contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
548 | A | Mike and Fax | PROGRAMMING | 1,100 | [
"brute force",
"implementation",
"strings"
] | null | null | While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*.
He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length.
He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length. | The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000).
The second line contains integer *k* (1<=≤<=*k*<=≤<=1000). | Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise. | [
"saba\n2\n",
"saddastavvat\n2\n"
] | [
"NO\n",
"YES\n"
] | Palindrome is a string reading the same forward and backward.
In the second sample, the faxes in his back-bag can be "saddas" and "tavvat". | 500 | [
{
"input": "saba\n2",
"output": "NO"
},
{
"input": "saddastavvat\n2",
"output": "YES"
},
{
"input": "aaaaaaaaaa\n3",
"output": "NO"
},
{
"input": "aaaaaa\n3",
"output": "YES"
},
{
"input": "abaacca\n2",
"output": "NO"
},
{
"input": "a\n1",
"output": "YES"
},
{
"input": "princeofpersia\n1",
"output": "NO"
},
{
"input": "xhwbdoryfiaxglripavycmxmcejbcpzidrqsqvikfzjyfnmedxrvlnusavyhillaxrblkynwdrlhthtqzjktzkullgrqsolqssocpfwcaizhovajlhmeibhiuwtxpljkyyiwykzpmazkkzampzkywiyykjlpxtwuihbiemhljavohziacwfpcossqlosqrgllukztkjzqththlrdwnyklbrxallihyvasunlvrxdemnfyjzfkivqsqrdizpcbjecmxmcyvapirlgxaifyrodbwhx\n1",
"output": "YES"
},
{
"input": "yfhqnbzaqeqmcvtsbcdn\n456",
"output": "NO"
},
{
"input": "lgsdfiforlqrohhjyzrigewkigiiffvbyrapzmjvtkklndeyuqpuukajgtguhlarjdqlxksyekbjgrmhuyiqdlzjqqzlxufffpelyptodwhvkfbalxbufrlcsjgxmfxeqsszqghcustqrqjljattgvzynyvfbjgbuynbcguqtyfowgtcbbaywvcrgzrulqpghwoflutswu\n584",
"output": "NO"
},
{
"input": "awlrhmxxivqbntvtapwkdkunamcqoerfncfmookhdnuxtttlxmejojpwbdyxirdsjippzjhdrpjepremruczbedxrjpodlyyldopjrxdebzcurmerpejprdhjzppijsdrixydbwpjojemxltttxundhkoomfcnfreoqcmanukdkwpatvtnbqvixxmhrlwa\n1",
"output": "YES"
},
{
"input": "kafzpsglcpzludxojtdhzynpbekzssvhzizfrboxbhqvojiqtjitrackqccxgenwwnegxccqkcartijtqijovqhbxobrfzizhvsszkebpnyzhdtjoxdulzpclgspzfakvcbbjejeubvrrzlvjjgrcprntbyuakoxowoybbxgdugjffgbtfwrfiobifrshyaqqayhsrfiboifrwftbgffjgudgxbbyowoxokauybtnrpcrgjjvlzrrvbuejejbbcv\n2",
"output": "YES"
},
{
"input": "zieqwmmbrtoxysvavwdemmdeatfrolsqvvlgphhhmojjfxfurtuiqdiilhlcwwqedlhblrzmvuoaczcwrqzyymiggpvbpkycibsvkhytrzhguksxyykkkvfljbbnjblylftmqxkojithwsegzsaexlpuicexbdzpwesrkzbqltxhifwqcehzsjgsqbwkujvjbjpqxdpmlimsusumizizpyigmkxwuberthdghnepyrxzvvidxeafwylegschhtywvqsxuqmsddhkzgkdiekodqpnftdyhnpicsnbhfxemxllvaurkmjvtrmqkulerxtaolmokiqqvqgechkqxmendpmgxwiaffcajmqjmvrwryzxujmiasuqtosuisiclnv\n8",
"output": "NO"
},
{
"input": "syghzncbi\n829",
"output": "NO"
},
{
"input": "ljpdpstntznciejqqtpysskztdfawuncqzwwfefrfsihyrdopwawowshquqnjhesxszuywezpebpzhtopgngrnqgwnoqhyrykojguybvdbjpfpmvkxscocywzsxcivysfrrzsonayztzzuybrkiombhqcfkszyscykzistiobrpavezedgobowjszfadcccmxyqehmkgywiwxffibzetb\n137",
"output": "NO"
},
{
"input": "eytuqriplfczwsqlsnjetfpzehzvzayickkbnfqddaisfpasvigwtnvbybwultsgrtjbaebktvubwofysgidpufzteuhuaaqkhmhguockoczlrmlrrzouvqtwbcchxxiydbohnvrmtqjzhkfmvdulojhdvgwudvidpausvfujkjprxsobliuauxleqvsmz\n253",
"output": "NO"
},
{
"input": "xkaqgwabuilhuqwhnrdtyattmqcjfbiqodjlwzgcyvghqncklbhnlmagvjvwysrfryrlmclninogumjfmyenkmydlmifxpkvlaapgnfarejaowftxxztshsesjtsgommaeslrhronruqdurvjesydrzmxirmxumrcqezznqltngsgdcthivdnjnshjfujtiqsltpttgbljfcbqsfwbzokciqlavrthgaqbzikpwwsebzwddlvdwrmztwmhcxdinwlbklwmteeybbdbzevfbsrtldapulwgusuvnreiflkytonzmervyrlbqhzapgxepwauaiwygpxarfeyqhimzlxntjuaaigeisgrvwgbhqemqetzyallzaoqprhzpjibkutgwrodruqu\n857",
"output": "NO"
},
{
"input": "rbehjxpblnzfgeebpkvzznwtzszghjuuxovreapmwehqyjymrkmksffbdpbdyegulabsmjiykeeqtuvqqyxlitpxjdpwmqtlmudqsksgwqekvwfjdsggzajcpsyserkctpbajgzdbiqaekfaepnecezdzamqszpwfvhlannszgaiewvcdnnvzhblmuzjtqeyjcqjqoxatavavokyxokuxwuqueskktxnxraihnqovrfykpzsyjmrhqsvbobzsnfqwvdwatvjxaubtiwhgvrqwjhgfnauqegqmcwnaruinplmtmxhvohhqgvcatsdqiwkvslhqzqevdgdhpijjevuyuitnixdjhwlmjsstmugownjdhvxueg\n677",
"output": "NO"
},
{
"input": "a\n3",
"output": "NO"
},
{
"input": "aa\n2",
"output": "YES"
},
{
"input": "abcaabca\n2",
"output": "NO"
},
{
"input": "aaaaaaaaab\n5",
"output": "NO"
},
{
"input": "aabbb\n3",
"output": "NO"
},
{
"input": "abcde\n5",
"output": "YES"
},
{
"input": "aabc\n2",
"output": "NO"
},
{
"input": "aabcaa\n3",
"output": "NO"
}
] | 1,432,658,482 | 382 | Python 3 | OK | TESTS | 56 | 62 | 0 | def sol():
s = input()
k = int(input())
if len(s) % k:
return "NO"
else:
l = len(s) // k
for i in range(k):
st = s[i*l:(i+1)*l]
if st != st[::-1]:
break
else:
return "YES"
return "NO"
print(sol())
| Title: Mike and Fax
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*.
He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length.
He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length.
Input Specification:
The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000).
The second line contains integer *k* (1<=≤<=*k*<=≤<=1000).
Output Specification:
Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise.
Demo Input:
['saba\n2\n', 'saddastavvat\n2\n']
Demo Output:
['NO\n', 'YES\n']
Note:
Palindrome is a string reading the same forward and backward.
In the second sample, the faxes in his back-bag can be "saddas" and "tavvat". | ```python
def sol():
s = input()
k = int(input())
if len(s) % k:
return "NO"
else:
l = len(s) // k
for i in range(k):
st = s[i*l:(i+1)*l]
if st != st[::-1]:
break
else:
return "YES"
return "NO"
print(sol())
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Oleg writes down the history of the days he lived. For each day he decides if it was good or bad. Oleg calls a non-empty sequence of days a zebra, if it starts with a bad day, ends with a bad day, and good and bad days are alternating in it. Let us denote bad days as 0 and good days as 1. Then, for example, sequences of days 0, 010, 01010 are zebras, while sequences 1, 0110, 0101 are not.
Oleg tells you the story of days he lived in chronological order in form of string consisting of 0 and 1. Now you are interested if it is possible to divide Oleg's life history into several subsequences, each of which is a zebra, and the way it can be done. Each day must belong to exactly one of the subsequences. For each of the subsequences, days forming it must be ordered chronologically. Note that subsequence does not have to be a group of consecutive days. | In the only line of input data there is a non-empty string *s* consisting of characters 0 and 1, which describes the history of Oleg's life. Its length (denoted as |*s*|) does not exceed 200<=000 characters. | If there is a way to divide history into zebra subsequences, in the first line of output you should print an integer *k* (1<=≤<=*k*<=≤<=|*s*|), the resulting number of subsequences. In the *i*-th of following *k* lines first print the integer *l**i* (1<=≤<=*l**i*<=≤<=|*s*|), which is the length of the *i*-th subsequence, and then *l**i* indices of days forming the subsequence. Indices must follow in ascending order. Days are numbered starting from 1. Each index from 1 to *n* must belong to exactly one subsequence. If there is no way to divide day history into zebra subsequences, print -1.
