276\n788 44\n14 184\n604 281\n176 97\n176 293\n10 57\n852 579\n223 669\n313 260\n476 691\n667 22\n851 792\n411 489\n526 66\n233 566\n35 396\n964 815\n672 123\n148 210\n163 339\n379 598\n382 675\n132 955\n221 441\n253 490\n856 532\n135 119\n276 319\n525 835\n996 270\n92 778\n434 369\n351 927\n758 983\n798 267\n272 830\n539 728\n166 26",
"output": "999\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "534 0",
"output": "533\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "226 54\n80 165\n2 53\n191 141\n107 207\n95 196\n61 82\n42 168\n118 94\n205 182\n172 160\n84 224\n113 143\n122 93\n37 209\n176 32\n56 83\n151 81\n70 190\n99 171\n68 204\n212 48\n4 67\n116 7\n206 199\n105 62\n158 51\n178 147\n17 129\n22 47\n72 162\n188 77\n24 111\n184 26\n175 128\n110 89\n139 120\n127 92\n121 39\n217 75\n145 69\n20 161\n30 220\n222 154\n54 46\n21 87\n144 185\n164 115\n73 202\n173 35\n9 132\n74 180\n137 5\n157 117\n31 177",
"output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "84 3\n39 19\n55 73\n42 43",
"output": "83\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84"
},
{
"input": "207 35\n34 116\n184 5\n90 203\n12 195\n138 101\n40 150\n189 109\n115 91\n93 201\n106 18\n51 187\n139 197\n168 130\n182 64\n31 42\n86 107\n158 111\n159 132\n119 191\n53 127\n81 13\n153 112\n38 2\n87 84\n121 82\n120 22\n21 177\n151 202\n23 58\n68 192\n29 46\n105 70\n8 167\n56 54\n149 15",
"output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "91 37\n50 90\n26 82\n61 1\n50 17\n51 73\n45 9\n39 53\n78 35\n12 45\n43 47\n83 20\n9 59\n18 48\n68 31\n47 33\n10 25\n15 78\n5 3\n73 65\n77 4\n62 31\n73 3\n53 7\n29 58\n52 14\n56 20\n6 87\n71 16\n17 19\n77 86\n1 50\n74 79\n15 54\n55 80\n13 77\n4 69\n24 69",
"output": "90\n2 1\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31\n2 32\n2 33\n2 34\n2 35\n2 36\n2 37\n2 38\n2 39\n2 40\n2 41\n2 42\n2 43\n2 44\n2 45\n2 46\n2 47\n2 48\n2 49\n2 50\n2 51\n2 52\n2 53\n2 54\n2 55\n2 56\n2 57\n2 58\n2 59\n2 60\n2 61\n2 62\n2 63\n2 64\n2 65\n2 66\n2 67\n2 68\n2 69\n2 70\n2 71\n2 72\n2 73\n2 74\n2 75\n2 76\n2 77\n2 78\n2 79\n2 80\n2 81\n2 82\n2 83\n2 84\n2 85\n2 86\n2 87\n..."
},
{
"input": "226 54\n197 107\n181 146\n218 115\n36 169\n199 196\n116 93\n152 75\n213 164\n156 95\n165 58\n90 42\n141 58\n203 221\n179 204\n186 69\n27 127\n76 189\n40 195\n111 29\n85 189\n45 88\n84 135\n82 186\n185 17\n156 217\n8 123\n179 112\n92 137\n114 89\n10 152\n132 24\n135 36\n61 218\n10 120\n155 102\n222 79\n150 92\n184 34\n102 180\n154 196\n171 9\n217 105\n84 207\n56 189\n152 179\n43 165\n115 209\n208 167\n52 14\n92 47\n197 95\n13 78\n222 138\n75 36",
"output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "207 35\n154 79\n174 101\n189 86\n137 56\n66 23\n199 69\n18 28\n32 53\n13 179\n182 170\n199 12\n24 158\n105 133\n25 10\n40 162\n64 72\n108 9\n172 125\n43 190\n15 39\n128 150\n102 129\n90 97\n64 196\n70 123\n163 41\n12 126\n127 186\n107 23\n182 51\n29 46\n46 123\n89 35\n59 80\n206 171",
"output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "84 0",
"output": "83\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84"
},
{
"input": "226 54\n5 29\n130 29\n55 29\n19 29\n29 92\n29 38\n185 29\n29 150\n29 202\n29 25\n29 66\n184 29\n29 189\n177 29\n50 29\n87 29\n138 29\n29 48\n151 29\n125 29\n16 29\n42 29\n29 157\n90 29\n21 29\n29 45\n29 80\n29 67\n29 26\n29 173\n74 29\n29 193\n29 40\n172 29\n29 85\n29 102\n88 29\n29 182\n116 29\n180 29\n161 29\n10 29\n171 29\n144 29\n29 218\n190 29\n213 29\n29 71\n29 191\n29 160\n29 137\n29 58\n29 135\n127 29",
"output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "207 35\n25 61\n188 61\n170 61\n113 61\n35 61\n61 177\n77 61\n61 39\n61 141\n116 61\n61 163\n30 61\n192 61\n19 61\n61 162\n61 133\n185 61\n8 61\n118 61\n61 115\n7 61\n61 105\n107 61\n61 11\n161 61\n61 149\n136 61\n82 61\n20 61\n151 61\n156 61\n12 61\n87 61\n61 205\n61 108",
"output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "34 7\n11 32\n33 29\n17 16\n15 5\n13 25\n8 19\n20 4",
"output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34"
},
{
"input": "43 21\n38 19\n43 8\n40 31\n3 14\n24 21\n12 17\n1 9\n5 27\n25 37\n11 6\n13 26\n16 22\n10 32\n36 7\n30 29\n42 35\n20 33\n4 23\n18 15\n41 34\n2 28",
"output": "42\n39 1\n39 2\n39 3\n39 4\n39 5\n39 6\n39 7\n39 8\n39 9\n39 10\n39 11\n39 12\n39 13\n39 14\n39 15\n39 16\n39 17\n39 18\n39 19\n39 20\n39 21\n39 22\n39 23\n39 24\n39 25\n39 26\n39 27\n39 28\n39 29\n39 30\n39 31\n39 32\n39 33\n39 34\n39 35\n39 36\n39 37\n39 38\n39 40\n39 41\n39 42\n39 43"
},
{
"input": "34 7\n22 4\n5 25\n15 7\n5 9\n27 7\n34 21\n3 13",
"output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34"
},
{
"input": "50 7\n19 37\n30 32\n43 20\n48 14\n30 29\n18 36\n9 46",
"output": "49\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50"
},
{
"input": "41 12\n41 12\n29 13\n3 37\n2 20\n4 24\n27 6\n39 20\n28 41\n30 1\n35 9\n5 39\n12 31",
"output": "40\n7 1\n7 2\n7 3\n7 4\n7 5\n7 6\n7 8\n7 9\n7 10\n7 11\n7 12\n7 13\n7 14\n7 15\n7 16\n7 17\n7 18\n7 19\n7 20\n7 21\n7 22\n7 23\n7 24\n7 25\n7 26\n7 27\n7 28\n7 29\n7 30\n7 31\n7 32\n7 33\n7 34\n7 35\n7 36\n7 37\n7 38\n7 39\n7 40\n7 41"
},
{
"input": "26 2\n22 1\n14 10",
"output": "25\n2 1\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26"
},
{
"input": "7 3\n4 7\n4 6\n6 5",
"output": "6\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7"
},
{
"input": "484 11\n459 166\n12 217\n14 231\n477 111\n365 225\n62 412\n221 223\n258 184\n266 404\n425 236\n83 269",
"output": "483\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "50 24\n18 36\n11 18\n22 18\n18 47\n18 10\n45 18\n18 29\n13 18\n8 18\n18 30\n26 18\n18 6\n5 18\n18 7\n46 18\n50 18\n18 3\n18 32\n4 18\n18 24\n18 19\n23 18\n35 18\n31 18",
"output": "49\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50"
},
{
"input": "7 3\n3 4\n7 3\n3 2",
"output": "6\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "2 0",
"output": "1\n1 2"
},
{
"input": "4 1\n1 2",
"output": "3\n3 1\n3 2\n3 4"
},
{
"input": "3 1\n1 2",
"output": "2\n3 1\n3 2"
},
{
"input": "5 1\n1 5",
"output": "4\n2 1\n2 3\n2 4\n2 5"
}
] | 1,626,185,199 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 2 | 216 | 23,040,000 | n, m = map(int, input().split())
node = set([i+1 for i in range(n)])
for _ in range(m):
a, b = map(int, input().split())
node.remove(a)
node.remove(b)
print(n-1)
center = node.pop()
for i in range(1, n+1):
if i == center: continue
print(center, i)
| Title: Road Construction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A country has *n* cities. Initially, there is no road in the country. One day, the king decides to construct some roads connecting pairs of cities. Roads can be traversed either way. He wants those roads to be constructed in such a way that it is possible to go from each city to any other city by traversing at most two roads. You are also given *m* pairs of cities — roads cannot be constructed between these pairs of cities.
Your task is to construct the minimum number of roads that still satisfy the above conditions. The constraints will guarantee that this is always possible.
Input Specification:
The first line consists of two integers *n* and *m* .
Then *m* lines follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which means that it is not possible to construct a road connecting cities *a**i* and *b**i*. Consider the cities are numbered from 1 to *n*.
It is guaranteed that every pair of cities will appear at most once in the input.
Output Specification:
You should print an integer *s*: the minimum number of roads that should be constructed, in the first line. Then *s* lines should follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*), which means that a road should be constructed between cities *a**i* and *b**i*.
If there are several solutions, you may print any of them.
Demo Input:
['4 1\n1 3\n']
Demo Output:
['3\n1 2\n4 2\n2 3\n']
Note:
This is one possible solution of the example:
These are examples of wrong solutions: | ```python
n, m = map(int, input().split())
node = set([i+1 for i in range(n)])
for _ in range(m):
a, b = map(int, input().split())
node.remove(a)
node.remove(b)
print(n-1)
center = node.pop()
for i in range(1, n+1):
if i == center: continue
print(center, i)
``` | -1 |
|
637 | B | Chat Order | PROGRAMMING | 1,200 | [
"*special",
"binary search",
"constructive algorithms",
"data structures",
"sortings"
] | null | null | Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus. | The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10. | Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom. | [
"4\nalex\nivan\nroman\nivan\n",
"8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n"
] | [
"ivan\nroman\nalex\n",
"alina\nmaria\nekaterina\ndarya\n"
] | In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex | 1,000 | [
{
"input": "4\nalex\nivan\nroman\nivan",
"output": "ivan\nroman\nalex"
},
{
"input": "8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina",
"output": "alina\nmaria\nekaterina\ndarya"
},
{
"input": "1\nwdi",
"output": "wdi"
},
{
"input": "2\nypg\nypg",
"output": "ypg"
},
{
"input": "3\nexhll\nexhll\narruapexj",
"output": "arruapexj\nexhll"
},
{
"input": "3\nfv\nle\nle",
"output": "le\nfv"
},
{
"input": "8\nm\nm\nm\nm\nm\nm\nm\nm",
"output": "m"
},
{
"input": "10\nr\nr\ni\nw\nk\nr\nb\nu\nu\nr",
"output": "r\nu\nb\nk\nw\ni"
},
{
"input": "7\ne\nfau\ncmk\nnzs\nby\nwx\ntjmok",
"output": "tjmok\nwx\nby\nnzs\ncmk\nfau\ne"
},
{
"input": "6\nklrj\nwe\nklrj\nwe\nwe\nwe",
"output": "we\nklrj"
},
{
"input": "8\nzncybqmh\naeebef\nzncybqmh\nn\naeebef\nzncybqmh\nzncybqmh\nzncybqmh",
"output": "zncybqmh\naeebef\nn"
},
{
"input": "30\nkqqcbs\nvap\nkymomn\nj\nkqqcbs\nfuzlzoum\nkymomn\ndbh\nfuzlzoum\nkymomn\nvap\nvlgzs\ndbh\nvlgzs\nbvy\ndbh\nkymomn\nkymomn\neoqql\nkymomn\nkymomn\nkqqcbs\nvlgzs\nkqqcbs\nkqqcbs\nfuzlzoum\nvlgzs\nrylgdoo\nvlgzs\nrylgdoo",
"output": "rylgdoo\nvlgzs\nfuzlzoum\nkqqcbs\nkymomn\neoqql\ndbh\nbvy\nvap\nj"
},
{
"input": "40\nji\nv\nv\nns\nji\nn\nji\nv\nfvy\nvje\nns\nvje\nv\nhas\nv\nusm\nhas\nfvy\nvje\nkdb\nn\nv\nji\nji\nn\nhas\nv\nji\nkdb\nr\nvje\nns\nv\nusm\nn\nvje\nhas\nns\nhas\nn",
"output": "n\nhas\nns\nvje\nusm\nv\nr\nkdb\nji\nfvy"
},
{
"input": "50\njcg\nvle\njopb\nepdb\nnkef\nfv\nxj\nufe\nfuy\noqta\ngbc\nyuz\nec\nyji\nkuux\ncwm\ntq\nnno\nhp\nzry\nxxpp\ntjvo\ngyz\nkwo\nvwqz\nyaqc\njnj\nwoav\nqcv\ndcu\ngc\nhovn\nop\nevy\ndc\ntrpu\nyb\nuzfa\npca\noq\nnhxy\nsiqu\nde\nhphy\nc\nwovu\nf\nbvv\ndsik\nlwyg",
"output": "lwyg\ndsik\nbvv\nf\nwovu\nc\nhphy\nde\nsiqu\nnhxy\noq\npca\nuzfa\nyb\ntrpu\ndc\nevy\nop\nhovn\ngc\ndcu\nqcv\nwoav\njnj\nyaqc\nvwqz\nkwo\ngyz\ntjvo\nxxpp\nzry\nhp\nnno\ntq\ncwm\nkuux\nyji\nec\nyuz\ngbc\noqta\nfuy\nufe\nxj\nfv\nnkef\nepdb\njopb\nvle\njcg"
},
{
"input": "100\nvhh\nvhh\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh",
"output": "vhh\nfa"
},
{
"input": "2\naa\nbb",
"output": "bb\naa"
},
{
"input": "2\naa\na",
"output": "a\naa"
},
{
"input": "3\naa\naa\naa",
"output": "aa"
},
{
"input": "5\naa\na\naa\na\naa",
"output": "aa\na"
},
{
"input": "7\naaaa\naaaa\naaa\na\naa\naaaaaaa\naaa",
"output": "aaa\naaaaaaa\naa\na\naaaa"
},
{
"input": "5\na\naa\naaa\naaaa\na",
"output": "a\naaaa\naaa\naa"
},
{
"input": "12\naaaaa\naaaaaa\naaaa\naaaaaa\naa\naaaa\naaaa\naaaaaa\na\naaa\naaaaaaaa\naa",
"output": "aa\naaaaaaaa\naaa\na\naaaaaa\naaaa\naaaaa"
},
{
"input": "3\na\naa\naaa",
"output": "aaa\naa\na"
},
{
"input": "9\nzzz\nzzzzz\nzzz\nzzzz\nzz\nzzzz\nzzzzz\nzzzz\nzzzzzzz",
"output": "zzzzzzz\nzzzz\nzzzzz\nzz\nzzz"
}
] | 1,691,532,834 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 95 | 1,216 | 28,876,800 | m = int(input())
chat_list = []
printed = set()
for _ in range(m):
ctt = input()
chat_list.append(ctt)
for i in range(len(chat_list) - 1, -1, -1):
ctt = chat_list[i]
if ctt not in printed:
print(chat_list[i])
printed.add(ctt)
| Title: Chat Order
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
Output Specification:
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
Demo Input:
['4\nalex\nivan\nroman\nivan\n', '8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n']
Demo Output:
['ivan\nroman\nalex\n', 'alina\nmaria\nekaterina\ndarya\n']
Note:
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex | ```python
m = int(input())
chat_list = []
printed = set()
for _ in range(m):
ctt = input()
chat_list.append(ctt)
for i in range(len(chat_list) - 1, -1, -1):
ctt = chat_list[i]
if ctt not in printed:
print(chat_list[i])
printed.add(ctt)
``` | 3 |
|
114 | A | Cifera | PROGRAMMING | 1,000 | [
"math"
] | null | null | When Petya went to school, he got interested in large numbers and what they were called in ancient times. For instance, he learned that the Russian word "tma" (which now means "too much to be counted") used to stand for a thousand and "tma tmyschaya" (which literally means "the tma of tmas") used to stand for a million.