Subsequences may be printed in any order. If there are several solutions, you may print any of them. You do not have to minimize nor maximize the value of *k*. | [
"0010100\n",
"111\n"
] | [
"3\n3 1 3 4\n3 2 5 6\n1 7\n",
"-1\n"
] | none | 0 | [
{
"input": "0010100",
"output": "3\n1 1\n5 2 3 4 5 6\n1 7"
},
{
"input": "111",
"output": "-1"
},
{
"input": "0",
"output": "1\n1 1"
},
{
"input": "1",
"output": "-1"
},
{
"input": "0101010101",
"output": "-1"
},
{
"input": "010100001",
"output": "-1"
},
{
"input": "000111000",
"output": "3\n3 1 6 7\n3 2 5 8\n3 3 4 9"
},
{
"input": "0101001000",
"output": "4\n5 1 2 3 4 5\n3 6 7 8\n1 9\n1 10"
},
{
"input": "0000001000",
"output": "8\n1 1\n1 2\n1 3\n1 4\n1 5\n3 6 7 8\n1 9\n1 10"
},
{
"input": "0101",
"output": "-1"
},
{
"input": "000101110",
"output": "-1"
},
{
"input": "010101010",
"output": "1\n9 1 2 3 4 5 6 7 8 9"
},
{
"input": "0101001010",
"output": "2\n5 1 2 3 4 5\n5 6 7 8 9 10"
},
{
"input": "0100101100",
"output": "2\n5 1 2 3 8 9\n5 4 5 6 7 10"
},
{
"input": "0110100000",
"output": "-1"
},
{
"input": "0000000000",
"output": "10\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10"
},
{
"input": "1111111111",
"output": "-1"
},
{
"input": "0010101100",
"output": "2\n3 1 8 9\n7 2 3 4 5 6 7 10"
},
{
"input": "1010000",
"output": "-1"
},
{
"input": "0001110",
"output": "-1"
},
{
"input": "0000000000011001100011110101000101000010010111000100110110000011010011110110001100100001001001010010",
"output": "22\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n7 9 24 25 26 27 28 29\n7 10 13 14 17 18 23 30\n11 11 12 15 16 19 22 31 32 33 34 35\n3 20 21 36\n3 37 46 47\n9 38 39 40 45 48 57 58 75 76\n17 41 42 43 44 49 50 51 54 55 56 59 72 73 74 77 80 81\n9 52 53 60 71 78 79 82 83 84\n7 61 64 65 66 67 70 85\n5 62 63 68 69 86\n3 87 88 89\n3 90 91 92\n5 93 94 95 96 97\n3 98 99 100"
},
{
"input": "01010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010",
"output": "1\n245 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "0010011100000000",
"output": "8\n3 1 8 9\n5 2 3 4 7 10\n3 5 6 11\n1 12\n1 13\n1 14\n1 15\n1 16"
}
] | 1,521,165,279 | 4,479 | Python 3 | WRONG_ANSWER | TESTS | 4 | 77 | 7,065,600 | import sys
days = next(sys.stdin)[:-1]
n = len(days)
ones = days.count('1')
zeros = n - ones
longseq = [None] * n
singles = [None] * n
nl = 0
ns = 0
for i in range(n):
d = int(days[i])
if (nl - d) % 2:
if d:
print(-1)
exit()
else:
singles[ns] = str(i + 1)
ns += 1
else:
longseq[nl] = str(i + 1)
nl += 1
if nl % 2 == 0:
print(-1)
print(1 + ns)
print(nl, " ".join(longseq[:nl]))
for i in range(ns):
print(1, singles[i])
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Oleg writes down the history of the days he lived. For each day he decides if it was good or bad. Oleg calls a non-empty sequence of days a zebra, if it starts with a bad day, ends with a bad day, and good and bad days are alternating in it. Let us denote bad days as 0 and good days as 1. Then, for example, sequences of days 0, 010, 01010 are zebras, while sequences 1, 0110, 0101 are not.
Oleg tells you the story of days he lived in chronological order in form of string consisting of 0 and 1. Now you are interested if it is possible to divide Oleg's life history into several subsequences, each of which is a zebra, and the way it can be done. Each day must belong to exactly one of the subsequences. For each of the subsequences, days forming it must be ordered chronologically. Note that subsequence does not have to be a group of consecutive days.
Input Specification:
In the only line of input data there is a non-empty string *s* consisting of characters 0 and 1, which describes the history of Oleg's life. Its length (denoted as |*s*|) does not exceed 200<=000 characters.
Output Specification:
If there is a way to divide history into zebra subsequences, in the first line of output you should print an integer *k* (1<=≤<=*k*<=≤<=|*s*|), the resulting number of subsequences. In the *i*-th of following *k* lines first print the integer *l**i* (1<=≤<=*l**i*<=≤<=|*s*|), which is the length of the *i*-th subsequence, and then *l**i* indices of days forming the subsequence. Indices must follow in ascending order. Days are numbered starting from 1. Each index from 1 to *n* must belong to exactly one subsequence. If there is no way to divide day history into zebra subsequences, print -1.
Subsequences may be printed in any order. If there are several solutions, you may print any of them. You do not have to minimize nor maximize the value of *k*.
Demo Input:
['0010100\n', '111\n']
Demo Output:
['3\n3 1 3 4\n3 2 5 6\n1 7\n', '-1\n']
Note:
none | ```python
import sys
days = next(sys.stdin)[:-1]
n = len(days)
ones = days.count('1')
zeros = n - ones
longseq = [None] * n
singles = [None] * n
nl = 0
ns = 0
for i in range(n):
d = int(days[i])
if (nl - d) % 2:
if d:
print(-1)
exit()
else:
singles[ns] = str(i + 1)
ns += 1
else:
longseq[nl] = str(i + 1)
nl += 1
if nl % 2 == 0:
print(-1)
print(1 + ns)
print(nl, " ".join(longseq[:nl]))
for i in range(ns):
print(1, singles[i])
``` | 0 |
|
711 | A | Bus to Udayland | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied.
ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit? | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus.
Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row.
Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details. | If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output).
If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line.
If there are multiple solutions, you may print any of them. | [
"6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n",
"4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n",
"5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n"
] | [
"YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n",
"NO\n",
"YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n"
] | Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair.
O+|+X
XO|XX
OX|OO
XX|OX
OO|OO
OO|XX | 500 | [
{
"input": "6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX",
"output": "YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX"
},
{
"input": "4\nXO|OX\nXO|XX\nOX|OX\nXX|OX",
"output": "NO"
},
{
"input": "5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO",
"output": "YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO"
},
{
"input": "1\nXO|OX",
"output": "NO"
},
{
"input": "1\nOO|OO",
"output": "YES\n++|OO"
},
{
"input": "4\nXO|XX\nXX|XO\nOX|XX\nXO|XO",
"output": "NO"
},
{
"input": "9\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|OO\nOX|OX\nOX|XO\nOX|OX",
"output": "YES\nOX|XO\nOX|XO\nXO|OX\nOX|OX\nXO|OX\nXX|++\nOX|OX\nOX|XO\nOX|OX"
},
{
"input": "61\nOX|XX\nOX|XX\nOX|XX\nXO|XO\nXX|XO\nXX|XX\nXX|XX\nOX|XX\nXO|XO\nOX|XO\nXO|OX\nXX|XX\nXX|XX\nOX|OX\nXX|OX\nOX|XO\nOX|XO\nXO|OX\nXO|XX\nOX|XX\nOX|XX\nXO|OX\nXO|XX\nXO|XX\nOX|XX\nXX|XX\nXX|XO\nXO|XX\nXX|XX\nXO|OX\nXX|XO\nXO|XX\nXO|XO\nXO|OX\nXX|OX\nXO|OX\nOX|XX\nXX|OX\nXX|XX\nOX|XO\nOX|XX\nXO|OX\nOX|XX\nOX|XX\nXO|XO\nXO|XX\nOX|XX\nXO|XO\nOX|XX\nXX|XX\nOX|XO\nXO|XO\nXO|XO\nOX|OX\nXX|OX\nXX|OX\nOX|XO\nOX|XX\nOX|OX\nXO|XX\nOX|XX",
"output": "NO"
},
{
"input": "1\nOO|XX",
"output": "YES\n++|XX"
},
{
"input": "10\nOO|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX",
"output": "YES\n++|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|XX"
},
{
"input": "10\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|OO",
"output": "YES\nXX|XX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXO|OX\nXX|++"
},
{
"input": "5\nXX|XX\nXX|XX\nXO|OX\nOO|OX\nOX|XO",
"output": "YES\nXX|XX\nXX|XX\nXO|OX\n++|OX\nOX|XO"
},
{
"input": "6\nOO|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX",
"output": "YES\n++|XX\nXO|XX\nOX|OO\nXX|OX\nOO|XX\nOX|XX"
}
] | 1,624,175,334 | 2,147,483,647 | Python 3 | OK | TESTS | 71 | 77 | 0 | n=int(input())
M=[input()for _ in range(n)]
for i in range(n):
if'OO'in M[i]:
M[i]=M[i].replace('OO','++',1)
print('YES',*M,sep='\n')
break
else:
print('NO')
| Title: Bus to Udayland
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder and Chris the Baboon are travelling to Udayland! To get there, they have to get on the special IOI bus. The IOI bus has *n* rows of seats. There are 4 seats in each row, and the seats are separated into pairs by a walkway. When ZS and Chris came, some places in the bus was already occupied.
ZS and Chris are good friends. They insist to get a pair of neighbouring empty seats. Two seats are considered neighbouring if they are in the same row and in the same pair. Given the configuration of the bus, can you help ZS and Chris determine where they should sit?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of rows of seats in the bus.
Then, *n* lines follow. Each line contains exactly 5 characters, the first two of them denote the first pair of seats in the row, the third character denotes the walkway (it always equals '|') and the last two of them denote the second pair of seats in the row.
Each character, except the walkway, equals to 'O' or to 'X'. 'O' denotes an empty seat, 'X' denotes an occupied seat. See the sample cases for more details.
Output Specification:
If it is possible for Chris and ZS to sit at neighbouring empty seats, print "YES" (without quotes) in the first line. In the next *n* lines print the bus configuration, where the characters in the pair of seats for Chris and ZS is changed with characters '+'. Thus the configuration should differ from the input one by exactly two charaters (they should be equal to 'O' in the input and to '+' in the output).
If there is no pair of seats for Chris and ZS, print "NO" (without quotes) in a single line.
If there are multiple solutions, you may print any of them.
Demo Input:
['6\nOO|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', '4\nXO|OX\nXO|XX\nOX|OX\nXX|OX\n', '5\nXX|XX\nXX|XX\nXO|OX\nXO|OO\nOX|XO\n']
Demo Output:
['YES\n++|OX\nXO|XX\nOX|OO\nXX|OX\nOO|OO\nOO|XX\n', 'NO\n', 'YES\nXX|XX\nXX|XX\nXO|OX\nXO|++\nOX|XO\n']
Note:
Note that the following is an incorrect configuration for the first sample case because the seats must be in the same pair.
O+|+X
XO|XX
OX|OO
XX|OX
OO|OO
OO|XX | ```python
n=int(input())
M=[input()for _ in range(n)]
for i in range(n):
if'OO'in M[i]:
M[i]=M[i].replace('OO','++',1)
print('YES',*M,sep='\n')
break
else:
print('NO')
``` | 3 |
|
156 | C | Cipher | PROGRAMMING | 2,000 | [
"combinatorics",
"dp"
] | null | null | Sherlock Holmes found a mysterious correspondence of two VIPs and made up his mind to read it. But there is a problem! The correspondence turned out to be encrypted. The detective tried really hard to decipher the correspondence, but he couldn't understand anything.
At last, after some thought, he thought of something. Let's say there is a word *s*, consisting of |*s*| lowercase Latin letters. Then for one operation you can choose a certain position *p* (1<=≤<=*p*<=<<=|*s*|) and perform one of the following actions:
- either replace letter *s**p* with the one that alphabetically follows it and replace letter *s**p*<=+<=1 with the one that alphabetically precedes it; - or replace letter *s**p* with the one that alphabetically precedes it and replace letter *s**p*<=+<=1 with the one that alphabetically follows it.
Let us note that letter "z" doesn't have a defined following letter and letter "a" doesn't have a defined preceding letter. That's why the corresponding changes are not acceptable. If the operation requires performing at least one unacceptable change, then such operation cannot be performed.
Two words coincide in their meaning iff one of them can be transformed into the other one as a result of zero or more operations.
Sherlock Holmes needs to learn to quickly determine the following for each word: how many words can exist that coincide in their meaning with the given word, but differs from the given word in at least one character? Count this number for him modulo 1000000007 (109<=+<=7). | The input data contains several tests. The first line contains the only integer *t* (1<=≤<=*t*<=≤<=104) — the number of tests.
Next *t* lines contain the words, one per line. Each word consists of lowercase Latin letters and has length from 1 to 100, inclusive. Lengths of words can differ. | For each word you should print the number of different other words that coincide with it in their meaning — not from the words listed in the input data, but from all possible words. As the sought number can be very large, print its value modulo 1000000007 (109<=+<=7). | [
"1\nab\n",
"1\naaaaaaaaaaa\n",
"2\nya\nklmbfxzb\n"
] | [
"1\n",
"0\n",
"24\n320092793\n"
] | Some explanations about the operation:
- Note that for each letter, we can clearly define the letter that follows it. Letter "b" alphabetically follows letter "a", letter "c" follows letter "b", ..., "z" follows letter "y". - Preceding letters are defined in the similar manner: letter "y" precedes letter "z", ..., "a" precedes letter "b". - Note that the operation never changes a word's length.
In the first sample you can obtain the only other word "ba". In the second sample you cannot obtain any other word, so the correct answer is 0.
Consider the third sample. One operation can transform word "klmbfxzb" into word "klmcexzb": we should choose *p* = 4, and replace the fourth letter with the following one ("b" → "c"), and the fifth one — with the preceding one ("f" → "e"). Also, we can obtain many other words from this one. An operation can transform word "ya" only into one other word "xb".
Word "ya" coincides in its meaning with words "xb", "wc", "vd", ..., "ay" (overall there are 24 other words). The word "klmbfxzb has many more variants — there are 3320092814 other words that coincide with in the meaning. So the answer for the first word equals 24 and for the second one equals 320092793 — the number 3320092814 modulo 10<sup class="upper-index">9</sup> + 7 | 1,500 | [
{
"input": "1\nab",
"output": "1"
},
{
"input": "1\naaaaaaaaaaa",
"output": "0"
},
{
"input": "2\nya\nklmbfxzb",
"output": "24\n320092793"
},
{
"input": "1\na",
"output": "0"
},
{
"input": "1\nz",
"output": "0"
},
{
"input": "1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "1\nmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmnmn",
"output": "39086755"
},
{
"input": "15\nejkf\nkc\nu\nznmjnznzn\nbjkcg\nwou\nywy\nqoojqlr\nnbkip\nsgmgjg\ndjjdd\nh\nkgbkri\nt\npvzbvkij",
"output": "4454\n12\n0\n667098198\n35884\n209\n20\n142184034\n186649\n4212829\n31439\n0\n3167654\n0\n474922754"
},
{
"input": "15\nieqqe\nwwbnobrb\ngyftfg\nclrn\nzwtviipwww\nmsmsiih\nofqsusmsmm\nyjomiiq\naedoeun\nz\nmwwmimiwiu\ngtdsifgg\nvmmmren\nzlgzousxzp\ngcpodkxebk",
"output": "195974\n543885418\n5715485\n10619\n87838649\n154292634\n869212338\n155736014\n55669004\n0\n792902040\n590044032\n155736014\n991368939\n271743066"
},
{
"input": "17\nwfvfmnmr\nkyururk\nnei\nmeb\nwldtalawww\njeobzb\nuuww\nwfkgzxmr\nrvvpxrihha\nqz\ngpodf\niatnevlia\njjnaunradf\nwoi\ny\nmewdykdldp\nnckg",
"output": "662991818\n51681734\n350\n170\n598684361\n3582684\n968\n541474246\n55368153\n9\n148439\n157054204\n91519085\n464\n0\n838428119\n5759"
},
{
"input": "17\nku\njf\nygbkcbf\ngmp\nnuaxjssqv\nawxxcxw\nyccccvc\na\nu\nnod\nmfgtj\nekkjbkzr\njtisatba\nxtkxlk\nt\nxkxzuizs\nnvvvqarn",
"output": "20\n14\n25664534\n486\n516112667\n64053170\n44165015\n0\n0\n450\n222299\n145570718\n897496632\n3582684\n0\n190441484\n326269025"
},
{
"input": "19\nqhovyphr\nttymgy\nqbed\nidxitl\nusbrx\nqevvydqdb\nltyjljj\ncgv\nsruvudcu\naqjbqjybyq\nrhtwwtthhh\nh\nksktyyst\npmwmnzswlw\nm\nuwaup\nxhvk\nj\nvii",
"output": "434174305\n2030279\n2924\n6460404\n177169\n583243193\n154292634\n434\n434174305\n191795714\n792902040\n0\n573191111\n676498805\n0\n195974\n9239\n0\n506"
},
{
"input": "10\njrojjyqqjtrfjf\nvuwzvmwjyfvifdfddymwfuzmvvummwdfzjzdvzuvfvjiuvyzymviyyumvziyimfzfiji\nwxzwojjzqzyqlojjbrjlbqrrwqw\nqfwppnuvbgegbqgbmeqpbguwmmqhunnquepepeewubbmnenvmwhnvhunnmsqmmgfepevupewvenmwpmgspnebv\nrxqzorkizznsiirciokscrrjqqqzkfijrrkkfrqjjifczcjcnqoisorszkjxcxvqzcfczqfcrvfrsckvvfjxnxzqjivqv\nnvimavvhfskwkhgvaowsficdmv\nqvrdgohdmgawrqo\npulanukntfhrthkxkprprhrhcouxxnkhoroptcxkfktotkokonoxptcocnfartlucnlncalnknhlpachofclannctpklackcc\ntqezktgzhipiaootfpqpzjgtqitagthef\nqaeigcacoqoc",
"output": "520219051\n945235283\n691128313\n324077859\n417775814\n827035318\n275780270\n145635612\n155578699\n486064325"
},
{
"input": "10\nnnclytzybytthncihlnnbclzcbhinhyzbhnbiyccltnnchylynhznycniiztzcthiyyhccybc\ngbcccdnjbgntyzayntwdf\ndzkxapreirktspflaudtlexeffifxxzxrjaxqfkcncxf\nnilfxfsyliingzbgsxbzxxmqqxnngsfqqqbqinglmbxgysbi\nsjquzchhssjrrzbuc\nhdhvdnjvhreiiekeinvdddneejkrdkjvikj\nanyamaosolahmhnmsmmmmhhofsaalfmomoshy\nnqvzznlicebqsviwivvhhiiciblbelvlelhisclecb\nlbtihlhulugddgtfwjiftfltijwitcgmgvjfcfcdwbliijqhidghdwibpgjqdumdijmhlbdfvcpcqqptcc\nkfjcmfzxhhkhfikihymhmhxuzeykfkmezcmieyxxshjckfxsx",
"output": "860385290\n566220124\n563237657\n25482967\n365565922\n211740598\n627945017\n550126162\n997587067\n505019519"
}
] | 1,531,489,998 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 6 | 654 | 3,276,800 | S, N = 2501, 101
m = 1000000007
k = 26
p = [[0] * (S + k) for i in range(N)]
p[0][0] = 1
for n in range(1, N):
for s in range(S):
p[n][s] = (p[n][s - 1] + p[n - 1][s] - p[n - 1][s - k]) % m
d = [0] * N
r = []
for j in range(int(input())):
t = input()
s, n = sum(ord(q) - 97 for q in t), len(t)
d[n] += 1
r.append((s, n))
for s, n in r: print(p[n][s] - d[n]) | Title: Cipher
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sherlock Holmes found a mysterious correspondence of two VIPs and made up his mind to read it. But there is a problem! The correspondence turned out to be encrypted. The detective tried really hard to decipher the correspondence, but he couldn't understand anything.