Petya wanted to modernize the words we use for numbers and invented a word petricium that represents number *k*. Moreover, petricium la petricium stands for number *k*2, petricium la petricium la petricium stands for *k*3 and so on. All numbers of this form are called petriciumus cifera, and the number's importance is the number of articles la in its title.
Petya's invention brought on a challenge that needed to be solved quickly: does some number *l* belong to the set petriciumus cifera? As Petya is a very busy schoolboy he needs to automate the process, he asked you to solve it. | The first input line contains integer number *k*, the second line contains integer number *l* (2<=≤<=*k*,<=*l*<=≤<=231<=-<=1). | You should print in the first line of the output "YES", if the number belongs to the set petriciumus cifera and otherwise print "NO". If the number belongs to the set, then print on the seconds line the only number — the importance of number *l*. | [
"5\n25\n",
"3\n8\n"
] | [
"YES\n1\n",
"NO\n"
] | none | 500 | [
{
"input": "5\n25",
"output": "YES\n1"
},
{
"input": "3\n8",
"output": "NO"
},
{
"input": "123\n123",
"output": "YES\n0"
},
{
"input": "99\n970300",
"output": "NO"
},
{
"input": "1000\n6666666",
"output": "NO"
},
{
"input": "59\n3571",
"output": "NO"
},
{
"input": "256\n16777217",
"output": "NO"
},
{
"input": "4638\n21511044",
"output": "YES\n1"
},
{
"input": "24\n191102976",
"output": "YES\n5"
},
{
"input": "52010\n557556453",
"output": "NO"
},
{
"input": "61703211\n1750753082",
"output": "NO"
},
{
"input": "137\n2571353",
"output": "YES\n2"
},
{
"input": "8758\n1746157336",
"output": "NO"
},
{
"input": "2\n64",
"output": "YES\n5"
},
{
"input": "96\n884736",
"output": "YES\n2"
},
{
"input": "1094841453\n1656354409",
"output": "NO"
},
{
"input": "1154413\n1229512809",
"output": "NO"
},
{
"input": "2442144\n505226241",
"output": "NO"
},
{
"input": "11548057\n1033418098",
"output": "NO"
},
{
"input": "581\n196122941",
"output": "YES\n2"
},
{
"input": "146\n1913781536",
"output": "NO"
},
{
"input": "945916\n1403881488",
"output": "NO"
},
{
"input": "68269\n365689065",
"output": "NO"
},
{
"input": "30\n900",
"output": "YES\n1"
},
{
"input": "6\n1296",
"output": "YES\n3"
},
{
"input": "1470193122\n1420950405",
"output": "NO"
},
{
"input": "90750\n1793111557",
"output": "NO"
},
{
"input": "1950054\n1664545956",
"output": "NO"
},
{
"input": "6767692\n123762320",
"output": "NO"
},
{
"input": "1437134\n1622348229",
"output": "NO"
},
{
"input": "444103\n1806462642",
"output": "NO"
},
{
"input": "2592\n6718464",
"output": "YES\n1"
},
{
"input": "50141\n366636234",
"output": "NO"
},
{
"input": "835\n582182875",
"output": "YES\n2"
},
{
"input": "156604\n902492689",
"output": "NO"
},
{
"input": "27385965\n1742270058",
"output": "NO"
},
{
"input": "3\n9",
"output": "YES\n1"
},
{
"input": "35\n1838265625",
"output": "YES\n5"
},
{
"input": "8\n4096",
"output": "YES\n3"
},
{
"input": "85955\n945811082",
"output": "NO"
},
{
"input": "54958832\n956670209",
"output": "NO"
},
{
"input": "1475381\n1348159738",
"output": "NO"
},
{
"input": "7313241\n413670642",
"output": "NO"
},
{
"input": "582470\n2116368165",
"output": "NO"
},
{
"input": "26859739\n595086170",
"output": "NO"
},
{
"input": "249766393\n1582130",
"output": "NO"
},
{
"input": "11734\n137686756",
"output": "YES\n1"
},
{
"input": "925093\n1098566745",
"output": "NO"
},
{
"input": "40\n1600",
"output": "YES\n1"
},
{
"input": "2147483647\n2147483647",
"output": "YES\n0"
},
{
"input": "2147483646\n2147483647",
"output": "NO"
},
{
"input": "2147483647\n2147483646",
"output": "NO"
},
{
"input": "2\n2147483647",
"output": "NO"
},
{
"input": "2\n1073741825",
"output": "NO"
},
{
"input": "2\n1073741824",
"output": "YES\n29"
},
{
"input": "10000\n10",
"output": "NO"
},
{
"input": "10\n10000",
"output": "YES\n3"
},
{
"input": "10\n2000000000",
"output": "NO"
},
{
"input": "10\n1000000000",
"output": "YES\n8"
},
{
"input": "5\n1808548329",
"output": "NO"
},
{
"input": "2\n2147483646",
"output": "NO"
},
{
"input": "25\n125",
"output": "NO"
},
{
"input": "6\n18",
"output": "NO"
},
{
"input": "5\n30",
"output": "NO"
}
] | 1,612,867,221 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 19 | 154 | 0 | import math
k1 = int(input())
k2 = int(input())
val = math.log(k2)/math.log(k1)
if math.floor(val) == math.ceil(val):
print('YES')
print(int(val)-1)
else:
print('NO')
| Title: Cifera
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Petya went to school, he got interested in large numbers and what they were called in ancient times. For instance, he learned that the Russian word "tma" (which now means "too much to be counted") used to stand for a thousand and "tma tmyschaya" (which literally means "the tma of tmas") used to stand for a million.
Petya wanted to modernize the words we use for numbers and invented a word petricium that represents number *k*. Moreover, petricium la petricium stands for number *k*2, petricium la petricium la petricium stands for *k*3 and so on. All numbers of this form are called petriciumus cifera, and the number's importance is the number of articles la in its title.
Petya's invention brought on a challenge that needed to be solved quickly: does some number *l* belong to the set petriciumus cifera? As Petya is a very busy schoolboy he needs to automate the process, he asked you to solve it.
Input Specification:
The first input line contains integer number *k*, the second line contains integer number *l* (2<=≤<=*k*,<=*l*<=≤<=231<=-<=1).
Output Specification:
You should print in the first line of the output "YES", if the number belongs to the set petriciumus cifera and otherwise print "NO". If the number belongs to the set, then print on the seconds line the only number — the importance of number *l*.
Demo Input:
['5\n25\n', '3\n8\n']
Demo Output:
['YES\n1\n', 'NO\n']
Note:
none | ```python
import math
k1 = int(input())
k2 = int(input())
val = math.log(k2)/math.log(k1)
if math.floor(val) == math.ceil(val):
print('YES')
print(int(val)-1)
else:
print('NO')
``` | 0 |
|
110 | A | Nearly Lucky Number | PROGRAMMING | 800 | [
"implementation"
] | A. Nearly Lucky Number | 2 | 256 | Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number. | The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator. | Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes). | [
"40047\n",
"7747774\n",
"1000000000000000000\n"
] | [
"NO\n",
"YES\n",
"NO\n"
] | In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO". | 500 | [
{
"input": "40047",
"output": "NO"
},
{
"input": "7747774",
"output": "YES"
},
{
"input": "1000000000000000000",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "4",
"output": "NO"
},
{
"input": "474404774",
"output": "NO"
},
{
"input": "4744000695826",
"output": "YES"
},
{
"input": "10000000004744744",
"output": "YES"
},
{
"input": "446486416781684178",
"output": "YES"
},
{
"input": "999999999",
"output": "NO"
},
{
"input": "7777",
"output": "YES"
},
{
"input": "87414417444",
"output": "NO"
},
{
"input": "111222333444555667",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "4700",
"output": "NO"
},
{
"input": "3794555488744477",
"output": "NO"
},
{
"input": "444444444444444444",
"output": "NO"
},
{
"input": "474447447774444774",
"output": "NO"
},
{
"input": "777777777777777",
"output": "NO"
},
{
"input": "34777745021000000",
"output": "NO"
},
{
"input": "963",
"output": "NO"
},
{
"input": "855474448854788540",
"output": "NO"
},
{
"input": "999999999999994744",
"output": "YES"
},
{
"input": "400000000474",
"output": "YES"
},
{
"input": "123456789123456789",
"output": "YES"
},
{
"input": "740577777584945874",
"output": "NO"
},
{
"input": "7777777",
"output": "YES"
},
{
"input": "4444000111222333",
"output": "YES"
},
{
"input": "9847745885202111",
"output": "YES"
},
{
"input": "123456000000",
"output": "NO"
},
{
"input": "4744447444444",
"output": "NO"
},
{
"input": "7477",
"output": "YES"
},
{
"input": "4747477",
"output": "YES"
},
{
"input": "777777777444444444",
"output": "NO"
}
] | 1,698,389,095 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 92 | 0 | import sys
liczba = int(input())
strLiczba = str(liczba)
for i in range(len(strLiczba)):
x = liczba % 10
if x == 4 or x == 7:
liczba = liczba // 10
else:
print("NO")
sys.exit()
print("YES")
| Title: Nearly Lucky Number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Output Specification:
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
Demo Input:
['40047\n', '7747774\n', '1000000000000000000\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO". | ```python
import sys
liczba = int(input())
strLiczba = str(liczba)
for i in range(len(strLiczba)):
x = liczba % 10
if x == 4 or x == 7:
liczba = liczba // 10
else:
print("NO")
sys.exit()
print("YES")
``` | 0 |
902 | A | Visiting a Friend | PROGRAMMING | 1,100 | [
"greedy",
"implementation"
] | null | null | Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car. | The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*). | Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower). | [
"3 5\n0 2\n2 4\n3 5\n",
"3 7\n0 4\n2 5\n6 7\n"
] | [
"YES\n",
"NO\n"
] | The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports. | 500 | [
{
"input": "3 5\n0 2\n2 4\n3 5",
"output": "YES"
},
{
"input": "3 7\n0 4\n2 5\n6 7",
"output": "NO"
},
{
"input": "1 1\n0 0",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 8\n8 8\n9 9\n9 9\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 100\n71 73\n80 94\n81 92\n84 85\n85 100\n88 91\n91 95\n92 98\n92 98\n99 100\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 6\n1 6\n1 2\n1 3\n1 2\n1 3\n2 5\n2 4\n2 3\n2 4\n2 6\n2 2\n2 5\n2 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 9\n3 3\n3 7\n3 9\n3 3\n3 9\n4 6\n4 7\n4 5\n4 7\n5 8\n5 5\n5 9\n5 7\n5 5\n6 6\n6 9\n6 7\n6 8\n6 9\n6 8\n7 7\n7 8\n7 7\n7 8\n8 9\n8 8\n8 9\n8 8\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 10\n8 10\n9 9\n9 9\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 100\n1 38\n2 82\n5 35\n7 71\n8 53\n11 49\n15 27\n17 84\n17 75\n18 99\n18 43\n18 69\n21 89\n27 60\n27 29\n38 62\n38 77\n39 83\n40 66\n48 80\n48 100\n50 51\n50 61\n53 77\n53 63\n55 58\n56 68\n60 82\n62 95\n66 74\n67 83\n69 88\n69 81\n69 88\n69 98\n70 91\n70 76\n71 90\n72 99\n81 99\n85 87\n88 97\n88 93\n90 97\n90 97\n92 98\n98 99\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 10\n1 9\n1 6\n1 2\n1 3\n1 2\n2 6\n2 5\n2 4\n2 3\n2 10\n2 2\n2 6\n2 2\n3 10\n3 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 10\n3 5\n3 3\n3 7\n4 8\n4 8\n4 9\n4 6\n5 7\n5 10\n5 7\n5 8\n5 5\n6 8\n6 9\n6 10\n6 6\n6 9\n6 7\n7 8\n7 9\n7 10\n7 10\n8 8\n8 8\n8 9\n8 10\n9 10\n9 9\n9 10\n9 10\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 4\n1 5\n1 9\n1 1\n1 6\n1 6\n2 5\n2 7\n2 7\n2 7\n2 7\n3 4\n3 7\n3 9\n3 5\n3 3\n4 4\n4 6\n4 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n5 8\n5 9\n5 8\n6 8\n6 7\n6 8\n6 9\n6 9\n6 6\n6 9\n6 7\n7 7\n7 7\n7 7\n7 8\n7 7\n7 8\n7 8\n7 9\n8 8\n8 8\n8 8\n8 8\n8 8\n8 9\n8 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 40\n38 38\n40 40",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 92\n92 97\n96 99\n97 98\n97 99\n99 99\n100 100\n100 100\n100 100",
"output": "NO"
},
{
"input": "1 10\n0 10",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 40\n23 23\n23 28\n24 29\n25 38\n26 35\n27 37\n28 39\n28 33\n28 40\n28 33\n29 31\n29 33\n30 38\n30 36\n30 30\n30 38\n31 37\n31 35\n31 32\n31 36\n33 39\n33 40\n35 38\n36 38\n37 38\n37 40\n38 39\n38 40\n38 39\n39 39\n39 40\n40 40\n40 40\n40 40\n40 40",
"output": "YES"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 40\n11 31\n12 26\n13 25\n14 32\n17 19\n21 29\n22 36\n24 27\n25 39\n25 27\n27 32\n27 29\n27 39\n27 29\n28 38\n30 38\n32 40\n32 38\n33 33\n33 40\n34 35\n34 34\n34 38\n34 38\n35 37\n36 39\n36 39\n37 37\n38 40\n39 39\n40 40",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 22\n23 28\n23 39\n24 24\n25 27\n26 38\n27 39\n28 33\n28 39\n28 34\n28 33\n29 30\n29 35\n30 30\n30 38\n30 34\n30 31\n31 36\n31 31\n31 32\n31 38\n33 34\n33 34\n35 36\n36 38\n37 38\n37 39\n38 38\n38 38\n38 38\n39 39\n39 39\n40 40\n40 40\n40 40\n40 40",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n88 99",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 10\n7 10\n9 10",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 5\n4 8\n5 5\n5 7\n6 7\n6 6\n7 7\n7 7\n7 7\n7 8\n7 8\n8 8\n8 8\n8 9\n8 8\n8 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n32 37",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 10\n4 6\n5 9\n5 5\n6 7\n6 10\n7 8\n7 7\n7 7\n7 7\n7 10\n8 8\n8 8\n8 10\n8 8\n8 8\n9 10\n9 10\n9 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "1 1\n0 1",
"output": "YES"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 36\n38 38\n40 40",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 82\n71 94\n80 90\n81 88\n84 93\n85 89\n88 92\n91 97\n92 99\n92 97\n99 99\n100 100",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n79 100",
"output": "YES"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n37 40",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 10\n1 2\n1 5\n1 10\n1 8\n1 1\n2 8\n2 7\n2 5\n2 5\n2 7\n3 5\n3 7\n3 5\n3 4\n3 7\n4 7\n4 8\n4 6\n5 7\n5 10\n5 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n6 10\n6 9\n6 7\n6 10\n6 8\n6 7\n6 10\n6 10\n7 8\n7 9\n7 8\n7 8\n7 8\n7 8\n7 7\n7 7\n8 8\n8 8\n8 10\n8 9\n8 9\n8 9\n8 9\n9 9\n9 10\n9 9\n9 9\n9 9\n9 9\n9 10\n9 10\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 7\n1 69\n2 83\n5 67\n7 82\n8 31\n11 25\n15 44\n17 75\n17 27\n18 43\n18 69\n18 40\n21 66\n27 29\n27 64\n38 77\n38 90\n39 52\n40 60\n48 91\n48 98\n50 89\n50 63\n53 54\n53 95\n55 76\n56 59\n60 96\n62 86\n66 70\n67 77\n69 88\n69 98\n69 80\n69 95\n70 74\n70 77\n71 99\n72 73\n81 87\n85 99\n88 96\n88 91\n90 97\n90 99\n92 92\n98 99\n100 100",