At last, after some thought, he thought of something. Let's say there is a word *s*, consisting of |*s*| lowercase Latin letters. Then for one operation you can choose a certain position *p* (1<=≤<=*p*<=<<=|*s*|) and perform one of the following actions:
- either replace letter *s**p* with the one that alphabetically follows it and replace letter *s**p*<=+<=1 with the one that alphabetically precedes it; - or replace letter *s**p* with the one that alphabetically precedes it and replace letter *s**p*<=+<=1 with the one that alphabetically follows it.
Let us note that letter "z" doesn't have a defined following letter and letter "a" doesn't have a defined preceding letter. That's why the corresponding changes are not acceptable. If the operation requires performing at least one unacceptable change, then such operation cannot be performed.
Two words coincide in their meaning iff one of them can be transformed into the other one as a result of zero or more operations.
Sherlock Holmes needs to learn to quickly determine the following for each word: how many words can exist that coincide in their meaning with the given word, but differs from the given word in at least one character? Count this number for him modulo 1000000007 (109<=+<=7).
Input Specification:
The input data contains several tests. The first line contains the only integer *t* (1<=≤<=*t*<=≤<=104) — the number of tests.
Next *t* lines contain the words, one per line. Each word consists of lowercase Latin letters and has length from 1 to 100, inclusive. Lengths of words can differ.
Output Specification:
For each word you should print the number of different other words that coincide with it in their meaning — not from the words listed in the input data, but from all possible words. As the sought number can be very large, print its value modulo 1000000007 (109<=+<=7).
Demo Input:
['1\nab\n', '1\naaaaaaaaaaa\n', '2\nya\nklmbfxzb\n']
Demo Output:
['1\n', '0\n', '24\n320092793\n']
Note:
Some explanations about the operation:
- Note that for each letter, we can clearly define the letter that follows it. Letter "b" alphabetically follows letter "a", letter "c" follows letter "b", ..., "z" follows letter "y". - Preceding letters are defined in the similar manner: letter "y" precedes letter "z", ..., "a" precedes letter "b". - Note that the operation never changes a word's length.
In the first sample you can obtain the only other word "ba". In the second sample you cannot obtain any other word, so the correct answer is 0.
Consider the third sample. One operation can transform word "klmbfxzb" into word "klmcexzb": we should choose *p* = 4, and replace the fourth letter with the following one ("b" → "c"), and the fifth one — with the preceding one ("f" → "e"). Also, we can obtain many other words from this one. An operation can transform word "ya" only into one other word "xb".
Word "ya" coincides in its meaning with words "xb", "wc", "vd", ..., "ay" (overall there are 24 other words). The word "klmbfxzb has many more variants — there are 3320092814 other words that coincide with in the meaning. So the answer for the first word equals 24 and for the second one equals 320092793 — the number 3320092814 modulo 10<sup class="upper-index">9</sup> + 7 | ```python
S, N = 2501, 101
m = 1000000007
k = 26
p = [[0] * (S + k) for i in range(N)]
p[0][0] = 1
for n in range(1, N):
for s in range(S):
p[n][s] = (p[n][s - 1] + p[n - 1][s] - p[n - 1][s - k]) % m
d = [0] * N
r = []
for j in range(int(input())):
t = input()
s, n = sum(ord(q) - 97 for q in t), len(t)
d[n] += 1
r.append((s, n))
for s, n in r: print(p[n][s] - d[n])
``` | 0 |
|
893 | B | Beautiful Divisors | PROGRAMMING | 1,000 | [
"brute force",
"implementation"
] | null | null | Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes.
Some examples of beautiful numbers:
- 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610).
More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1).
Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it! | The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got. | Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists. | [
"3\n",
"992\n"
] | [
"1\n",
"496\n"
] | none | 0 | [
{
"input": "3",
"output": "1"
},
{
"input": "992",
"output": "496"
},
{
"input": "81142",
"output": "1"
},
{
"input": "76920",
"output": "120"
},
{
"input": "2016",
"output": "2016"
},
{
"input": "1",
"output": "1"
},
{
"input": "6",
"output": "6"
},
{
"input": "32640",
"output": "32640"
},
{
"input": "12096",
"output": "2016"
},
{
"input": "55948",
"output": "1"
},
{
"input": "47262",
"output": "6"
},
{
"input": "22876",
"output": "28"
},
{
"input": "96120",
"output": "120"
},
{
"input": "42160",
"output": "496"
},
{
"input": "38304",
"output": "2016"
},
{
"input": "89408",
"output": "8128"
},
{
"input": "97920",
"output": "32640"
},
{
"input": "55493",
"output": "1"
},
{
"input": "38021",
"output": "1"
},
{
"input": "21445",
"output": "1"
},
{
"input": "100000",
"output": "1"
},
{
"input": "497",
"output": "1"
},
{
"input": "240",
"output": "120"
},
{
"input": "21204",
"output": "6"
},
{
"input": "65536",
"output": "1"
},
{
"input": "364",
"output": "28"
},
{
"input": "1024",
"output": "1"
},
{
"input": "36",
"output": "6"
},
{
"input": "28",
"output": "28"
},
{
"input": "14400",
"output": "120"
},
{
"input": "10080",
"output": "2016"
},
{
"input": "9",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "42",
"output": "6"
},
{
"input": "83160",
"output": "120"
},
{
"input": "65534",
"output": "1"
},
{
"input": "1026",
"output": "6"
},
{
"input": "1025",
"output": "1"
},
{
"input": "1027",
"output": "1"
},
{
"input": "2018",
"output": "1"
},
{
"input": "2020",
"output": "1"
},
{
"input": "123",
"output": "1"
},
{
"input": "150",
"output": "6"
},
{
"input": "5",
"output": "1"
},
{
"input": "66",
"output": "6"
},
{
"input": "12768",
"output": "28"
},
{
"input": "156",
"output": "6"
},
{
"input": "99990",
"output": "6"
},
{
"input": "248",
"output": "1"
}
] | 1,630,950,109 | 709 | PyPy 3 | OK | TESTS | 49 | 124 | 20,172,800 | import sys
input = sys.stdin.readline
def divisor(i):
s = []
for j in range(1, int(i ** (1 / 2)) + 1):
if i % j == 0:
s.append(i // j)
s.append(j)
return sorted(set(s))
pow2 = [1]
for _ in range(20):
pow2.append(2 * pow2[-1])
s = set()
for k in range(20):
s.add((pow2[k + 1] - 1) * pow2[k])
n = int(input())
d = divisor(n)
ans = 1
for i in d:
if i in s:
ans = max(ans, i)
print(ans) | Title: Beautiful Divisors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Luba learned about a special kind of numbers that she calls beautiful numbers. The number is called beautiful iff its binary representation consists of *k*<=+<=1 consecutive ones, and then *k* consecutive zeroes.
Some examples of beautiful numbers:
- 12 (110); - 1102 (610); - 11110002 (12010); - 1111100002 (49610).
More formally, the number is beautiful iff there exists some positive integer *k* such that the number is equal to (2*k*<=-<=1)<=*<=(2*k*<=-<=1).
Luba has got an integer number *n*, and she wants to find its greatest beautiful divisor. Help her to find it!