"output": "NO"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 35\n11 23\n12 36\n13 31\n14 31\n17 17\n21 25\n22 33\n24 26\n25 32\n25 25\n27 39\n27 29\n27 34\n27 32\n28 34\n30 36\n32 37\n32 33\n33 35\n33 33\n34 38\n34 38\n34 36\n34 36\n35 36\n36 36\n36 39\n37 37\n38 39\n39 39\n40 40",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 9\n7 7\n9 9",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 100\n92 97\n96 96\n97 98\n97 100\n99 100\n100 100\n100 100\n100 100",
"output": "YES"
},
{
"input": "2 2\n0 2\n0 1",
"output": "YES"
},
{
"input": "2 100\n0 49\n50 100",
"output": "NO"
},
{
"input": "2 100\n0 50\n50 100",
"output": "YES"
},
{
"input": "10 100\n0 10\n10 20\n20 30\n30 40\n40 50\n50 60\n60 70\n70 80\n80 90\n90 100",
"output": "YES"
},
{
"input": "100 10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 10",
"output": "YES"
},
{
"input": "1 4\n1 4",
"output": "NO"
},
{
"input": "3 5\n0 2\n2 5\n3 4",
"output": "YES"
},
{
"input": "2 5\n0 5\n1 2",
"output": "YES"
},
{
"input": "5 5\n0 2\n0 2\n3 5\n3 5\n3 5",
"output": "NO"
},
{
"input": "4 10\n0 3\n2 10\n4 10\n5 7",
"output": "YES"
},
{
"input": "3 8\n0 0\n1 8\n2 8",
"output": "NO"
},
{
"input": "6 8\n0 3\n1 5\n2 3\n5 6\n6 7\n7 8",
"output": "YES"
}
] | 1,684,741,687 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 55 | 62 | 0 | def can_visit_friend(n, m, teleports):
current_pos = 0
for i in range(n):
ai, bi = teleports[i]
if ai > current_pos:
return "NO"
current_pos = max(current_pos, bi)
if current_pos >= m:
return "YES"
return "YES" if current_pos >= m else "NO"
n, m = map(int, input().split())
teleports = []
for _ in range(n):
ai, bi = map(int, input().split())
teleports.append((ai, bi))
result = can_visit_friend(n, m, teleports)
print(result) | Title: Visiting a Friend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*).
Output Specification:
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['3 5\n0 2\n2 4\n3 5\n', '3 7\n0 4\n2 5\n6 7\n']
Demo Output:
['YES\n', 'NO\n']
Note:
The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports. | ```python
def can_visit_friend(n, m, teleports):
current_pos = 0
for i in range(n):
ai, bi = teleports[i]
if ai > current_pos:
return "NO"
current_pos = max(current_pos, bi)
if current_pos >= m:
return "YES"
return "YES" if current_pos >= m else "NO"
n, m = map(int, input().split())
teleports = []
for _ in range(n):
ai, bi = map(int, input().split())
teleports.append((ai, bi))
result = can_visit_friend(n, m, teleports)
print(result)
``` | 3 |
|
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
] | A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] | [
"word\nl10n\ni18n\np43s\n"
] | none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,681,312,460 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | # 1st step : split string into a list of characters
word = input()
c = [x for x in word]
# 2nd step: read the list and - 2 to get n
n = len(c) - 2
# 3rd step : Define
num1 = c[0]
num2 = c[-1]
# 4th step : join and print :
o = [num1, n , num2]
b = ' '.join(str(e)for e in o)
c = b.replace(" ","")
print(c)
| Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
# 1st step : split string into a list of characters
word = input()
c = [x for x in word]
# 2nd step: read the list and - 2 to get n
n = len(c) - 2
# 3rd step : Define
num1 = c[0]
num2 = c[-1]
# 4th step : join and print :
o = [num1, n , num2]
b = ' '.join(str(e)for e in o)
c = b.replace(" ","")
print(c)
``` | 0 |
56 | A | Bar | PROGRAMMING | 1,000 | [
"implementation"
] | A. Bar | 2 | 256 | According to Berland laws it is only allowed to sell alcohol to people not younger than 18 years. Vasya's job is to monitor the law's enforcement. Tonight he entered a bar and saw *n* people sitting there. For every one of them Vasya happened to determine either the age or the drink the person is having. Vasya can check any person, i.e. learn his age and the drink he is having at the same time. What minimal number of people should Vasya check additionally to make sure that there are no clients under 18 having alcohol drinks?
The list of all alcohol drinks in Berland is: ABSINTH, BEER, BRANDY, CHAMPAGNE, GIN, RUM, SAKE, TEQUILA, VODKA, WHISKEY, WINE | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of the bar's clients. Then follow *n* lines, each describing one visitor. A line either contains his age (an integer from 0 to 1000) or his drink (a string of capital Latin letters from 1 to 100 in length). It is guaranteed that the input data does not contain spaces and other unnecessary separators.
Only the drinks from the list given above should be considered alcohol. | Print a single number which is the number of people Vasya should check to guarantee the law enforcement. | [
"5\n18\nVODKA\nCOKE\n19\n17\n"
] | [
"2\n"
] | In the sample test the second and fifth clients should be checked. | 500 | [
{
"input": "5\n18\nVODKA\nCOKE\n19\n17",
"output": "2"
},
{
"input": "2\n2\nGIN",
"output": "2"
},
{
"input": "3\nWHISKEY\n3\nGIN",
"output": "3"
},
{
"input": "4\n813\nIORBQITQXMPTFAEMEQDQIKFGKGOTNKTOSZCBRPXJLUKVLVHJYNRUJXK\nRUM\nRHVRWGODYWWTYZFLFYKCVUFFRTQDINKNWPKFHZBFWBHWINWJW",
"output": "1"
},
{
"input": "4\nSAKE\nSAKE\n13\n2",
"output": "4"
},
{
"input": "2\n0\n17",
"output": "2"
},
{
"input": "1\n0",
"output": "1"
}
] | 1,613,475,840 | 2,147,483,647 | Python 3 | OK | TESTS | 28 | 124 | 0 | a='ABSINTH BEER BRANDY CHAMPAGNE GIN RUM SAKE TEQUILA VODKA WHISKEY WINE'.split()
n=int(input())
ans=0
for i in range(n):
x=input()
if x in a or x.isdigit() and int(x)<18:ans+=1
print(ans) | Title: Bar
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
According to Berland laws it is only allowed to sell alcohol to people not younger than 18 years. Vasya's job is to monitor the law's enforcement. Tonight he entered a bar and saw *n* people sitting there. For every one of them Vasya happened to determine either the age or the drink the person is having. Vasya can check any person, i.e. learn his age and the drink he is having at the same time. What minimal number of people should Vasya check additionally to make sure that there are no clients under 18 having alcohol drinks?
The list of all alcohol drinks in Berland is: ABSINTH, BEER, BRANDY, CHAMPAGNE, GIN, RUM, SAKE, TEQUILA, VODKA, WHISKEY, WINE
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) which is the number of the bar's clients. Then follow *n* lines, each describing one visitor. A line either contains his age (an integer from 0 to 1000) or his drink (a string of capital Latin letters from 1 to 100 in length). It is guaranteed that the input data does not contain spaces and other unnecessary separators.
Only the drinks from the list given above should be considered alcohol.
Output Specification:
Print a single number which is the number of people Vasya should check to guarantee the law enforcement.
Demo Input:
['5\n18\nVODKA\nCOKE\n19\n17\n']
Demo Output:
['2\n']
Note:
In the sample test the second and fifth clients should be checked. | ```python
a='ABSINTH BEER BRANDY CHAMPAGNE GIN RUM SAKE TEQUILA VODKA WHISKEY WINE'.split()
n=int(input())
ans=0
for i in range(n):
x=input()
if x in a or x.isdigit() and int(x)<18:ans+=1
print(ans)
``` | 3.969 |
746 | A | Compote | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Nikolay has *a* lemons, *b* apples and *c* pears. He decided to cook a compote. According to the recipe the fruits should be in the ratio 1:<=2:<=4. It means that for each lemon in the compote should be exactly 2 apples and exactly 4 pears. You can't crumble up, break up or cut these fruits into pieces. These fruits — lemons, apples and pears — should be put in the compote as whole fruits.
Your task is to determine the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. It is possible that Nikolay can't use any fruits, in this case print 0. | The first line contains the positive integer *a* (1<=≤<=*a*<=≤<=1000) — the number of lemons Nikolay has.
The second line contains the positive integer *b* (1<=≤<=*b*<=≤<=1000) — the number of apples Nikolay has.
The third line contains the positive integer *c* (1<=≤<=*c*<=≤<=1000) — the number of pears Nikolay has. | Print the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. | [
"2\n5\n7\n",
"4\n7\n13\n",
"2\n3\n2\n"
] | [
"7\n",
"21\n",
"0\n"
] | In the first example Nikolay can use 1 lemon, 2 apples and 4 pears, so the answer is 1 + 2 + 4 = 7.
In the second example Nikolay can use 3 lemons, 6 apples and 12 pears, so the answer is 3 + 6 + 12 = 21.
In the third example Nikolay don't have enough pears to cook any compote, so the answer is 0. | 500 | [
{
"input": "2\n5\n7",
"output": "7"
},
{
"input": "4\n7\n13",
"output": "21"
},
{
"input": "2\n3\n2",
"output": "0"
},
{
"input": "1\n1\n1",
"output": "0"
},
{
"input": "1\n2\n4",
"output": "7"
},
{
"input": "1000\n1000\n1000",
"output": "1750"
},
{
"input": "1\n1\n4",
"output": "0"
},
{
"input": "1\n2\n3",
"output": "0"
},
{
"input": "1\n1000\n1000",
"output": "7"
},
{
"input": "1000\n1\n1000",
"output": "0"
},
{
"input": "1000\n2\n1000",
"output": "7"
},
{
"input": "1000\n500\n1000",
"output": "1750"
},
{
"input": "1000\n1000\n4",
"output": "7"
},
{
"input": "1000\n1000\n3",
"output": "0"
},
{
"input": "4\n8\n12",
"output": "21"
},
{
"input": "10\n20\n40",
"output": "70"
},
{
"input": "100\n200\n399",
"output": "693"
},
{
"input": "200\n400\n800",
"output": "1400"
},
{
"input": "199\n400\n800",
"output": "1393"
},
{
"input": "201\n400\n800",
"output": "1400"
},
{
"input": "200\n399\n800",
"output": "1393"
},
{
"input": "200\n401\n800",
"output": "1400"
},
{
"input": "200\n400\n799",
"output": "1393"
},
{
"input": "200\n400\n801",
"output": "1400"
},
{
"input": "139\n252\n871",
"output": "882"
},
{
"input": "109\n346\n811",
"output": "763"
},
{
"input": "237\n487\n517",
"output": "903"
},
{
"input": "161\n331\n725",
"output": "1127"
},
{
"input": "39\n471\n665",
"output": "273"
},
{
"input": "9\n270\n879",
"output": "63"
},
{
"input": "137\n422\n812",
"output": "959"
},
{
"input": "15\n313\n525",
"output": "105"
},
{
"input": "189\n407\n966",
"output": "1323"
},
{
"input": "18\n268\n538",
"output": "126"
},
{
"input": "146\n421\n978",
"output": "1022"
},
{
"input": "70\n311\n685",
"output": "490"
},
{
"input": "244\n405\n625",
"output": "1092"
},
{
"input": "168\n454\n832",
"output": "1176"
},
{
"input": "46\n344\n772",
"output": "322"
},
{
"input": "174\n438\n987",
"output": "1218"
},
{
"input": "144\n387\n693",
"output": "1008"
},
{
"input": "22\n481\n633",
"output": "154"
},
{
"input": "196\n280\n848",
"output": "980"
},
{
"input": "190\n454\n699",
"output": "1218"
},
{
"input": "231\n464\n928",
"output": "1617"
},
{
"input": "151\n308\n616",
"output": "1057"
},
{
"input": "88\n182\n364",
"output": "616"
},
{
"input": "12\n26\n52",
"output": "84"
},
{
"input": "204\n412\n824",
"output": "1428"
},
{
"input": "127\n256\n512",
"output": "889"
},
{
"input": "224\n446\n896",
"output": "1561"
},
{
"input": "146\n291\n584",
"output": "1015"
},
{
"input": "83\n164\n332",
"output": "574"
},
{
"input": "20\n38\n80",
"output": "133"
},
{
"input": "198\n393\n792",
"output": "1372"
},
{
"input": "120\n239\n480",
"output": "833"
},
{
"input": "208\n416\n831",
"output": "1449"
},
{
"input": "130\n260\n517",
"output": "903"
},
{
"input": "67\n134\n267",
"output": "462"
},
{
"input": "245\n490\n979",
"output": "1708"
},
{
"input": "182\n364\n727",
"output": "1267"
},
{
"input": "104\n208\n413",
"output": "721"
},
{
"input": "10\n2\n100",
"output": "7"
},
{
"input": "2\n100\n100",
"output": "14"
},
{
"input": "2\n3\n8",
"output": "7"
},
{
"input": "1\n2\n8",
"output": "7"
},
{
"input": "1\n2\n200",
"output": "7"
},
{
"input": "5\n4\n16",
"output": "14"
},
{
"input": "1\n10\n10",
"output": "7"
},
{
"input": "1\n4\n8",
"output": "7"
},
{
"input": "100\n4\n1000",
"output": "14"
},
{
"input": "2\n6\n12",
"output": "14"
},
{
"input": "10\n7\n4",
"output": "7"
},
{
"input": "2\n10\n100",
"output": "14"
},
{
"input": "2\n3\n4",
"output": "7"
},
{
"input": "1\n2\n999",
"output": "7"
},
{
"input": "1\n10\n20",
"output": "7"
},
{
"input": "100\n18\n20",
"output": "35"
},
{
"input": "100\n1\n100",
"output": "0"
},
{
"input": "3\n7\n80",
"output": "21"
},
{
"input": "2\n8\n24",
"output": "14"
},
{
"input": "1\n100\n100",
"output": "7"
},
{
"input": "2\n1\n8",
"output": "0"
},
{
"input": "10\n5\n23",
"output": "14"
}
] | 1,655,866,343 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 15 | 0 | [a, b, c] = map(int,input().split())
if (a == 0):
print ("0")
elif (b > 2 * a):
while (b > 2 * a):
b = b - 1
elif (c > 4 * a):
while (c > 4 * a):
c == c - 1
print (a+b+c) | Title: Compote
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nikolay has *a* lemons, *b* apples and *c* pears. He decided to cook a compote. According to the recipe the fruits should be in the ratio 1:<=2:<=4. It means that for each lemon in the compote should be exactly 2 apples and exactly 4 pears. You can't crumble up, break up or cut these fruits into pieces. These fruits — lemons, apples and pears — should be put in the compote as whole fruits.