Input Specification:
The only line of input contains one number *n* (1<=≤<=*n*<=≤<=105) — the number Luba has got.
Output Specification:
Output one number — the greatest beautiful divisor of Luba's number. It is obvious that the answer always exists.
Demo Input:
['3\n', '992\n']
Demo Output:
['1\n', '496\n']
Note:
none | ```python
import sys
input = sys.stdin.readline
def divisor(i):
s = []
for j in range(1, int(i ** (1 / 2)) + 1):
if i % j == 0:
s.append(i // j)
s.append(j)
return sorted(set(s))
pow2 = [1]
for _ in range(20):
pow2.append(2 * pow2[-1])
s = set()
for k in range(20):
s.add((pow2[k + 1] - 1) * pow2[k])
n = int(input())
d = divisor(n)
ans = 1
for i in d:
if i in s:
ans = max(ans, i)
print(ans)
``` | 3 |
|
1,010 | A | Fly | PROGRAMMING | 1,500 | [
"binary search",
"math"
] | null | null | Natasha is going to fly on a rocket to Mars and return to Earth. Also, on the way to Mars, she will land on $n - 2$ intermediate planets. Formally: we number all the planets from $1$ to $n$. $1$ is Earth, $n$ is Mars. Natasha will make exactly $n$ flights: $1 \to 2 \to \ldots n \to 1$.
Flight from $x$ to $y$ consists of two phases: take-off from planet $x$ and landing to planet $y$. This way, the overall itinerary of the trip will be: the $1$-st planet $\to$ take-off from the $1$-st planet $\to$ landing to the $2$-nd planet $\to$ $2$-nd planet $\to$ take-off from the $2$-nd planet $\to$ $\ldots$ $\to$ landing to the $n$-th planet $\to$ the $n$-th planet $\to$ take-off from the $n$-th planet $\to$ landing to the $1$-st planet $\to$ the $1$-st planet.
The mass of the rocket together with all the useful cargo (but without fuel) is $m$ tons. However, Natasha does not know how much fuel to load into the rocket. Unfortunately, fuel can only be loaded on Earth, so if the rocket runs out of fuel on some other planet, Natasha will not be able to return home. Fuel is needed to take-off from each planet and to land to each planet. It is known that $1$ ton of fuel can lift off $a_i$ tons of rocket from the $i$-th planet or to land $b_i$ tons of rocket onto the $i$-th planet.
For example, if the weight of rocket is $9$ tons, weight of fuel is $3$ tons and take-off coefficient is $8$ ($a_i = 8$), then $1.5$ tons of fuel will be burnt (since $1.5 \cdot 8 = 9 + 3$). The new weight of fuel after take-off will be $1.5$ tons.
Please note, that it is allowed to burn non-integral amount of fuel during take-off or landing, and the amount of initial fuel can be non-integral as well.
Help Natasha to calculate the minimum mass of fuel to load into the rocket. Note, that the rocket must spend fuel to carry both useful cargo and the fuel itself. However, it doesn't need to carry the fuel which has already been burnt. Assume, that the rocket takes off and lands instantly. | The first line contains a single integer $n$ ($2 \le n \le 1000$) — number of planets.
The second line contains the only integer $m$ ($1 \le m \le 1000$) — weight of the payload.
The third line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 1000$), where $a_i$ is the number of tons, which can be lifted off by one ton of fuel.
The fourth line contains $n$ integers $b_1, b_2, \ldots, b_n$ ($1 \le b_i \le 1000$), where $b_i$ is the number of tons, which can be landed by one ton of fuel.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel. | If Natasha can fly to Mars through $(n - 2)$ planets and return to Earth, print the minimum mass of fuel (in tons) that Natasha should take. Otherwise, print a single number $-1$.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel.
The answer will be considered correct if its absolute or relative error doesn't exceed $10^{-6}$. Formally, let your answer be $p$, and the jury's answer be $q$. Your answer is considered correct if $\frac{|p - q|}{\max{(1, |q|)}} \le 10^{-6}$. | [
"2\n12\n11 8\n7 5\n",
"3\n1\n1 4 1\n2 5 3\n",
"6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3\n"
] | [
"10.0000000000\n",
"-1\n",
"85.4800000000\n"
] | Let's consider the first example.
Initially, the mass of a rocket with fuel is $22$ tons.
- At take-off from Earth one ton of fuel can lift off $11$ tons of cargo, so to lift off $22$ tons you need to burn $2$ tons of fuel. Remaining weight of the rocket with fuel is $20$ tons.- During landing on Mars, one ton of fuel can land $5$ tons of cargo, so for landing $20$ tons you will need to burn $4$ tons of fuel. There will be $16$ tons of the rocket with fuel remaining.- While taking off from Mars, one ton of fuel can raise $8$ tons of cargo, so to lift off $16$ tons you will need to burn $2$ tons of fuel. There will be $14$ tons of rocket with fuel after that.- During landing on Earth, one ton of fuel can land $7$ tons of cargo, so for landing $14$ tons you will need to burn $2$ tons of fuel. Remaining weight is $12$ tons, that is, a rocket without any fuel.
In the second case, the rocket will not be able even to take off from Earth. | 500 | [
{
"input": "2\n12\n11 8\n7 5",
"output": "10.0000000000"
},
{
"input": "3\n1\n1 4 1\n2 5 3",
"output": "-1"
},
{
"input": "6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3",
"output": "85.4800000000"
},
{
"input": "3\n3\n1 2 1\n2 2 2",
"output": "-1"
},
{
"input": "4\n4\n2 3 2 2\n2 3 4 3",
"output": "284.0000000000"
},
{
"input": "5\n2\n1 2 2 1 2\n4 5 1 4 1",
"output": "-1"
},
{
"input": "7\n7\n3 2 6 2 2 2 5\n4 7 5 6 2 2 2",
"output": "4697.0000000000"
},
{
"input": "2\n1000\n12 34\n56 78",
"output": "159.2650775220"
},
{
"input": "8\n4\n1 1 4 1 3 1 8 1\n1 1 1 1 1 3 1 2",
"output": "-1"
},
{
"input": "9\n2\n8 7 1 1 3 7 1 2 4\n4 1 1 8 7 7 1 1 5",
"output": "-1"
},
{
"input": "10\n10\n9 8 8 7 2 10 2 9 2 4\n3 10 6 2 6 6 5 9 4 5",
"output": "3075.7142857143"
},
{
"input": "20\n12\n3 9 12 13 16 18 9 9 19 7 2 5 17 14 7 7 15 16 5 7\n16 9 13 5 14 10 4 3 16 16 12 20 17 11 4 5 5 14 6 15",
"output": "4670.8944493007"
},
{
"input": "30\n5\n25 1 28 1 27 25 24 1 28 1 12 1 29 16 1 1 1 1 27 1 24 1 1 1 1 1 1 1 30 3\n1 22 1 1 24 2 13 1 16 21 1 27 14 16 1 1 7 1 1 18 1 23 10 1 15 16 16 15 10 1",
"output": "-1"
},
{
"input": "40\n13\n1 1 1 23 21 1 1 1 1 1 40 32 1 21 1 8 1 1 36 15 33 1 30 1 1 37 22 1 4 39 7 1 9 37 1 1 1 28 1 1\n1 34 17 1 38 20 8 14 1 18 29 3 21 21 18 14 1 11 1 1 23 1 25 1 14 1 7 31 9 20 25 1 1 1 1 8 26 12 1 1",
"output": "-1"
},
{
"input": "50\n19\n17 7 13 42 19 25 10 25 2 36 17 40 30 48 34 43 34 20 5 15 8 7 43 35 21 40 40 19 30 11 49 7 24 23 43 30 38 49 10 8 30 11 28 50 48 25 25 20 48 24\n49 35 10 22 24 50 50 7 6 13 16 35 12 43 50 44 35 33 38 49 26 18 23 37 7 38 23 20 28 48 41 16 6 32 32 34 11 39 38 9 38 23 16 31 37 47 33 20 46 30",
"output": "7832.1821424977"
},
{
"input": "60\n21\n11 35 1 28 39 13 19 56 13 13 21 25 1 1 23 1 52 26 53 1 1 1 30 39 1 7 1 1 3 1 1 10 1 1 37 1 1 25 1 1 1 53 1 3 48 1 6 5 4 15 1 14 25 53 25 38 27 1 1 1\n1 1 1 35 40 58 10 22 1 56 1 59 1 6 33 1 1 1 1 18 14 1 1 40 25 47 1 34 1 1 53 1 1 25 1 45 1 1 25 34 3 1 1 1 53 27 11 58 1 1 1 10 12 1 1 1 31 52 1 1",
"output": "-1"
},
{
"input": "70\n69\n70 66 57 58 24 60 39 2 48 61 65 22 10 26 68 62 48 25 12 14 45 57 6 30 48 15 46 33 42 28 69 42 64 25 24 8 62 12 68 53 55 20 32 70 3 5 41 49 16 26 2 34 34 20 39 65 18 47 62 31 39 28 61 67 7 14 31 31 53 54\n40 33 24 20 68 20 22 39 53 56 48 38 59 45 47 46 7 69 11 58 61 40 35 38 62 66 18 36 44 48 67 24 14 27 67 63 68 30 50 6 58 7 6 35 20 58 6 12 12 23 14 2 63 27 29 22 49 16 55 40 70 27 27 70 42 38 66 55 69 47",
"output": "217989.4794743629"
},
{
"input": "80\n21\n65 4 26 25 1 1 1 1 1 1 60 1 29 43 48 6 48 13 29 1 1 62 1 1 1 1 1 1 1 26 9 1 22 1 35 13 66 36 1 1 1 38 55 21 70 1 58 70 1 1 38 1 1 20 1 1 51 1 1 28 1 23 11 1 39 47 1 52 41 1 63 1 1 52 1 45 11 10 80 1\n1 1 25 30 1 1 55 54 1 48 10 37 22 1 74 1 78 13 1 65 32 1 1 1 1 69 5 59 1 1 65 1 40 1 31 1 1 75 54 1 60 1 1 1 1 1 1 1 11 29 36 1 72 71 52 1 1 1 37 1 1 75 43 9 53 1 62 1 29 1 40 27 59 74 41 53 19 30 1 73",
"output": "-1"
},
{
"input": "90\n35\n1 68 16 30 24 1 1 1 35 1 1 67 1 1 1 1 33 16 37 77 83 1 77 26 1 1 68 67 70 62 1 47 1 1 1 84 1 65 1 32 83 1 1 1 28 1 71 76 84 1 1 5 1 74 10 1 1 1 38 87 13 1 7 66 81 49 1 9 1 11 1 25 1 1 1 1 7 1 1 36 61 47 51 1 1 69 40 1 37 1\n40 1 21 1 19 51 37 52 64 1 86 1 5 24 1 1 1 19 36 1 1 77 24 4 1 18 89 1 1 1 1 1 29 22 1 80 32 36 6 1 63 1 30 1 1 1 86 79 73 52 9 1 1 11 7 1 25 20 1 20 1 49 1 37 1 41 1 1 1 1 54 55 1 10 1 1 1 1 1 1 66 1 68 1 1 1 1 53 1 1",
"output": "-1"
},
{
"input": "2\n1\n1 1\n1 1",
"output": "-1"
},
{
"input": "2\n1\n1 1\n2 2",
"output": "-1"
},
{
"input": "2\n1\n2 2\n1 1",
"output": "-1"
},
{
"input": "2\n1\n2 2\n2 2",
"output": "15.0000000000"
},
{
"input": "2\n2\n1 1\n1 1",
"output": "-1"
},
{
"input": "2\n2\n1 1\n2 2",
"output": "-1"
},
{
"input": "2\n2\n2 2\n1 1",
"output": "-1"
},
{
"input": "2\n2\n2 2\n2 2",
"output": "30.0000000000"
},
{
"input": "40\n55\n1 382 1 1 1 629 111 689 396 614 1 1 995 148 7 820 913 1 1 169 157 1 702 1 159 1 1 226 1 253 1 319 1 130 1 1 1 466 1 756\n1 23 555 1 412 1 1 373 316 234 888 1 112 818 33 443 313 1 235 1 1 610 110 535 1 445 1 386 1 1 758 1 292 1 862 1 244 428 530 1",
"output": "-1"
},
{
"input": "49\n1\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "695580114.6380882263"
},
{
"input": "2\n12\n11 8\n1 1",
"output": "-1"
},
{
"input": "3\n3\n7 11 17\n19 31 33",
"output": "1.6012429470"
}
] | 1,592,842,660 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 7 | 217 | 2,355,200 | if __name__ == '__main__':
n = int(input())
m = int(input())
arr = list(map(int, input().split()))
brr = list(map(int, input().split()))
if 1 in arr or 1 in brr:
print(-1)
else:
mul = 1
for x in arr:
mul *= x
for x in brr:
mul *= x
for x in arr:
mul /= x - 1
for x in brr:
mul /= x - 1
print(mul * m - m)
| Title: Fly
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Natasha is going to fly on a rocket to Mars and return to Earth. Also, on the way to Mars, she will land on $n - 2$ intermediate planets. Formally: we number all the planets from $1$ to $n$. $1$ is Earth, $n$ is Mars. Natasha will make exactly $n$ flights: $1 \to 2 \to \ldots n \to 1$.
Flight from $x$ to $y$ consists of two phases: take-off from planet $x$ and landing to planet $y$. This way, the overall itinerary of the trip will be: the $1$-st planet $\to$ take-off from the $1$-st planet $\to$ landing to the $2$-nd planet $\to$ $2$-nd planet $\to$ take-off from the $2$-nd planet $\to$ $\ldots$ $\to$ landing to the $n$-th planet $\to$ the $n$-th planet $\to$ take-off from the $n$-th planet $\to$ landing to the $1$-st planet $\to$ the $1$-st planet.
The mass of the rocket together with all the useful cargo (but without fuel) is $m$ tons. However, Natasha does not know how much fuel to load into the rocket. Unfortunately, fuel can only be loaded on Earth, so if the rocket runs out of fuel on some other planet, Natasha will not be able to return home. Fuel is needed to take-off from each planet and to land to each planet. It is known that $1$ ton of fuel can lift off $a_i$ tons of rocket from the $i$-th planet or to land $b_i$ tons of rocket onto the $i$-th planet.
For example, if the weight of rocket is $9$ tons, weight of fuel is $3$ tons and take-off coefficient is $8$ ($a_i = 8$), then $1.5$ tons of fuel will be burnt (since $1.5 \cdot 8 = 9 + 3$). The new weight of fuel after take-off will be $1.5$ tons.
Please note, that it is allowed to burn non-integral amount of fuel during take-off or landing, and the amount of initial fuel can be non-integral as well.
Help Natasha to calculate the minimum mass of fuel to load into the rocket. Note, that the rocket must spend fuel to carry both useful cargo and the fuel itself. However, it doesn't need to carry the fuel which has already been burnt. Assume, that the rocket takes off and lands instantly.
Input Specification:
The first line contains a single integer $n$ ($2 \le n \le 1000$) — number of planets.
The second line contains the only integer $m$ ($1 \le m \le 1000$) — weight of the payload.
The third line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 1000$), where $a_i$ is the number of tons, which can be lifted off by one ton of fuel.
The fourth line contains $n$ integers $b_1, b_2, \ldots, b_n$ ($1 \le b_i \le 1000$), where $b_i$ is the number of tons, which can be landed by one ton of fuel.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel.
Output Specification:
If Natasha can fly to Mars through $(n - 2)$ planets and return to Earth, print the minimum mass of fuel (in tons) that Natasha should take. Otherwise, print a single number $-1$.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel.
The answer will be considered correct if its absolute or relative error doesn't exceed $10^{-6}$. Formally, let your answer be $p$, and the jury's answer be $q$. Your answer is considered correct if $\frac{|p - q|}{\max{(1, |q|)}} \le 10^{-6}$.
Demo Input:
['2\n12\n11 8\n7 5\n', '3\n1\n1 4 1\n2 5 3\n', '6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3\n']
Demo Output:
['10.0000000000\n', '-1\n', '85.4800000000\n']
Note:
Let's consider the first example.
Initially, the mass of a rocket with fuel is $22$ tons.
- At take-off from Earth one ton of fuel can lift off $11$ tons of cargo, so to lift off $22$ tons you need to burn $2$ tons of fuel. Remaining weight of the rocket with fuel is $20$ tons.- During landing on Mars, one ton of fuel can land $5$ tons of cargo, so for landing $20$ tons you will need to burn $4$ tons of fuel. There will be $16$ tons of the rocket with fuel remaining.- While taking off from Mars, one ton of fuel can raise $8$ tons of cargo, so to lift off $16$ tons you will need to burn $2$ tons of fuel. There will be $14$ tons of rocket with fuel after that.- During landing on Earth, one ton of fuel can land $7$ tons of cargo, so for landing $14$ tons you will need to burn $2$ tons of fuel. Remaining weight is $12$ tons, that is, a rocket without any fuel.
In the second case, the rocket will not be able even to take off from Earth. | ```python
if __name__ == '__main__':
n = int(input())
m = int(input())
arr = list(map(int, input().split()))
brr = list(map(int, input().split()))
if 1 in arr or 1 in brr:
print(-1)
else:
mul = 1
for x in arr:
mul *= x
for x in brr:
mul *= x
for x in arr:
mul /= x - 1
for x in brr:
mul /= x - 1
print(mul * m - m)
``` | -1 |
|
165 | A | Supercentral Point | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*):
- point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=><=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=<<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=<<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=><=*y*
We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points.
Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. | The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. | Print the only number — the number of supercentral points of the given set. | [
"8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n",
"5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n"
] | [
"2\n",
"1\n"
] | In the first sample the supercentral points are only points (1, 1) and (1, 2).