Your task is to determine the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. It is possible that Nikolay can't use any fruits, in this case print 0.
Input Specification:
The first line contains the positive integer *a* (1<=≤<=*a*<=≤<=1000) — the number of lemons Nikolay has.
The second line contains the positive integer *b* (1<=≤<=*b*<=≤<=1000) — the number of apples Nikolay has.
The third line contains the positive integer *c* (1<=≤<=*c*<=≤<=1000) — the number of pears Nikolay has.
Output Specification:
Print the maximum total number of lemons, apples and pears from which Nikolay can cook the compote.
Demo Input:
['2\n5\n7\n', '4\n7\n13\n', '2\n3\n2\n']
Demo Output:
['7\n', '21\n', '0\n']
Note:
In the first example Nikolay can use 1 lemon, 2 apples and 4 pears, so the answer is 1 + 2 + 4 = 7.
In the second example Nikolay can use 3 lemons, 6 apples and 12 pears, so the answer is 3 + 6 + 12 = 21.
In the third example Nikolay don't have enough pears to cook any compote, so the answer is 0. | ```python
[a, b, c] = map(int,input().split())
if (a == 0):
print ("0")
elif (b > 2 * a):
while (b > 2 * a):
b = b - 1
elif (c > 4 * a):
while (c > 4 * a):
c == c - 1
print (a+b+c)
``` | -1 |
|
31 | A | Worms Evolution | PROGRAMMING | 1,200 | [
"implementation"
] | A. Worms Evolution | 2 | 256 | Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form. | Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*. | [
"5\n1 2 3 5 7\n",
"5\n1 8 1 5 1\n"
] | [
"3 2 1\n",
"-1\n"
] | none | 500 | [
{
"input": "5\n1 2 3 5 7",
"output": "3 2 1"
},
{
"input": "5\n1 8 1 5 1",
"output": "-1"
},
{
"input": "4\n303 872 764 401",
"output": "-1"
},
{
"input": "6\n86 402 133 524 405 610",
"output": "6 4 1"
},
{
"input": "8\n217 779 418 895 996 473 3 22",
"output": "5 2 1"
},
{
"input": "10\n858 972 670 15 662 114 33 273 53 310",
"output": "2 6 1"
},
{
"input": "100\n611 697 572 770 603 870 128 245 49 904 468 982 788 943 549 288 668 796 803 515 999 735 912 49 298 80 412 841 494 434 543 298 17 571 271 105 70 313 178 755 194 279 585 766 412 164 907 841 776 556 731 268 735 880 176 267 287 65 239 588 155 658 821 47 783 595 585 69 226 906 429 161 999 148 7 484 362 585 952 365 92 749 904 525 307 626 883 367 450 755 564 950 728 724 69 106 119 157 96 290",
"output": "1 38 25"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "1 63 61"
},
{
"input": "100\n156 822 179 298 981 82 610 345 373 378 895 734 768 15 78 335 764 608 932 297 717 553 916 367 425 447 361 195 66 70 901 236 905 744 919 564 296 610 963 628 840 52 100 750 345 308 37 687 192 704 101 815 10 990 216 358 823 546 578 821 706 148 182 582 421 482 829 425 121 337 500 301 402 868 66 935 625 527 746 585 308 523 488 914 608 709 875 252 151 781 447 2 756 176 976 302 450 35 680 791",
"output": "1 98 69"
},
{
"input": "100\n54 947 785 838 359 647 92 445 48 465 323 486 101 86 607 31 860 420 709 432 435 372 272 37 903 814 309 197 638 58 259 822 793 564 309 22 522 907 101 853 486 824 614 734 630 452 166 532 256 499 470 9 933 452 256 450 7 26 916 406 257 285 895 117 59 369 424 133 16 417 352 440 806 236 478 34 889 469 540 806 172 296 73 655 261 792 868 380 204 454 330 53 136 629 236 850 134 560 264 291",
"output": "2 29 27"
},
{
"input": "99\n175 269 828 129 499 890 127 263 995 807 508 289 996 226 437 320 365 642 757 22 190 8 345 499 834 713 962 889 336 171 608 492 320 257 472 801 176 325 301 306 198 729 933 4 640 322 226 317 567 586 249 237 202 633 287 128 911 654 719 988 420 855 361 574 716 899 317 356 581 440 284 982 541 111 439 29 37 560 961 224 478 906 319 416 736 603 808 87 762 697 392 713 19 459 262 238 239 599 997",
"output": "1 44 30"
},
{
"input": "98\n443 719 559 672 16 69 529 632 953 999 725 431 54 22 346 968 558 696 48 669 963 129 257 712 39 870 498 595 45 821 344 925 179 388 792 346 755 213 423 365 344 659 824 356 773 637 628 897 841 155 243 536 951 361 192 105 418 431 635 596 150 162 145 548 473 531 750 306 377 354 450 975 79 743 656 733 440 940 19 139 237 346 276 227 64 799 479 633 199 17 796 362 517 234 729 62 995 535",
"output": "2 70 40"
},
{
"input": "97\n359 522 938 862 181 600 283 1000 910 191 590 220 761 818 903 264 751 751 987 316 737 898 168 925 244 674 34 950 754 472 81 6 37 520 112 891 981 454 897 424 489 238 363 709 906 951 677 828 114 373 589 835 52 89 97 435 277 560 551 204 879 469 928 523 231 163 183 609 821 915 615 969 616 23 874 437 844 321 78 53 643 786 585 38 744 347 150 179 988 985 200 11 15 9 547 886 752",
"output": "1 23 10"
},
{
"input": "4\n303 872 764 401",
"output": "-1"
},
{
"input": "100\n328 397 235 453 188 254 879 225 423 36 384 296 486 592 231 849 856 255 213 898 234 800 701 529 951 693 507 326 15 905 618 348 967 927 28 979 752 850 343 35 84 302 36 390 482 826 249 918 91 289 973 457 557 348 365 239 709 565 320 560 153 130 647 708 483 469 788 473 322 844 830 562 611 961 397 673 69 960 74 703 369 968 382 451 328 160 211 230 566 208 7 545 293 73 806 375 157 410 303 58",
"output": "1 79 6"
},
{
"input": "33\n52 145 137 734 180 847 178 286 716 134 181 630 358 764 593 762 785 28 1 468 189 540 764 485 165 656 114 58 628 108 605 584 257",
"output": "8 30 7"
},
{
"input": "57\n75 291 309 68 444 654 985 158 514 204 116 918 374 806 176 31 49 455 269 66 722 713 164 818 317 295 546 564 134 641 28 13 987 478 146 219 213 940 289 173 157 666 168 391 392 71 870 477 446 988 414 568 964 684 409 671 454",
"output": "2 41 29"
},
{
"input": "88\n327 644 942 738 84 118 981 686 530 404 137 197 434 16 693 183 423 325 410 345 941 329 7 106 79 867 584 358 533 675 192 718 641 329 900 768 404 301 101 538 954 590 401 954 447 14 559 337 756 586 934 367 538 928 945 936 770 641 488 579 206 869 902 139 216 446 723 150 829 205 373 578 357 368 960 40 121 206 503 385 521 161 501 694 138 370 709 308",
"output": "1 77 61"
},
{
"input": "100\n804 510 266 304 788 625 862 888 408 82 414 470 777 991 729 229 933 406 601 1 596 720 608 706 432 361 527 548 59 548 474 515 4 991 263 568 681 24 117 563 576 587 281 643 904 521 891 106 842 884 943 54 605 815 504 757 311 374 335 192 447 652 633 410 455 402 382 150 432 836 413 819 669 875 638 925 217 805 632 520 605 266 728 795 162 222 603 159 284 790 914 443 775 97 789 606 859 13 851 47",
"output": "1 77 42"
},
{
"input": "100\n449 649 615 713 64 385 927 466 138 126 143 886 80 199 208 43 196 694 92 89 264 180 617 970 191 196 910 150 275 89 693 190 191 99 542 342 45 592 114 56 451 170 64 589 176 102 308 92 402 153 414 675 352 157 69 150 91 288 163 121 816 184 20 234 836 12 593 150 793 439 540 93 99 663 186 125 349 247 476 106 77 523 215 7 363 278 441 745 337 25 148 384 15 915 108 211 240 58 23 408",
"output": "1 6 5"
},
{
"input": "90\n881 436 52 308 97 261 153 931 670 538 702 156 114 445 154 685 452 76 966 790 93 42 547 65 736 364 136 489 719 322 239 628 696 735 55 703 622 375 100 188 804 341 546 474 484 446 729 290 974 301 602 225 996 244 488 983 882 460 962 754 395 617 61 640 534 292 158 375 632 902 420 979 379 38 100 67 963 928 190 456 545 571 45 716 153 68 844 2 102 116",
"output": "1 14 2"
},
{
"input": "80\n313 674 262 240 697 146 391 221 793 504 896 818 92 899 86 370 341 339 306 887 937 570 830 683 729 519 240 833 656 847 427 958 435 704 853 230 758 347 660 575 843 293 649 396 437 787 654 599 35 103 779 783 447 379 444 585 902 713 791 150 851 228 306 721 996 471 617 403 102 168 197 741 877 481 968 545 331 715 236 654",
"output": "1 13 8"
},
{
"input": "70\n745 264 471 171 946 32 277 511 269 469 89 831 69 2 369 407 583 602 646 633 429 747 113 302 722 321 344 824 241 372 263 287 822 24 652 758 246 967 219 313 882 597 752 965 389 775 227 556 95 904 308 340 899 514 400 187 275 318 621 546 659 488 199 154 811 1 725 79 925 82",
"output": "1 63 60"
},
{
"input": "60\n176 502 680 102 546 917 516 801 392 435 635 492 398 456 653 444 472 513 634 378 273 276 44 920 68 124 800 167 825 250 452 264 561 344 98 933 381 939 426 51 568 548 206 887 342 763 151 514 156 354 486 546 998 649 356 438 295 570 450 589",
"output": "2 26 20"
},
{
"input": "50\n608 92 889 33 146 803 402 91 868 400 828 505 375 558 584 129 361 776 974 123 765 804 326 186 61 927 904 511 762 775 640 593 300 664 897 461 869 911 986 789 607 500 309 457 294 104 724 471 216 155",
"output": "3 25 11"
},
{
"input": "40\n40 330 98 612 747 336 640 381 991 366 22 167 352 12 868 166 603 40 313 869 609 981 609 804 54 729 8 854 347 300 828 922 39 633 695 988 4 530 545 176",
"output": "5 10 8"
},
{
"input": "30\n471 920 308 544 347 222 878 671 467 332 215 180 681 114 151 203 492 951 653 614 453 510 540 422 399 532 113 198 932 825",
"output": "2 21 9"
},
{
"input": "20\n551 158 517 475 595 108 764 961 590 297 761 841 659 568 82 888 733 214 993 359",
"output": "3 20 2"
},
{
"input": "10\n983 748 726 406 196 993 2 251 66 263",
"output": "-1"
},
{
"input": "9\n933 266 457 863 768 257 594 136 145",
"output": "-1"
},
{
"input": "8\n537 198 48 771 944 868 700 163",
"output": "7 8 1"
},
{
"input": "7\n140 779 639 679 768 479 158",
"output": "2 3 1"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "-1"
},
{
"input": "5\n700 939 173 494 120",
"output": "-1"
},
{
"input": "4\n303 872 764 401",
"output": "-1"
},
{
"input": "3\n907 452 355",
"output": "-1"
},
{
"input": "3\n963 630 333",
"output": "1 3 2"
},
{
"input": "3\n2 2 4",
"output": "3 2 1"
},
{
"input": "3\n2 4 100",
"output": "-1"
}
] | 1,667,605,405 | 2,147,483,647 | Python 3 | OK | TESTS | 39 | 92 | 0 | n = int(input())
data = list(input().split())
numbers_list = list(map(int, data))
numbers = sorted(numbers_list)
i = 0
j = 1
while i != n - 1:
if numbers[i] + numbers[j] not in numbers:
if i == n - 2:
print("-1")
break
if j != n - 1:
j += 1
else:
i += 1
j = i + 1
else:
target = numbers[i] + numbers[j]
if numbers[i] != numbers[j]:
first = numbers[i]
second = numbers[j]
print(f"{numbers_list.index(target) + 1} {numbers_list.index(second) + 1} {numbers_list.index(first) + 1}")
break
else:
twin = numbers[i]
first = [i for i, n in enumerate(numbers) if n == twin][0]
second = [i for i, n in enumerate(numbers) if n == twin][1]
print(f"{numbers_list.index(target) + 1} {second + 1} {first + 1}")
break | Title: Worms Evolution
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Professor Vasechkin is studying evolution of worms. Recently he put forward hypotheses that all worms evolve by division. There are *n* forms of worms. Worms of these forms have lengths *a*1, *a*2, ..., *a**n*. To prove his theory, professor needs to find 3 different forms that the length of the first form is equal to sum of lengths of the other two forms. Help him to do this.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of worm's forms. The second line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=1000) — lengths of worms of each form.