In the second sample there is one supercental point — point (0, 0). | 500 | [
{
"input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3",
"output": "2"
},
{
"input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0",
"output": "1"
},
{
"input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1",
"output": "1"
},
{
"input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808",
"output": "7"
},
{
"input": "1\n487 550",
"output": "0"
},
{
"input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676",
"output": "0"
},
{
"input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136",
"output": "8"
},
{
"input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188",
"output": "9"
},
{
"input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191",
"output": "5"
},
{
"input": "4\n1 0\n2 0\n1 1\n1 -1",
"output": "0"
}
] | 1,689,931,049 | 2,147,483,647 | Python 3 | OK | TESTS | 26 | 92 | 0 | """
165A | Supercentral Point: implementation
"""
def supercentral_point():
n = int(input())
ss = []
for _ in range(n):
s = list(map(int, input().split(' ')))
ss.append(s)
a = 0
for x, y in ss:
l = 0
r = 0
u = 0
d = 0
for xp, yp in ss:
if y == yp:
if x > xp:
l += 1
if x < xp:
r += 1
if x == xp:
if y < yp:
u += 1
if y > yp:
d += 1
if l and r and u and d:
a += 1
print(a)
if __name__ == '__main__':
supercentral_point() | Title: Supercentral Point
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*):
- point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=><=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=<<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=<<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=><=*y*
We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points.
Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
Input Specification:
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Output Specification:
Print the only number — the number of supercentral points of the given set.
Demo Input:
['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the supercentral points are only points (1, 1) and (1, 2).
In the second sample there is one supercental point — point (0, 0). | ```python
"""
165A | Supercentral Point: implementation
"""
def supercentral_point():
n = int(input())
ss = []
for _ in range(n):
s = list(map(int, input().split(' ')))
ss.append(s)
a = 0
for x, y in ss:
l = 0
r = 0
u = 0
d = 0
for xp, yp in ss:
if y == yp:
if x > xp:
l += 1
if x < xp:
r += 1
if x == xp:
if y < yp:
u += 1
if y > yp:
d += 1
if l and r and u and d:
a += 1
print(a)
if __name__ == '__main__':
supercentral_point()
``` | 3 |
|
509 | A | Maximum in Table | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above. | The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table. | Print a single line containing a positive integer *m* — the maximum value in the table. | [
"1\n",
"5\n"
] | [
"1",
"70"
] | In the second test the rows of the table look as follows: | 0 | [
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,652,410,691 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 15 | 0 | for _ in range(int(input())):
a,b,c,n = map(int,input().split())
cnt = 0
k = n
m = max(a,b,c)
cnt += (m-a)
cnt += (m-b)
cnt += (m-c)
a = m - a
b = m - b
c = m - c
n = n - cnt
if n%3 == 0:
print('YES')
else:
print('NO') | Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows: | ```python
for _ in range(int(input())):
a,b,c,n = map(int,input().split())
cnt = 0
k = n
m = max(a,b,c)
cnt += (m-a)
cnt += (m-b)
cnt += (m-c)
a = m - a
b = m - b
c = m - c
n = n - cnt
if n%3 == 0:
print('YES')
else:
print('NO')
``` | -1 |
|
667 | A | Pouring Rain | PROGRAMMING | 1,100 | [
"geometry",
"math"
] | null | null | A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter. | The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup. | If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104. | [
"1 2 3 100\n",
"1 1 1 1\n"
] | [
"NO\n",
"YES\n3.659792366325\n"
] | In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds. | 500 | [
{
"input": "1 2 3 100",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "YES\n3.659792366325"
},
{
"input": "48 7946 7992 72",
"output": "NO"
},
{
"input": "72 6791 8546 46",
"output": "NO"
},
{
"input": "100 5635 9099 23",
"output": "NO"
},
{
"input": "20 287 3845 5",
"output": "YES\n39.646277165210"
},
{
"input": "48 6428 9807 83",
"output": "NO"
},
{
"input": "72 5272 4552 64",
"output": "NO"
},
{
"input": "100 4117 5106 34",
"output": "NO"
},
{
"input": "20 2961 9852 15",
"output": "YES\n180.991437129723"
},
{
"input": "48 1805 3109 93",
"output": "NO"
},
{
"input": "72 8534 7042 65",
"output": "NO"
},
{
"input": "1 47 80 68",
"output": "YES\n1.388102806810"
},
{
"input": "4 495 8813 1",
"output": "YES\n0.706823517575"
},
{
"input": "5 2797 5925 9",
"output": "YES\n9.553973511669"
},
{
"input": "1 8324 4362 23",
"output": "YES\n1.505007106354"
},
{
"input": "6 1976 8455 3",
"output": "YES\n6.674898722265"
},
{
"input": "7 2644 8080 5",
"output": "YES\n12.900417790197"
},
{
"input": "3 4183 5491 98",
"output": "YES\n6.162185601824"
},
{
"input": "2 8591 320 101",
"output": "YES\n9999.259991757254"
},
{
"input": "10000 10000 10000 10000",
"output": "NO"
},
{
"input": "2 5000 12 3",
"output": "YES\n6099.653943875812"
},
{
"input": "10 1000 100 1",
"output": "YES\n3659.792366325487"
}
] | 1,653,865,904 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 23 | 62 | 0 | from math import pi
d,h,v,e = map(float, input().split())
flux_in = d * d * pi / 4 * e
if (flux_in > v):
print("NO")
else:
print("YES")
print(h * d * d * pi / (4 * (v - flux_in))) | Title: Pouring Rain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter.
Input Specification:
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup.
Output Specification:
If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
Demo Input:
['1 2 3 100\n', '1 1 1 1\n']
Demo Output:
['NO\n', 'YES\n3.659792366325\n']
Note:
In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds. | ```python
from math import pi
d,h,v,e = map(float, input().split())
flux_in = d * d * pi / 4 * e
if (flux_in > v):
print("NO")
else:
print("YES")
print(h * d * d * pi / (4 * (v - flux_in)))
``` | 3 |
|
600 | F | Edge coloring of bipartite graph | PROGRAMMING | 2,800 | [
"graphs"
] | null | null | You are given an undirected bipartite graph without multiple edges. You should paint the edges of graph to minimal number of colours, so that no two adjacent edges have the same colour. | The first line contains three integers *a*,<=*b*,<=*m* (1<=≤<=*a*,<=*b*<=≤<=1000, 0<=≤<=*m*<=≤<=105), *a* is the size of the first part, *b* is the size of the second part, *m* is the number of edges in the graph.
Each of the next *m* lines contains two integers *x*,<=*y* (1<=≤<=*x*<=≤<=*a*,<=1<=≤<=*y*<=≤<=*b*), where *x* is the number of the vertex in the first part and *y* is the number of the vertex in the second part. It is guaranteed that there are no multiple edges. | In the first line print integer *c* — the minimal number of colours. The second line should contain *m* integers from 1 to *c* — the colours of the edges (in the order they appear in the input).