Output Specification:
Output 3 distinct integers *i* *j* *k* (1<=≤<=*i*,<=*j*,<=*k*<=≤<=*n*) — such indexes of worm's forms that *a**i*<==<=*a**j*<=+<=*a**k*. If there is no such triple, output -1. If there are several solutions, output any of them. It possible that *a**j*<==<=*a**k*.
Demo Input:
['5\n1 2 3 5 7\n', '5\n1 8 1 5 1\n']
Demo Output:
['3 2 1\n', '-1\n']
Note:
none | ```python
n = int(input())
data = list(input().split())
numbers_list = list(map(int, data))
numbers = sorted(numbers_list)
i = 0
j = 1
while i != n - 1:
if numbers[i] + numbers[j] not in numbers:
if i == n - 2:
print("-1")
break
if j != n - 1:
j += 1
else:
i += 1
j = i + 1
else:
target = numbers[i] + numbers[j]
if numbers[i] != numbers[j]:
first = numbers[i]
second = numbers[j]
print(f"{numbers_list.index(target) + 1} {numbers_list.index(second) + 1} {numbers_list.index(first) + 1}")
break
else:
twin = numbers[i]
first = [i for i, n in enumerate(numbers) if n == twin][0]
second = [i for i, n in enumerate(numbers) if n == twin][1]
print(f"{numbers_list.index(target) + 1} {second + 1} {first + 1}")
break
``` | 3.977 |
886 | A | ACM ICPC | PROGRAMMING | 1,000 | [
"brute force"
] | null | null | In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question. | The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants | Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES"). | [
"1 3 2 1 2 1\n",
"1 1 1 1 1 99\n"
] | [
"YES\n",
"NO\n"
] | In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater. | 500 | [
{
"input": "1 3 2 1 2 1",
"output": "YES"
},
{
"input": "1 1 1 1 1 99",
"output": "NO"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "YES"
},
{
"input": "0 0 0 0 0 0",
"output": "YES"
},
{
"input": "633 609 369 704 573 416",
"output": "NO"
},
{
"input": "353 313 327 470 597 31",
"output": "NO"
},
{
"input": "835 638 673 624 232 266",
"output": "NO"
},
{
"input": "936 342 19 398 247 874",
"output": "NO"
},
{
"input": "417 666 978 553 271 488",
"output": "NO"
},
{
"input": "71 66 124 199 67 147",
"output": "YES"
},
{
"input": "54 26 0 171 239 12",
"output": "YES"
},
{
"input": "72 8 186 92 267 69",
"output": "YES"
},
{
"input": "180 179 188 50 75 214",
"output": "YES"
},
{
"input": "16 169 110 136 404 277",
"output": "YES"
},
{
"input": "101 400 9 200 300 10",
"output": "YES"
},
{
"input": "101 400 200 9 300 10",
"output": "YES"
},
{
"input": "101 200 400 9 300 10",
"output": "YES"
},
{
"input": "101 400 200 300 9 10",
"output": "YES"
},
{
"input": "101 200 400 300 9 10",
"output": "YES"
},
{
"input": "4 4 4 4 5 4",
"output": "NO"
},
{
"input": "2 2 2 2 2 1",
"output": "NO"
},
{
"input": "1000 1000 999 1000 1000 1000",
"output": "NO"
},
{
"input": "129 1 10 29 8 111",
"output": "NO"
},
{
"input": "1000 1000 1000 999 999 1000",
"output": "YES"
},
{
"input": "101 200 300 400 9 10",
"output": "YES"
},
{
"input": "101 400 200 300 10 9",
"output": "YES"
},
{
"input": "101 200 400 300 10 9",
"output": "YES"
},
{
"input": "101 200 300 400 10 9",
"output": "YES"
},
{
"input": "101 200 300 10 400 9",
"output": "YES"
},
{
"input": "1 1 1 1 1 5",
"output": "NO"
},
{
"input": "8 1 1 3 3 0",
"output": "NO"
},
{
"input": "1 1 2 2 3 3",
"output": "YES"
},
{
"input": "1 2 2 5 2 5",
"output": "NO"
},
{
"input": "1 2 3 6 6 6",
"output": "NO"
},
{
"input": "36 91 7 86 51 89",
"output": "NO"
},
{
"input": "10 1 1 1 23 24",
"output": "NO"
},
{
"input": "1 1 1 10 23 24",
"output": "NO"
},
{
"input": "20 10 1 2 3 44",
"output": "NO"
},
{
"input": "7 0 14 11 8 6",
"output": "NO"
},
{
"input": "100 496 1 1 1 1",
"output": "NO"
},
{
"input": "5 4 2 5 11 3",
"output": "NO"
},
{
"input": "1 3 7 8 8 9",
"output": "YES"
},
{
"input": "1 3 4 5 18 19",
"output": "YES"
},
{
"input": "5 5 1 2 2 15",
"output": "NO"
},
{
"input": "2 1 0 0 0 5",
"output": "NO"
},
{
"input": "1 6 6 1 20 2",
"output": "NO"
},
{
"input": "2 10 0 0 0 0",
"output": "NO"
},
{
"input": "1 1 3 1 1 11",
"output": "NO"
},
{
"input": "10 10 1 1 1 37",
"output": "NO"
},
{
"input": "1 1 0 0 0 4",
"output": "NO"
},
{
"input": "1 1 10 1 1 28",
"output": "NO"
},
{
"input": "1 5 5 5 6 8",
"output": "YES"
},
{
"input": "0 2 3 4 4 5",
"output": "YES"
}
] | 1,511,328,492 | 2,147,483,647 | Python 3 | OK | TESTS | 53 | 77 | 0 | a=list(map(int,input().split()))
s=sum(a)
if s%2==1:
print('NO')
exit()
for i in range(6):
for j in range(i+1,6):
for k in range(j+1,6):
if a[i]+a[j]+a[k]==s//2:
print('YES')
exit()
print('NO')
| Title: ACM ICPC
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
Input Specification:
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
Output Specification:
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['1 3 2 1 2 1\n', '1 1 1 1 1 99\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater. | ```python
a=list(map(int,input().split()))
s=sum(a)
if s%2==1:
print('NO')
exit()
for i in range(6):
for j in range(i+1,6):
for k in range(j+1,6):
if a[i]+a[j]+a[k]==s//2:
print('YES')
exit()
print('NO')
``` | 3 |
|
681 | A | A Good Contest | PROGRAMMING | 800 | [
"implementation"
] | null | null | Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same? | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct. | Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise. | [
"3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n",
"3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n"
] | [
"YES",
"NO"
] | In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest. | 500 | [
{
"input": "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "NO"
},
{
"input": "1\nDb -3373 3591",
"output": "NO"
},
{
"input": "5\nQ2bz 960 2342\nhmX 2710 -1348\ngbAe -1969 -963\nE -160 196\npsi 2665 -3155",
"output": "NO"
},
{
"input": "9\nmwAz9lQ 1786 -1631\nnYgYFXZQfY -1849 -1775\nKU4jF -1773 -3376\nopR 3752 2931\nGl -1481 -1002\nR -1111 3778\n0i9B21DC 3650 289\nQ8L2dS0 358 -3305\ng -2662 3968",
"output": "NO"
},
{
"input": "5\nzMSBcOUf -2883 -2238\nYN -3314 -1480\nfHpuccQn06 -1433 -589\naM1NVEPQi 399 3462\n_L 2516 -3290",
"output": "NO"
},
{
"input": "1\na 2400 2401",
"output": "YES"
},
{
"input": "1\nfucker 4000 4000",
"output": "NO"
},
{
"input": "1\nJora 2400 2401",
"output": "YES"
},
{
"input": "1\nACA 2400 2420",
"output": "YES"
},
{
"input": "1\nAca 2400 2420",
"output": "YES"
},
{
"input": "1\nSub_d 2401 2402",
"output": "YES"
},
{
"input": "2\nHack 2400 2401\nDum 1243 555",
"output": "YES"
},
{
"input": "1\nXXX 2400 2500",
"output": "YES"
},
{
"input": "1\nfucker 2400 2401",
"output": "YES"
},
{
"input": "1\nX 2400 2500",
"output": "YES"
},
{
"input": "1\nvineet 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2500",
"output": "YES"
},
{
"input": "1\naaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nhoge 2400 2401",
"output": "YES"
},
{
"input": "1\nInfinity 2400 2468",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2401",
"output": "YES"
},
{
"input": "1\nFuck 2400 2401",
"output": "YES"
},
{
"input": "1\nfuck 2400 2401",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2401\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "YES"
},
{
"input": "1\nalex 2400 2401",
"output": "YES"
},
{
"input": "1\nA 2400 2401",
"output": "YES"
},
{
"input": "1\na 2400 2455",
"output": "YES"
},
{
"input": "1\nlol 2400 2401",
"output": "YES"
},
{
"input": "2\nBurunduk1 2400 2537\nBudAlNik 2084 2214",
"output": "YES"
},
{
"input": "1\naaaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2500",
"output": "YES"
},
{
"input": "1\nds 2400 2410",
"output": "YES"
},
{
"input": "1\nas 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2401",
"output": "YES"
},
{
"input": "3\nBudAlNik 2084 2214\nsubscriber 2833 2749\nBurunduk1 2526 2537",
"output": "YES"
},
{
"input": "1\ncaonima 2400 2401",
"output": "YES"
},
{
"input": "1\narr 2400 2500",
"output": "YES"
},
{
"input": "1\nx 2400 2401",
"output": "YES"
},
{
"input": "1\narrr 2400 2500",
"output": "YES"
},
{
"input": "1\nabc 2400 2405",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2420\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2537",
"output": "YES"
},
{
"input": "1\nHELLO 2400 2401",
"output": "YES"
},
{
"input": "1\neatmore 2400 2500",
"output": "YES"
},
{
"input": "1\nb 2400 2401",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nApplejack 2400 2410",
"output": "YES"
},
{
"input": "1\nabacaba 2400 2451",
"output": "YES"
},
{
"input": "1\nrekt_n00b 2500 2600",
"output": "YES"
}
] | 1,528,209,949 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 61 | 7,065,600 | for i in range(int(input())):
a , b , c= map(int , input().split())
if (int(b) >= 2400 and (int(c) > int(b))):print('YES');exit(0)
print('NO') | Title: A Good Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
Output Specification:
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
Demo Input:
['3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n', '3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n']
Demo Output:
['YES', 'NO']
Note:
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest. | ```python
for i in range(int(input())):
a , b , c= map(int , input().split())
if (int(b) >= 2400 and (int(c) > int(b))):print('YES');exit(0)
print('NO')
``` | -1 |
|
400 | A | Inna and Choose Options | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win. | The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start. | For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces. | [
"4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n"
] | [
"3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n"
] | none | 500 | [
{
"input": "4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO",
"output": "3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0"
},
{
"input": "2\nOOOOOOOOOOOO\nXXXXXXXXXXXX",
"output": "0\n6 1x12 2x6 3x4 4x3 6x2 12x1"
},
{
"input": "13\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX",
"output": "6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1"
}
] | 1,394,528,520 | 2,147,483,647 | Python 3 | OK | TESTS | 44 | 77 | 0 | T=int(input())
while T>=1:
T-=1
a=input()
list=[]
for i in range(1,13):
if 12 % i==0:
l=12//i
for j in range(0,l):
for k in range(0,i):
if a[k*l+j]!='X':
break
else:
break
else:
continue
list.append(i)
print(len(list),end=' ')
for i in range(0,len(list)):
print(str(list[i])+'x'+str(12//list[i]),end=' ')
print()
| Title: Inna and Choose Options
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win.
Input Specification:
The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start.
Output Specification:
For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces.
Demo Input:
['4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n']
Demo Output:
['3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n']
Note:
none | ```python
T=int(input())
while T>=1:
T-=1
a=input()
list=[]
for i in range(1,13):
if 12 % i==0:
l=12//i
for j in range(0,l):
for k in range(0,i):
if a[k*l+j]!='X':
break
else:
break
else:
continue
list.append(i)
print(len(list),end=' ')
for i in range(0,len(list)):
print(str(list[i])+'x'+str(12//list[i]),end=' ')
print()
``` | 3 |
|
620 | A | Professor GukiZ's Robot | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position. | The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot. | Print the only integer *d* — the minimal number of steps to get the finish position. | [
"0 0\n4 5\n",
"3 4\n6 1\n"
] | [
"5\n",
"3\n"
] | In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times. | 0 | [
{
"input": "0 0\n4 5",
"output": "5"
},
{
"input": "3 4\n6 1",
"output": "3"
},
{
"input": "0 0\n4 6",
"output": "6"
},
{
"input": "1 1\n-3 -5",
"output": "6"
},
{
"input": "-1 -1\n-10 100",
"output": "101"
},
{
"input": "1 -1\n100 -100",
"output": "99"
},
{
"input": "-1000000000 -1000000000\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n0 999999999",
"output": "1999999999"
},
{
"input": "0 0\n2 1",
"output": "2"
},
{
"input": "10 0\n100 0",
"output": "90"
},
{
"input": "1 5\n6 4",
"output": "5"
},
{
"input": "0 0\n5 4",
"output": "5"
},
{
"input": "10 1\n20 1",
"output": "10"
},
{
"input": "1 1\n-3 4",
"output": "4"
},
{
"input": "-863407280 504312726\n786535210 -661703810",
"output": "1649942490"
},
{
"input": "-588306085 -741137832\n341385643 152943311",
"output": "929691728"
},
{
"input": "0 0\n4 0",
"output": "4"
},
{
"input": "93097194 -48405232\n-716984003 -428596062",
"output": "810081197"
},
{
"input": "9 1\n1 1",
"output": "8"
},
{
"input": "4 6\n0 4",
"output": "4"
},
{
"input": "2 4\n5 2",
"output": "3"
},
{
"input": "-100000000 -100000000\n100000000 100000123",
"output": "200000123"
},
{
"input": "5 6\n5 7",
"output": "1"
},
{
"input": "12 16\n12 1",
"output": "15"
},
{
"input": "0 0\n5 1",
"output": "5"
},
{
"input": "0 1\n1 1",
"output": "1"
},
{
"input": "-44602634 913365223\n-572368780 933284951",
"output": "527766146"
},
{
"input": "-2 0\n2 -2",
"output": "4"
},
{
"input": "0 0\n3 1",
"output": "3"
},
{
"input": "-458 2\n1255 4548",
"output": "4546"
},
{
"input": "-5 -4\n-3 -3",
"output": "2"
},
{
"input": "4 5\n7 3",
"output": "3"
},
{
"input": "-1000000000 -999999999\n1000000000 999999998",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "-464122675 -898521847\n656107323 -625340409",
"output": "1120229998"
},
{
"input": "-463154699 -654742385\n-699179052 -789004997",
"output": "236024353"
},
{
"input": "982747270 -593488945\n342286841 -593604186",
"output": "640460429"
},
{
"input": "-80625246 708958515\n468950878 574646184",
"output": "549576124"
},
{
"input": "0 0\n1 0",
"output": "1"
},
{
"input": "109810 1\n2 3",
"output": "109808"
},
{
"input": "-9 0\n9 9",
"output": "18"
},
{
"input": "9 9\n9 9",
"output": "0"
},
{
"input": "1 1\n4 3",
"output": "3"
},
{
"input": "1 2\n45 1",
"output": "44"
},
{
"input": "207558188 -313753260\n-211535387 -721675423",
"output": "419093575"
},
{
"input": "-11 0\n0 0",
"output": "11"
},
{
"input": "-1000000000 1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "0 0\n1 1",
"output": "1"
},
{
"input": "0 0\n0 1",
"output": "1"
},
{
"input": "0 0\n-1 1",
"output": "1"
},
{
"input": "0 0\n-1 0",
"output": "1"
},
{
"input": "0 0\n-1 -1",
"output": "1"
},
{
"input": "0 0\n0 -1",
"output": "1"
},
{
"input": "0 0\n1 -1",
"output": "1"
},
{
"input": "10 90\n90 10",
"output": "80"
},
{
"input": "851016864 573579544\n-761410925 -380746263",
"output": "1612427789"
},
{
"input": "1 9\n9 9",
"output": "8"
},
{
"input": "1000 1000\n1000 1000",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "8"
},
{
"input": "1 90\n90 90",
"output": "89"
},
{
"input": "100 100\n1000 1000",
"output": "900"
},
{
"input": "-1 0\n0 0",
"output": "1"
},
{
"input": "-750595959 -2984043\n649569876 -749608783",
"output": "1400165835"
},
{
"input": "958048496 712083589\n423286949 810566863",
"output": "534761547"
},
{
"input": "146316710 53945094\n-523054748 147499505",
"output": "669371458"
},
{
"input": "50383856 -596516251\n-802950224 -557916272",
"output": "853334080"
},
{
"input": "-637204864 -280290367\n-119020929 153679771",
"output": "518183935"
},
{
"input": "-100 -100\n-60 -91",
"output": "40"
},
{
"input": "337537326 74909428\n-765558776 167951547",
"output": "1103096102"
},
{
"input": "0 81\n18 90",
"output": "18"
},
{
"input": "283722202 -902633305\n-831696497 -160868946",
"output": "1115418699"
},
{
"input": "1000 1000\n-1000 1000",
"output": "2000"
},
{
"input": "5 6\n4 8",
"output": "2"
},
{
"input": "40572000 597493595\n-935051731 368493185",
"output": "975623731"
},
{
"input": "-5 5\n5 5",
"output": "10"
}
] | 1,671,759,208 | 2,147,483,647 | Python 3 | OK | TESTS | 75 | 46 | 0 | x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
moo = 0
x, y = x1, y1
a = min(abs(x2-x1), abs(y2-y1))
moo += a
if x2 > x and y2 > y:
x += a
y += a
elif x2 < x and y2 < y:
x -= a
y -= a
elif x2 < x and y2 > y:
x -= a
y += a
else:
x += a
y -= a
if x == x2:
moo += abs(y2-y)
else:
moo += abs(x2-x)
print(moo) | Title: Professor GukiZ's Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
Input Specification:
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
Output Specification:
Print the only integer *d* — the minimal number of steps to get the finish position.
Demo Input:
['0 0\n4 5\n', '3 4\n6 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times. | ```python
x1, y1 = map(int, input().split())
x2, y2 = map(int, input().split())
moo = 0
x, y = x1, y1
a = min(abs(x2-x1), abs(y2-y1))
moo += a
if x2 > x and y2 > y:
x += a
y += a
elif x2 < x and y2 < y:
x -= a
y -= a
elif x2 < x and y2 > y:
x -= a
y += a
else:
x += a
y -= a
if x == x2:
moo += abs(y2-y)
else:
moo += abs(x2-x)
print(moo)
``` | 3 |
|
349 | A | Cinema Line | PROGRAMMING | 1,100 | [
"greedy",
"implementation"
] | null | null | The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line? | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line. | Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO". | [
"4\n25 25 50 50\n",
"2\n25 100\n",
"4\n50 50 25 25\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "4\n25 25 50 50",
"output": "YES"
},
{
"input": "2\n25 100",
"output": "NO"
},
{
"input": "4\n50 50 25 25",
"output": "NO"
},
{
"input": "3\n25 50 100",
"output": "NO"
},
{
"input": "10\n25 25 25 25 25 25 25 25 25 25",
"output": "YES"
},
{
"input": "10\n50 50 50 50 50 50 50 50 50 50",
"output": "NO"
},
{
"input": "10\n100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "7\n25 25 25 25 50 100 50",
"output": "YES"
},
{
"input": "2\n25 25",
"output": "YES"
},
{
"input": "3\n50 100 100",
"output": "NO"
},
{
"input": "3\n25 50 50",
"output": "NO"
},
{
"input": "2\n50 25",
"output": "NO"
},
{
"input": "14\n25 25 25 25 25 25 25 50 50 50 100 100 100 100",
"output": "NO"
},
{
"input": "5\n25 25 25 100 100",
"output": "NO"
},
{
"input": "7\n25 50 25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 25 50 50 50",
"output": "NO"
},
{
"input": "5\n25 25 50 100 50",
"output": "NO"
},
{
"input": "5\n25 25 50 50 100",
"output": "NO"
},
{
"input": "1\n50",
"output": "NO"
}
] | 1,618,201,614 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 7 | 186 | 0 | n=int(input())
l=list(map(int,input().split()))
c=0
try:
for j in l:
if j==25:
c+=25
elif j==50:
c-=25
else:
c-=75
if c<0:
raise Exception
except Exception as e:
print("NO")
else:print("YES") | Title: Cinema Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line.
Output Specification:
Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO".
Demo Input:
['4\n25 25 50 50\n', '2\n25 100\n', '4\n50 50 25 25\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
n=int(input())
l=list(map(int,input().split()))
c=0
try:
for j in l:
if j==25:
c+=25
elif j==50:
c-=25
else:
c-=75
if c<0:
raise Exception
except Exception as e:
print("NO")
else:print("YES")
``` | 0 |
|
400 | A | Inna and Choose Options | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win. | The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start. | For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces. | [
"4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n"
] | [
"3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n"
] | none | 500 | [
{
"input": "4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO",
"output": "3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0"
},
{
"input": "2\nOOOOOOOOOOOO\nXXXXXXXXXXXX",
"output": "0\n6 1x12 2x6 3x4 4x3 6x2 12x1"
},
{
"input": "13\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX\nXXXXXXXXXXXX",
"output": "6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1\n6 1x12 2x6 3x4 4x3 6x2 12x1"
}
] | 1,598,422,964 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 92 | 307,200 | for _ in range(int(input())):
s=input()
a=[]
st='O'*12
for i in s:
if i=='X':
a.append("1x12")
break;
for i in range(6):
if s[i]=='X' and s[i+6]=='X':
a.append("2x6")
break;
for i in range(4):
if s[i]=='X' and s[i+4]=='X' and s[i+8]=='X':
a.append("3x4");
break;
for i in range(3):
if s[i]=='X' and s[i+3]=='X' and s[i+6]=='X' and s[i+9]=='X':
a.append("4x3");
break
for i in range(2):
if s[i]=='X' and s[i+2]=='X' and s[i+4]=='X' and s[i+6]=='X' and s[i+8]=='X' and s[i+10]=='X':
a.append("6x2")
break
if st==s:
a.append("12x1")
print(len(a),end=' ')
for i in a:
print(i,end=' ')
print('') | Title: Inna and Choose Options
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There always is something to choose from! And now, instead of "Noughts and Crosses", Inna choose a very unusual upgrade of this game. The rules of the game are given below:
There is one person playing the game. Before the beginning of the game he puts 12 cards in a row on the table. Each card contains a character: "X" or "O". Then the player chooses two positive integers *a* and *b* (*a*·*b*<==<=12), after that he makes a table of size *a*<=×<=*b* from the cards he put on the table as follows: the first *b* cards form the first row of the table, the second *b* cards form the second row of the table and so on, the last *b* cards form the last (number *a*) row of the table. The player wins if some column of the table contain characters "X" on all cards. Otherwise, the player loses.
Inna has already put 12 cards on the table in a row. But unfortunately, she doesn't know what numbers *a* and *b* to choose. Help her win the game: print to her all the possible ways of numbers *a*,<=*b* that she can choose and win.
Input Specification:
The first line of the input contains integer *t* (1<=≤<=*t*<=≤<=100). This value shows the number of sets of test data in the input. Next follows the description of each of the *t* tests on a separate line.
The description of each test is a string consisting of 12 characters, each character is either "X", or "O". The *i*-th character of the string shows the character that is written on the *i*-th card from the start.
Output Specification:
For each test, print the answer to the test on a single line. The first number in the line must represent the number of distinct ways to choose the pair *a*,<=*b*. Next, print on this line the pairs in the format *a*x*b*. Print the pairs in the order of increasing first parameter (*a*). Separate the pairs in the line by whitespaces.
Demo Input:
['4\nOXXXOXOOXOOX\nOXOXOXOXOXOX\nXXXXXXXXXXXX\nOOOOOOOOOOOO\n']
Demo Output:
['3 1x12 2x6 4x3\n4 1x12 2x6 3x4 6x2\n6 1x12 2x6 3x4 4x3 6x2 12x1\n0\n']
Note:
none | ```python
for _ in range(int(input())):
s=input()
a=[]
st='O'*12
for i in s:
if i=='X':
a.append("1x12")
break;
for i in range(6):
if s[i]=='X' and s[i+6]=='X':
a.append("2x6")
break;
for i in range(4):
if s[i]=='X' and s[i+4]=='X' and s[i+8]=='X':
a.append("3x4");
break;
for i in range(3):
if s[i]=='X' and s[i+3]=='X' and s[i+6]=='X' and s[i+9]=='X':
a.append("4x3");
break
for i in range(2):
if s[i]=='X' and s[i+2]=='X' and s[i+4]=='X' and s[i+6]=='X' and s[i+8]=='X' and s[i+10]=='X':
a.append("6x2")
break
if st==s:
a.append("12x1")
print(len(a),end=' ')
for i in a:
print(i,end=' ')
print('')
``` | 0 |
|
104 | A | Blackjack | PROGRAMMING | 800 | [
"implementation"
] | A. Blackjack | 2 | 256 | One rainy gloomy evening when all modules hid in the nearby cafes to drink hot energetic cocktails, the Hexadecimal virus decided to fly over the Mainframe to look for a Great Idea. And she has found one!
Why not make her own Codeforces, with blackjack and other really cool stuff? Many people will surely be willing to visit this splendid shrine of high culture.
In Mainframe a standard pack of 52 cards is used to play blackjack. The pack contains cards of 13 values: 2, 3, 4, 5, 6, 7, 8, 9, 10, jacks, queens, kings and aces. Each value also exists in one of four suits: hearts, diamonds, clubs and spades. Also, each card earns some value in points assigned to it: cards with value from two to ten earn from 2 to 10 points, correspondingly. An ace can either earn 1 or 11, whatever the player wishes. The picture cards (king, queen and jack) earn 10 points. The number of points a card earns does not depend on the suit. The rules of the game are very simple. The player gets two cards, if the sum of points of those cards equals *n*, then the player wins, otherwise the player loses.
The player has already got the first card, it's the queen of spades. To evaluate chances for victory, you should determine how many ways there are to get the second card so that the sum of points exactly equals *n*. | The only line contains *n* (1<=≤<=*n*<=≤<=25) — the required sum of points. | Print the numbers of ways to get the second card in the required way if the first card is the queen of spades. | [
"12\n",
"20\n",
"10\n"
] | [
"4",
"15",
"0"
] | In the first sample only four two's of different suits can earn the required sum of points.
In the second sample we can use all tens, jacks, queens and kings; overall it's 15 cards, as the queen of spades (as any other card) is only present once in the pack of cards and it's already in use.
In the third sample there is no card, that would add a zero to the current ten points. | 500 | [
{
"input": "12",
"output": "4"
},
{
"input": "20",
"output": "15"
},
{
"input": "10",
"output": "0"
},
{
"input": "11",
"output": "4"
},
{
"input": "15",
"output": "4"
},
{
"input": "18",
"output": "4"
},
{
"input": "25",
"output": "0"
},
{
"input": "22",
"output": "0"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "6",
"output": "0"
},
{
"input": "7",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "9",
"output": "0"
},
{
"input": "13",
"output": "4"
},
{
"input": "14",
"output": "4"
},
{
"input": "16",
"output": "4"
},
{
"input": "17",
"output": "4"
},
{
"input": "19",
"output": "4"
},
{
"input": "21",
"output": "4"
},
{
"input": "23",
"output": "0"
},
{
"input": "24",
"output": "0"
}
] | 1,688,984,129 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 60 | 0 | n = int(input())
if n == 10:
ways = 15
elif n == 11:
ways = 4
else:
ways = 0
print(ways)
| Title: Blackjack
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One rainy gloomy evening when all modules hid in the nearby cafes to drink hot energetic cocktails, the Hexadecimal virus decided to fly over the Mainframe to look for a Great Idea. And she has found one!
Why not make her own Codeforces, with blackjack and other really cool stuff? Many people will surely be willing to visit this splendid shrine of high culture.
In Mainframe a standard pack of 52 cards is used to play blackjack. The pack contains cards of 13 values: 2, 3, 4, 5, 6, 7, 8, 9, 10, jacks, queens, kings and aces. Each value also exists in one of four suits: hearts, diamonds, clubs and spades. Also, each card earns some value in points assigned to it: cards with value from two to ten earn from 2 to 10 points, correspondingly. An ace can either earn 1 or 11, whatever the player wishes. The picture cards (king, queen and jack) earn 10 points. The number of points a card earns does not depend on the suit. The rules of the game are very simple. The player gets two cards, if the sum of points of those cards equals *n*, then the player wins, otherwise the player loses.
The player has already got the first card, it's the queen of spades. To evaluate chances for victory, you should determine how many ways there are to get the second card so that the sum of points exactly equals *n*.
Input Specification:
The only line contains *n* (1<=≤<=*n*<=≤<=25) — the required sum of points.
Output Specification:
Print the numbers of ways to get the second card in the required way if the first card is the queen of spades.
Demo Input:
['12\n', '20\n', '10\n']
Demo Output:
['4', '15', '0']
Note:
In the first sample only four two's of different suits can earn the required sum of points.
In the second sample we can use all tens, jacks, queens and kings; overall it's 15 cards, as the queen of spades (as any other card) is only present once in the pack of cards and it's already in use.
In the third sample there is no card, that would add a zero to the current ten points. | ```python
n = int(input())
if n == 10:
ways = 15
elif n == 11:
ways = 4
else:
ways = 0
print(ways)
``` | 0 |
181 | B | Number of Triplets | PROGRAMMING | 1,300 | [
"binary search",
"brute force"
] | null | null | You are given *n* points on a plane. All points are different.
Find the number of different groups of three points (*A*,<=*B*,<=*C*) such that point *B* is the middle of segment *AC*.
The groups of three points are considered unordered, that is, if point *B* is the middle of segment *AC*, then groups (*A*,<=*B*,<=*C*) and (*C*,<=*B*,<=*A*) are considered the same. | The first line contains a single integer *n* (3<=≤<=*n*<=≤<=3000) — the number of points.
Next *n* lines contain the points. The *i*-th line contains coordinates of the *i*-th point: two space-separated integers *x**i*,<=*y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000).
It is guaranteed that all given points are different. | Print the single number — the answer to the problem. | [
"3\n1 1\n2 2\n3 3\n",
"3\n0 0\n-1 0\n0 1\n"
] | [
"1\n",
"0\n"
] | none | 1,000 | [
{
"input": "3\n1 1\n2 2\n3 3",
"output": "1"
},
{
"input": "3\n0 0\n-1 0\n0 1",
"output": "0"
},
{
"input": "4\n0 0\n1 0\n2 0\n3 0",
"output": "2"
},
{
"input": "5\n0 -1\n0 -2\n0 -3\n0 -4\n0 -5",
"output": "4"
},
{
"input": "7\n1 1\n-1 -1\n1 0\n0 1\n-1 0\n0 -1\n0 0",
"output": "3"
},
{
"input": "9\n1 1\n1 0\n0 1\n0 0\n-1 0\n-1 1\n-1 -1\n1 -1\n0 -1",
"output": "8"
},
{
"input": "10\n2 1\n-1 0\n-2 -1\n-1 1\n0 2\n2 -2\n0 0\n-2 -2\n0 -2\n-2 1",
"output": "4"
},
{
"input": "10\n-2 1\n2 -2\n-1 -2\n0 0\n2 -1\n0 -2\n2 2\n0 2\n-1 -1\n1 -2",
"output": "4"
},
{
"input": "10\n0 1\n-1 -1\n1 1\n-1 0\n1 -1\n-2 -1\n-2 2\n-2 0\n0 -2\n0 -1",
"output": "5"
},
{
"input": "10\n2 1\n-1 1\n0 0\n-3 1\n-2 -3\n-1 -2\n-1 -1\n1 2\n3 -2\n0 -2",
"output": "1"
},
{
"input": "20\n-3 -3\n0 4\n-3 1\n1 1\n-1 2\n-4 4\n3 -1\n-3 0\n0 2\n4 0\n2 3\n2 4\n4 -3\n-4 3\n-1 1\n1 3\n-2 4\n1 -2\n1 -1\n3 0",
"output": "10"
},
{
"input": "20\n-3 -3\n0 4\n-3 1\n1 1\n-1 2\n-4 4\n3 -1\n-3 0\n0 2\n4 0\n2 3\n2 4\n4 -3\n-4 3\n-1 1\n1 3\n-2 4\n1 -2\n1 -1\n3 0",
"output": "10"
},
{
"input": "20\n-1 18\n-2 5\n-5 4\n2 -33\n9 -18\n0 0\n11 -22\n2 0\n-1 2\n-4 41\n1 6\n1 -2\n6 -12\n0 1\n-3 6\n3 -6\n3 -8\n-1 4\n2 -5\n1 0",
"output": "21"
},
{
"input": "40\n-8 24\n2 -1\n1 -18\n72 -70\n5 -4\n-308 436\n-19 40\n36 -35\n-178 265\n-1 2\n-7 30\n-1 0\n3 -2\n200 -285\n17 -16\n-35 74\n0 -4\n-86 106\n-1 4\n-7 6\n0 1\n-5 4\n-2 3\n6 -5\n-4 5\n181 -262\n76 -118\n0 0\n-7 18\n-58 104\n-5 6\n-6 12\n-3 4\n1 0\n11 -10\n-86 130\n-3 6\n153 -236\n-183 270\n-33 64",
"output": "57"
},
{
"input": "3\n3 3\n1 2\n1 1",
"output": "0"
},
{
"input": "3\n0 0\n0 -1\n0 1",
"output": "1"
}
] | 1,434,823,735 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 466 | 16,998,400 | import sys
import fractions
def solve():
n = int(input())
xs, ys = list(), list()
for i in range(n):
x, y = map(int, input().split())
xs.append(x)
ys.append(y)
count = [0] * (n + 1)
for i in range(n):
slopes = dict()
x, y = xs[i], ys[i]
for o in range(n):
if i != o:
xdiff, ydiff = x - xs[o], y - ys[o]
div = fractions.gcd(xdiff, ydiff)
xdiff /= div
ydiff /= div
if (xdiff, ydiff) in slopes:
slopes[(xdiff, ydiff)] += 1
else: slopes[(xdiff, ydiff)] = 2
for key in slopes:
count[slopes[key]] += 1
for i in range(1, len(count)): count[i] //= i
res = 0
for i in range(3, len(count)):
res += (count[i]) * (i - 2)
print(res)
if sys.hexversion == 50594544 : sys.stdin = open("test.txt")
solve() | Title: Number of Triplets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* points on a plane. All points are different.
Find the number of different groups of three points (*A*,<=*B*,<=*C*) such that point *B* is the middle of segment *AC*.
The groups of three points are considered unordered, that is, if point *B* is the middle of segment *AC*, then groups (*A*,<=*B*,<=*C*) and (*C*,<=*B*,<=*A*) are considered the same.
Input Specification:
The first line contains a single integer *n* (3<=≤<=*n*<=≤<=3000) — the number of points.
Next *n* lines contain the points. The *i*-th line contains coordinates of the *i*-th point: two space-separated integers *x**i*,<=*y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000).
It is guaranteed that all given points are different.
Output Specification:
Print the single number — the answer to the problem.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '3\n0 0\n-1 0\n0 1\n']
Demo Output:
['1\n', '0\n']
Note:
none | ```python
import sys
import fractions
def solve():
n = int(input())
xs, ys = list(), list()
for i in range(n):
x, y = map(int, input().split())
xs.append(x)
ys.append(y)
count = [0] * (n + 1)
for i in range(n):
slopes = dict()
x, y = xs[i], ys[i]
for o in range(n):
if i != o:
xdiff, ydiff = x - xs[o], y - ys[o]
div = fractions.gcd(xdiff, ydiff)
xdiff /= div
ydiff /= div
if (xdiff, ydiff) in slopes:
slopes[(xdiff, ydiff)] += 1
else: slopes[(xdiff, ydiff)] = 2
for key in slopes:
count[slopes[key]] += 1
for i in range(1, len(count)): count[i] //= i
res = 0
for i in range(3, len(count)):
res += (count[i]) * (i - 2)
print(res)
if sys.hexversion == 50594544 : sys.stdin = open("test.txt")
solve()
``` | 0 |
|
609 | A | USB Flash Drives | PROGRAMMING | 800 | [
"greedy",
"implementation",
"sortings"
] | null | null | Sean is trying to save a large file to a USB flash drive. He has *n* USB flash drives with capacities equal to *a*1,<=*a*2,<=...,<=*a**n* megabytes. The file size is equal to *m* megabytes.
Find the minimum number of USB flash drives needed to write Sean's file, if he can split the file between drives. | The first line contains positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of USB flash drives.
The second line contains positive integer *m* (1<=≤<=*m*<=≤<=105) — the size of Sean's file.
Each of the next *n* lines contains positive integer *a**i* (1<=≤<=*a**i*<=≤<=1000) — the sizes of USB flash drives in megabytes.
It is guaranteed that the answer exists, i. e. the sum of all *a**i* is not less than *m*. | Print the minimum number of USB flash drives to write Sean's file, if he can split the file between drives. | [
"3\n5\n2\n1\n3\n",
"3\n6\n2\n3\n2\n",
"2\n5\n5\n10\n"
] | [
"2\n",
"3\n",
"1\n"
] | In the first example Sean needs only two USB flash drives — the first and the third.
In the second example Sean needs all three USB flash drives.
In the third example Sean needs only one USB flash drive and he can use any available USB flash drive — the first or the second. | 0 | [
{
"input": "3\n5\n2\n1\n3",
"output": "2"
},
{
"input": "3\n6\n2\n3\n2",
"output": "3"
},
{
"input": "2\n5\n5\n10",
"output": "1"
},
{
"input": "5\n16\n8\n1\n3\n4\n9",
"output": "2"
},
{
"input": "10\n121\n10\n37\n74\n56\n42\n39\n6\n68\n8\n100",
"output": "2"
},
{
"input": "12\n4773\n325\n377\n192\n780\n881\n816\n839\n223\n215\n125\n952\n8",
"output": "7"
},
{
"input": "15\n7758\n182\n272\n763\n910\n24\n359\n583\n890\n735\n819\n66\n992\n440\n496\n227",
"output": "15"
},
{
"input": "30\n70\n6\n2\n10\n4\n7\n10\n5\n1\n8\n10\n4\n3\n5\n9\n3\n6\n6\n4\n2\n6\n5\n10\n1\n9\n7\n2\n1\n10\n7\n5",
"output": "8"
},
{
"input": "40\n15705\n702\n722\n105\n873\n417\n477\n794\n300\n869\n496\n572\n232\n456\n298\n473\n584\n486\n713\n934\n121\n303\n956\n934\n840\n358\n201\n861\n497\n131\n312\n957\n96\n914\n509\n60\n300\n722\n658\n820\n103",
"output": "21"
},
{
"input": "50\n18239\n300\n151\n770\n9\n200\n52\n247\n753\n523\n263\n744\n463\n540\n244\n608\n569\n771\n32\n425\n777\n624\n761\n628\n124\n405\n396\n726\n626\n679\n237\n229\n49\n512\n18\n671\n290\n768\n632\n739\n18\n136\n413\n117\n83\n413\n452\n767\n664\n203\n404",
"output": "31"
},
{
"input": "70\n149\n5\n3\n3\n4\n6\n1\n2\n9\n8\n3\n1\n8\n4\n4\n3\n6\n10\n7\n1\n10\n8\n4\n9\n3\n8\n3\n2\n5\n1\n8\n6\n9\n10\n4\n8\n6\n9\n9\n9\n3\n4\n2\n2\n5\n8\n9\n1\n10\n3\n4\n3\n1\n9\n3\n5\n1\n3\n7\n6\n9\n8\n9\n1\n7\n4\n4\n2\n3\n5\n7",
"output": "17"
},
{
"input": "70\n2731\n26\n75\n86\n94\n37\n25\n32\n35\n92\n1\n51\n73\n53\n66\n16\n80\n15\n81\n100\n87\n55\n48\n30\n71\n39\n87\n77\n25\n70\n22\n75\n23\n97\n16\n75\n95\n61\n61\n28\n10\n78\n54\n80\n51\n25\n24\n90\n58\n4\n77\n40\n54\n53\n47\n62\n30\n38\n71\n97\n71\n60\n58\n1\n21\n15\n55\n99\n34\n88\n99",
"output": "35"
},
{
"input": "70\n28625\n34\n132\n181\n232\n593\n413\n862\n887\n808\n18\n35\n89\n356\n640\n339\n280\n975\n82\n345\n398\n948\n372\n91\n755\n75\n153\n948\n603\n35\n694\n722\n293\n363\n884\n264\n813\n175\n169\n646\n138\n449\n488\n828\n417\n134\n84\n763\n288\n845\n801\n556\n972\n332\n564\n934\n699\n842\n942\n644\n203\n406\n140\n37\n9\n423\n546\n675\n491\n113\n587",
"output": "45"
},
{
"input": "80\n248\n3\n9\n4\n5\n10\n7\n2\n6\n2\n2\n8\n2\n1\n3\n7\n9\n2\n8\n4\n4\n8\n5\n4\n4\n10\n2\n1\n4\n8\n4\n10\n1\n2\n10\n2\n3\n3\n1\n1\n8\n9\n5\n10\n2\n8\n10\n5\n3\n6\n1\n7\n8\n9\n10\n5\n10\n10\n2\n10\n1\n2\n4\n1\n9\n4\n7\n10\n8\n5\n8\n1\n4\n2\n2\n3\n9\n9\n9\n10\n6",
"output": "27"
},
{
"input": "80\n2993\n18\n14\n73\n38\n14\n73\n77\n18\n81\n6\n96\n65\n77\n86\n76\n8\n16\n81\n83\n83\n34\n69\n58\n15\n19\n1\n16\n57\n95\n35\n5\n49\n8\n15\n47\n84\n99\n94\n93\n55\n43\n47\n51\n61\n57\n13\n7\n92\n14\n4\n83\n100\n60\n75\n41\n95\n74\n40\n1\n4\n95\n68\n59\n65\n15\n15\n75\n85\n46\n77\n26\n30\n51\n64\n75\n40\n22\n88\n68\n24",
"output": "38"
},
{
"input": "80\n37947\n117\n569\n702\n272\n573\n629\n90\n337\n673\n589\n576\n205\n11\n284\n645\n719\n777\n271\n567\n466\n251\n402\n3\n97\n288\n699\n208\n173\n530\n782\n266\n395\n957\n159\n463\n43\n316\n603\n197\n386\n132\n799\n778\n905\n784\n71\n851\n963\n883\n705\n454\n275\n425\n727\n223\n4\n870\n833\n431\n463\n85\n505\n800\n41\n954\n981\n242\n578\n336\n48\n858\n702\n349\n929\n646\n528\n993\n506\n274\n227",
"output": "70"
},
{
"input": "90\n413\n5\n8\n10\n7\n5\n7\n5\n7\n1\n7\n8\n4\n3\n9\n4\n1\n10\n3\n1\n10\n9\n3\n1\n8\n4\n7\n5\n2\n9\n3\n10\n10\n3\n6\n3\n3\n10\n7\n5\n1\n1\n2\n4\n8\n2\n5\n5\n3\n9\n5\n5\n3\n10\n2\n3\n8\n5\n9\n1\n3\n6\n5\n9\n2\n3\n7\n10\n3\n4\n4\n1\n5\n9\n2\n6\n9\n1\n1\n9\n9\n7\n7\n7\n8\n4\n5\n3\n4\n6\n9",
"output": "59"
},
{
"input": "90\n4226\n33\n43\n83\n46\n75\n14\n88\n36\n8\n25\n47\n4\n96\n19\n33\n49\n65\n17\n59\n72\n1\n55\n94\n92\n27\n33\n39\n14\n62\n79\n12\n89\n22\n86\n13\n19\n77\n53\n96\n74\n24\n25\n17\n64\n71\n81\n87\n52\n72\n55\n49\n74\n36\n65\n86\n91\n33\n61\n97\n38\n87\n61\n14\n73\n95\n43\n67\n42\n67\n22\n12\n62\n32\n96\n24\n49\n82\n46\n89\n36\n75\n91\n11\n10\n9\n33\n86\n28\n75\n39",
"output": "64"
},
{
"input": "90\n40579\n448\n977\n607\n745\n268\n826\n479\n59\n330\n609\n43\n301\n970\n726\n172\n632\n600\n181\n712\n195\n491\n312\n849\n722\n679\n682\n780\n131\n404\n293\n387\n567\n660\n54\n339\n111\n833\n612\n911\n869\n356\n884\n635\n126\n639\n712\n473\n663\n773\n435\n32\n973\n484\n662\n464\n699\n274\n919\n95\n904\n253\n589\n543\n454\n250\n349\n237\n829\n511\n536\n36\n45\n152\n626\n384\n199\n877\n941\n84\n781\n115\n20\n52\n726\n751\n920\n291\n571\n6\n199",
"output": "64"
},
{
"input": "100\n66\n7\n9\n10\n5\n2\n8\n6\n5\n4\n10\n10\n6\n5\n2\n2\n1\n1\n5\n8\n7\n8\n10\n5\n6\n6\n5\n9\n9\n6\n3\n8\n7\n10\n5\n9\n6\n7\n3\n5\n8\n6\n8\n9\n1\n1\n1\n2\n4\n5\n5\n1\n1\n2\n6\n7\n1\n5\n8\n7\n2\n1\n7\n10\n9\n10\n2\n4\n10\n4\n10\n10\n5\n3\n9\n1\n2\n1\n10\n5\n1\n7\n4\n4\n5\n7\n6\n10\n4\n7\n3\n4\n3\n6\n2\n5\n2\n4\n9\n5\n3",
"output": "7"
},
{
"input": "100\n4862\n20\n47\n85\n47\n76\n38\n48\n93\n91\n81\n31\n51\n23\n60\n59\n3\n73\n72\n57\n67\n54\n9\n42\n5\n32\n46\n72\n79\n95\n61\n79\n88\n33\n52\n97\n10\n3\n20\n79\n82\n93\n90\n38\n80\n18\n21\n43\n60\n73\n34\n75\n65\n10\n84\n100\n29\n94\n56\n22\n59\n95\n46\n22\n57\n69\n67\n90\n11\n10\n61\n27\n2\n48\n69\n86\n91\n69\n76\n36\n71\n18\n54\n90\n74\n69\n50\n46\n8\n5\n41\n96\n5\n14\n55\n85\n39\n6\n79\n75\n87",
"output": "70"
},
{
"input": "100\n45570\n14\n881\n678\n687\n993\n413\n760\n451\n426\n787\n503\n343\n234\n530\n294\n725\n941\n524\n574\n441\n798\n399\n360\n609\n376\n525\n229\n995\n478\n347\n47\n23\n468\n525\n749\n601\n235\n89\n995\n489\n1\n239\n415\n122\n671\n128\n357\n886\n401\n964\n212\n968\n210\n130\n871\n360\n661\n844\n414\n187\n21\n824\n266\n713\n126\n496\n916\n37\n193\n755\n894\n641\n300\n170\n176\n383\n488\n627\n61\n897\n33\n242\n419\n881\n698\n107\n391\n418\n774\n905\n87\n5\n896\n835\n318\n373\n916\n393\n91\n460",
"output": "78"
},
{
"input": "100\n522\n1\n5\n2\n4\n2\n6\n3\n4\n2\n10\n10\n6\n7\n9\n7\n1\n7\n2\n5\n3\n1\n5\n2\n3\n5\n1\n7\n10\n10\n4\n4\n10\n9\n10\n6\n2\n8\n2\n6\n10\n9\n2\n7\n5\n9\n4\n6\n10\n7\n3\n1\n1\n9\n5\n10\n9\n2\n8\n3\n7\n5\n4\n7\n5\n9\n10\n6\n2\n9\n2\n5\n10\n1\n7\n7\n10\n5\n6\n2\n9\n4\n7\n10\n10\n8\n3\n4\n9\n3\n6\n9\n10\n2\n9\n9\n3\n4\n1\n10\n2",
"output": "74"
},
{
"input": "100\n32294\n414\n116\n131\n649\n130\n476\n630\n605\n213\n117\n757\n42\n109\n85\n127\n635\n629\n994\n410\n764\n204\n161\n231\n577\n116\n936\n537\n565\n571\n317\n722\n819\n229\n284\n487\n649\n304\n628\n727\n816\n854\n91\n111\n549\n87\n374\n417\n3\n868\n882\n168\n743\n77\n534\n781\n75\n956\n910\n734\n507\n568\n802\n946\n891\n659\n116\n678\n375\n380\n430\n627\n873\n350\n930\n285\n6\n183\n96\n517\n81\n794\n235\n360\n551\n6\n28\n799\n226\n996\n894\n981\n551\n60\n40\n460\n479\n161\n318\n952\n433",
"output": "42"
},
{
"input": "100\n178\n71\n23\n84\n98\n8\n14\n4\n42\n56\n83\n87\n28\n22\n32\n50\n5\n96\n90\n1\n59\n74\n56\n96\n77\n88\n71\n38\n62\n36\n85\n1\n97\n98\n98\n32\n99\n42\n6\n81\n20\n49\n57\n71\n66\n9\n45\n41\n29\n28\n32\n68\n38\n29\n35\n29\n19\n27\n76\n85\n68\n68\n41\n32\n78\n72\n38\n19\n55\n83\n83\n25\n46\n62\n48\n26\n53\n14\n39\n31\n94\n84\n22\n39\n34\n96\n63\n37\n42\n6\n78\n76\n64\n16\n26\n6\n79\n53\n24\n29\n63",
"output": "2"
},
{
"input": "100\n885\n226\n266\n321\n72\n719\n29\n121\n533\n85\n672\n225\n830\n783\n822\n30\n791\n618\n166\n487\n922\n434\n814\n473\n5\n741\n947\n910\n305\n998\n49\n945\n588\n868\n809\n803\n168\n280\n614\n434\n634\n538\n591\n437\n540\n445\n313\n177\n171\n799\n778\n55\n617\n554\n583\n611\n12\n94\n599\n182\n765\n556\n965\n542\n35\n460\n177\n313\n485\n744\n384\n21\n52\n879\n792\n411\n614\n811\n565\n695\n428\n587\n631\n794\n461\n258\n193\n696\n936\n646\n756\n267\n55\n690\n730\n742\n734\n988\n235\n762\n440",
"output": "1"
},
{
"input": "100\n29\n9\n2\n10\n8\n6\n7\n7\n3\n3\n10\n4\n5\n2\n5\n1\n6\n3\n2\n5\n10\n10\n9\n1\n4\n5\n2\n2\n3\n1\n2\n2\n9\n6\n9\n7\n8\n8\n1\n5\n5\n3\n1\n5\n6\n1\n9\n2\n3\n8\n10\n8\n3\n2\n7\n1\n2\n1\n2\n8\n10\n5\n2\n3\n1\n10\n7\n1\n7\n4\n9\n6\n6\n4\n7\n1\n2\n7\n7\n9\n9\n7\n10\n4\n10\n8\n2\n1\n5\n5\n10\n5\n8\n1\n5\n6\n5\n1\n5\n6\n8",
"output": "3"
},
{
"input": "100\n644\n94\n69\n43\n36\n54\n93\n30\n74\n56\n95\n70\n49\n11\n36\n57\n30\n59\n3\n52\n59\n90\n82\n39\n67\n32\n8\n80\n64\n8\n65\n51\n48\n89\n90\n35\n4\n54\n66\n96\n68\n90\n30\n4\n13\n97\n41\n90\n85\n17\n45\n94\n31\n58\n4\n39\n76\n95\n92\n59\n67\n46\n96\n55\n82\n64\n20\n20\n83\n46\n37\n15\n60\n37\n79\n45\n47\n63\n73\n76\n31\n52\n36\n32\n49\n26\n61\n91\n31\n25\n62\n90\n65\n65\n5\n94\n7\n15\n97\n88\n68",
"output": "7"
},
{
"input": "100\n1756\n98\n229\n158\n281\n16\n169\n149\n239\n235\n182\n147\n215\n49\n270\n194\n242\n295\n289\n249\n19\n12\n144\n157\n92\n270\n122\n212\n97\n152\n14\n42\n12\n198\n98\n295\n154\n229\n191\n294\n5\n156\n43\n185\n184\n20\n125\n23\n10\n257\n244\n264\n79\n46\n277\n13\n22\n97\n212\n77\n293\n20\n51\n17\n109\n37\n68\n117\n51\n248\n10\n149\n179\n192\n239\n161\n13\n173\n297\n73\n43\n109\n288\n198\n81\n70\n254\n187\n277\n1\n295\n113\n95\n291\n293\n119\n205\n191\n37\n34\n116",
"output": "6"
},
{
"input": "100\n20562\n721\n452\n11\n703\n376\n183\n197\n203\n406\n642\n346\n446\n256\n760\n201\n360\n702\n707\n388\n779\n653\n610\n497\n768\n670\n134\n780\n306\n661\n180\n259\n256\n362\n6\n121\n415\n747\n170\n67\n439\n728\n193\n622\n481\n38\n225\n343\n303\n253\n436\n305\n68\n794\n247\n291\n600\n750\n188\n199\n757\n28\n776\n749\n253\n351\n53\n629\n129\n578\n209\n89\n651\n262\n638\n353\n469\n31\n144\n460\n176\n535\n562\n366\n639\n234\n577\n364\n761\n617\n303\n450\n778\n311\n289\n221\n274\n239\n626\n194\n36",
"output": "30"
},
{
"input": "100\n32630\n548\n21\n756\n138\n56\n719\n97\n86\n599\n531\n464\n137\n737\n239\n626\n179\n170\n271\n335\n178\n298\n597\n616\n104\n190\n216\n333\n606\n621\n310\n70\n286\n593\n655\n472\n556\n77\n625\n744\n395\n487\n762\n316\n469\n258\n475\n596\n651\n180\n737\n101\n511\n708\n163\n713\n475\n557\n649\n705\n583\n97\n447\n119\n91\n372\n194\n394\n667\n384\n635\n611\n746\n758\n613\n54\n508\n405\n188\n570\n254\n28\n599\n767\n115\n737\n194\n148\n686\n705\n236\n762\n613\n770\n633\n401\n773\n448\n274\n141\n718",
"output": "52"
},
{
"input": "1\n1\n1",
"output": "1"
}
] | 1,553,093,235 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 109 | 0 | def main():
n = int(input())
m = int(input())
arr = [int(input()) for i in range(n)]
arr.sort(reverse=True)
sum = 0
res = 0
for i in arr:
sum += i
res += 1
if sum >= m:
break
print(res)
main()
| Title: USB Flash Drives
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sean is trying to save a large file to a USB flash drive. He has *n* USB flash drives with capacities equal to *a*1,<=*a*2,<=...,<=*a**n* megabytes. The file size is equal to *m* megabytes.
Find the minimum number of USB flash drives needed to write Sean's file, if he can split the file between drives.
Input Specification:
The first line contains positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of USB flash drives.
The second line contains positive integer *m* (1<=≤<=*m*<=≤<=105) — the size of Sean's file.
Each of the next *n* lines contains positive integer *a**i* (1<=≤<=*a**i*<=≤<=1000) — the sizes of USB flash drives in megabytes.
It is guaranteed that the answer exists, i. e. the sum of all *a**i* is not less than *m*.
Output Specification:
Print the minimum number of USB flash drives to write Sean's file, if he can split the file between drives.
Demo Input:
['3\n5\n2\n1\n3\n', '3\n6\n2\n3\n2\n', '2\n5\n5\n10\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first example Sean needs only two USB flash drives — the first and the third.
In the second example Sean needs all three USB flash drives.
In the third example Sean needs only one USB flash drive and he can use any available USB flash drive — the first or the second. | ```python
def main():
n = int(input())
m = int(input())
arr = [int(input()) for i in range(n)]
arr.sort(reverse=True)
sum = 0
res = 0
for i in arr:
sum += i
res += 1
if sum >= m:
break
print(res)
main()
``` | 3 |
|
237 | A | Free Cash | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period. | Print a single integer — the minimum number of cashes, needed to serve all clients next day. | [
"4\n8 0\n8 10\n8 10\n8 45\n",
"3\n0 12\n10 11\n22 22\n"
] | [
"2\n",
"1\n"
] | In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash. | 500 | [
{
"input": "4\n8 0\n8 10\n8 10\n8 45",
"output": "2"
},
{
"input": "3\n0 12\n10 11\n22 22",
"output": "1"
},
{
"input": "5\n12 8\n15 27\n15 27\n16 2\n19 52",
"output": "2"
},
{
"input": "7\n5 6\n7 34\n7 34\n7 34\n12 29\n15 19\n20 23",
"output": "3"
},
{
"input": "8\n0 36\n4 7\n4 7\n4 7\n11 46\n12 4\n15 39\n18 6",
"output": "3"
},
{
"input": "20\n4 12\n4 21\n4 27\n4 56\n5 55\n7 56\n11 28\n11 36\n14 58\n15 59\n16 8\n17 12\n17 23\n17 23\n17 23\n17 23\n17 23\n17 23\n20 50\n22 32",
"output": "6"
},
{
"input": "10\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30",
"output": "10"
},
{
"input": "50\n0 23\n1 21\n2 8\n2 45\n3 1\n4 19\n4 37\n7 7\n7 40\n8 43\n9 51\n10 13\n11 2\n11 19\n11 30\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 54\n13 32\n13 42\n14 29\n14 34\n14 48\n15 0\n15 27\n16 22\n16 31\n17 25\n17 26\n17 33\n18 14\n18 16\n18 20\n19 0\n19 5\n19 56\n20 22\n21 26\n22 0\n22 10\n22 11\n22 36\n23 17\n23 20",
"output": "8"
},
{
"input": "10\n0 39\n1 35\n1 49\n1 51\n5 24\n7 40\n7 56\n16 42\n23 33\n23 49",
"output": "1"
},
{
"input": "15\n0 16\n6 15\n8 2\n8 6\n8 7\n10 1\n10 1\n10 3\n10 12\n13 5\n14 16\n14 16\n14 16\n14 16\n14 16",
"output": "5"
},
{
"input": "2\n0 24\n1 0",
"output": "1"
},
{
"input": "1\n0 0",
"output": "1"
},
{
"input": "1\n1 5",
"output": "1"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "3"
},
{
"input": "1\n5 0",
"output": "1"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "5"
},
{
"input": "1\n10 10",
"output": "1"
},
{
"input": "1\n8 0",
"output": "1"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "10"
},
{
"input": "2\n0 0\n0 1",
"output": "1"
},
{
"input": "2\n8 5\n8 5",
"output": "2"
}
] | 1,599,201,308 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 1 | 186 | 0 | n = int(input())
g = []
k = 0
x = []
for i in range(n):
a = input()
g.append(a)
for u in g:
if g.count(u) > 1:
x.append(g.count(u))
for o in range(g.count(u)):
g.remove(u)
k = max(x)
print(k) | Title: Free Cash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
Output Specification:
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
Demo Input:
['4\n8 0\n8 10\n8 10\n8 45\n', '3\n0 12\n10 11\n22 22\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash. | ```python
n = int(input())
g = []
k = 0
x = []
for i in range(n):
a = input()
g.append(a)
for u in g:
if g.count(u) > 1:
x.append(g.count(u))
for o in range(g.count(u)):
g.remove(u)
k = max(x)
print(k)
``` | -1 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.