If there are several solutions, you can print any one of them. | [
"4 3 5\n1 2\n2 2\n3 2\n4 1\n4 3\n"
] | [
"3\n1 2 3 1 2\n"
] | none | 0 | [
{
"input": "4 3 5\n1 2\n2 2\n3 2\n4 1\n4 3",
"output": "3\n1 2 3 1 2"
},
{
"input": "4 3 5\n1 2\n2 2\n3 2\n4 1\n4 3",
"output": "3\n1 2 3 1 2"
},
{
"input": "4 3 0",
"output": "0"
},
{
"input": "10 10 67\n1 1\n1 2\n1 3\n1 7\n1 9\n1 10\n2 1\n2 2\n2 3\n2 6\n2 8\n2 10\n3 2\n3 3\n3 6\n3 8\n3 9\n3 10\n4 1\n4 4\n4 5\n4 6\n4 7\n4 8\n5 2\n5 4\n5 7\n5 8\n5 9\n5 10\n6 1\n6 2\n6 3\n6 4\n6 6\n6 8\n6 9\n6 10\n7 2\n7 4\n7 6\n7 9\n7 10\n8 3\n8 4\n8 5\n8 6\n8 7\n8 8\n8 9\n8 10\n9 1\n9 2\n9 3\n9 5\n9 6\n9 7\n9 8\n9 9\n9 10\n10 1\n10 3\n10 4\n10 5\n10 8\n10 9\n10 10",
"output": "9\n3 2 1 4 5 6 2 6 4 3 5 1 1 2 4 3 6 5 1 3 4 5 6 2 3 5 1 6 4 2 4 5 3 2 6 1 7 8 4 8 2 3 7 5 4 6 7 2 8 1 3 5 7 6 1 8 3 4 2 9 6 7 1 2 9 8 4"
},
{
"input": "10 10 27\n1 10\n2 1\n2 3\n2 6\n2 8\n3 2\n3 4\n3 5\n4 1\n4 3\n4 5\n5 2\n5 5\n5 6\n6 1\n6 6\n7 8\n7 9\n8 1\n8 3\n8 6\n8 8\n9 1\n9 10\n10 2\n10 4\n10 5",
"output": "5\n1 1 2 3 4 1 2 3 2 1 4 2 1 4 3 2 1 2 4 3 1 2 5 2 3 1 2"
},
{
"input": "10 10 10\n1 7\n1 10\n2 3\n3 3\n4 5\n4 6\n4 7\n5 5\n8 10\n10 9",
"output": "3\n1 2 1 2 1 2 3 2 1 1"
},
{
"input": "100 100 50\n6 1\n6 89\n12 34\n14 4\n16 12\n20 45\n22 41\n22 87\n25 81\n30 92\n30 98\n31 16\n31 89\n32 84\n33 45\n33 94\n34 97\n36 94\n37 81\n39 23\n40 55\n40 60\n42 82\n44 80\n46 57\n46 86\n50 48\n55 33\n56 59\n56 76\n64 27\n64 60\n65 24\n71 95\n72 28\n74 23\n76 11\n80 34\n80 46\n81 22\n81 46\n85 2\n87 9\n91 97\n92 35\n95 22\n97 87\n98 29\n98 74\n100 7",
"output": "2\n1 2 1 1 1 1 1 2 1 1 2 2 1 1 2 1 1 2 2 1 1 2 1 1 1 2 1 1 1 2 2 1 1 1 1 2 1 2 1 1 2 1 1 2 1 2 1 1 2 1"
},
{
"input": "100 100 50\n3 71\n3 97\n5 65\n7 49\n9 85\n10 92\n12 60\n16 52\n17 13\n18 22\n22 85\n24 16\n27 47\n29 18\n31 83\n36 10\n37 68\n37 75\n38 1\n41 48\n43 99\n45 65\n45 96\n46 33\n50 39\n51 43\n53 55\n59 4\n63 1\n64 58\n64 92\n65 95\n70 49\n74 52\n75 51\n76 29\n76 43\n80 92\n84 51\n85 25\n85 37\n86 24\n86 81\n87 51\n91 7\n93 33\n97 50\n100 39\n100 59\n100 66",
"output": "3\n1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 2 1 2 1 2 2 1 1 2 3 2 1 2 1 2 3 1 2 1 2 1 3"
},
{
"input": "100 100 50\n4 76\n7 17\n8 6\n8 58\n11 56\n12 79\n14 38\n19 39\n22 50\n24 33\n27 41\n29 5\n29 35\n30 20\n31 37\n31 80\n32 50\n38 39\n42 49\n42 59\n48 1\n48 80\n49 36\n49 70\n50 95\n51 3\n51 33\n57 28\n59 71\n59 94\n59 95\n61 70\n63 5\n63 98\n64 73\n66 65\n74 85\n77 13\n77 59\n78 61\n79 4\n80 39\n82 91\n85 82\n85 92\n86 45\n88 32\n89 7\n93 21\n96 36",
"output": "3\n1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 2 2 2 1 2 2 1 1 2 1 1 2 1 1 2 3 1 2 1 1 1 1 1 3 1 1 3 1 1 2 1 1 1 1 2"
},
{
"input": "15 15 54\n1 1\n1 3\n1 5\n1 10\n1 14\n1 15\n2 3\n2 5\n2 14\n3 4\n3 10\n4 2\n4 13\n4 15\n5 4\n5 8\n5 10\n6 4\n6 6\n6 7\n6 8\n6 15\n7 3\n7 6\n7 7\n7 10\n8 1\n8 4\n8 6\n8 13\n9 2\n9 3\n10 2\n10 7\n10 15\n11 3\n11 6\n11 7\n11 10\n11 11\n12 5\n12 9\n12 10\n13 11\n14 2\n14 8\n14 12\n14 14\n14 15\n15 4\n15 5\n15 6\n15 10\n15 15",
"output": "7\n1 2 3 4 5 6 1 2 3 1 2 1 2 3 2 1 3 3 1 2 4 5 3 2 1 5 2 4 3 1 2 4 3 4 1 5 4 3 1 2 4 2 6 1 4 3 1 6 2 5 1 6 7 4"
},
{
"input": "15 15 49\n1 4\n1 7\n1 9\n1 11\n1 13\n2 1\n2 2\n2 4\n2 6\n2 8\n2 12\n2 13\n3 1\n3 2\n3 5\n3 9\n3 10\n4 2\n4 5\n4 6\n5 1\n5 8\n5 12\n6 1\n6 6\n6 15\n7 14\n8 2\n8 5\n8 6\n8 15\n9 1\n9 6\n9 13\n10 9\n10 11\n11 1\n11 2\n12 3\n12 7\n12 14\n13 5\n13 9\n13 14\n14 2\n14 3\n14 13\n15 10\n15 15",
"output": "7\n1 2 3 4 5 1 2 3 4 5 6 7 2 1 3 4 5 3 1 2 3 1 2 4 1 2 1 4 2 3 1 5 6 1 1 2 6 5 1 3 2 4 2 3 6 2 3 1 3"
},
{
"input": "15 15 49\n1 4\n1 7\n1 9\n1 11\n1 13\n2 1\n2 2\n2 4\n2 6\n2 8\n2 12\n2 13\n3 1\n3 2\n3 5\n3 9\n3 10\n4 2\n4 5\n4 6\n5 1\n5 8\n5 12\n6 1\n6 6\n6 15\n7 14\n8 2\n8 5\n8 6\n8 15\n9 1\n9 6\n9 13\n10 9\n10 11\n11 1\n11 2\n12 3\n12 7\n12 14\n13 5\n13 9\n13 14\n14 2\n14 3\n14 13\n15 10\n15 15",
"output": "7\n1 2 3 4 5 1 2 3 4 5 6 7 2 1 3 4 5 3 1 2 3 1 2 4 1 2 1 4 2 3 1 5 6 1 1 2 6 5 1 3 2 4 2 3 6 2 3 1 3"
},
{
"input": "15 15 53\n1 6\n2 4\n2 10\n3 3\n3 4\n3 11\n3 13\n3 14\n4 2\n4 12\n5 7\n5 8\n5 10\n6 1\n6 9\n7 10\n7 15\n8 7\n8 8\n9 4\n9 5\n9 6\n9 8\n9 11\n9 15\n10 1\n10 11\n10 15\n11 5\n11 7\n11 10\n11 12\n11 13\n12 1\n12 2\n12 4\n12 8\n12 10\n13 6\n13 7\n13 9\n13 13\n13 14\n14 9\n14 10\n14 15\n15 5\n15 8\n15 10\n15 11\n15 12\n15 14\n15 15",
"output": "7\n1 1 2 1 2 3 4 5 1 2 1 2 3 1 2 1 2 2 1 3 1 2 4 5 6 2 1 3 2 3 4 1 5 3 2 4 5 6 3 4 1 2 6 3 5 1 3 6 7 2 4 1 5"
},
{
"input": "139 1000 0",
"output": "0"
},
{
"input": "139 1000 1\n75 791",
"output": "1\n1"
}
] | 1,645,556,149 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 3 | 108 | 2,252,800 | import sys, os, io
input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
def f(u, v):
return u + m * v
a, b, m = map(int, input().split())
G = [set() for _ in range(a + 1)]
H = [set() for _ in range(b + 1)]
for i in range(m):
x, y = map(int, input().split())
u = f(i, y)
v = f(i, x)
G[x].add(u)
H[y].add(v)
cx = [0] * (a + 1)
cy = [0] * (b + 1)
for i in range(1, a + 1):
cx[i] = len(G[i])
for i in range(1, b + 1):
cy[i] = len(H[i])
c = max(max(cx), max(cy))
print(c)
okx = [0] * (a + 1)
oky = [0] * (b + 1)
ans = [0] * m
while c:
for i in range(1, a + 1):
if len(G[i]) ^ c:
continue
ma, k, e = 0, -1, -1
for j in G[i]:
u = j // m
if not oky[u] ^ c:
continue
if not len(H[u]) ^ c:
k, e = u, j % m
break
elif ma < len(H[u]):
ma, k, e = len(H[u]), u, j % m
ans[e] = c
G[i].remove(f(e, k))
H[k].remove(f(e, i))
okx[i], oky[k] = c, c
for i in range(1, b + 1):
if len(H[i]) ^ c:
continue
ma, k, e = 0, -1, -1
for j in H[i]:
u = j // m
if not okx[u] ^ c:
continue
if not len(G[u]) ^ c:
k, e = u, j % m
break
elif ma < len(G[u]):
ma, k, e = len(G[u]), u, j % m
ans[e] = c
H[i].remove(f(e, k))
G[k].remove(f(e, i))
oky[i], okx[k] = c, c
c -= 1
sys.stdout.write(" ".join(map(str, ans))) | Title: Edge coloring of bipartite graph
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an undirected bipartite graph without multiple edges. You should paint the edges of graph to minimal number of colours, so that no two adjacent edges have the same colour.
Input Specification:
The first line contains three integers *a*,<=*b*,<=*m* (1<=≤<=*a*,<=*b*<=≤<=1000, 0<=≤<=*m*<=≤<=105), *a* is the size of the first part, *b* is the size of the second part, *m* is the number of edges in the graph.
Each of the next *m* lines contains two integers *x*,<=*y* (1<=≤<=*x*<=≤<=*a*,<=1<=≤<=*y*<=≤<=*b*), where *x* is the number of the vertex in the first part and *y* is the number of the vertex in the second part. It is guaranteed that there are no multiple edges.
Output Specification:
In the first line print integer *c* — the minimal number of colours. The second line should contain *m* integers from 1 to *c* — the colours of the edges (in the order they appear in the input).
If there are several solutions, you can print any one of them.
Demo Input:
['4 3 5\n1 2\n2 2\n3 2\n4 1\n4 3\n']
Demo Output:
['3\n1 2 3 1 2\n']
Note:
none | ```python
import sys, os, io
input = io.BytesIO(os.read(0, os.fstat(0).st_size)).readline
def f(u, v):
return u + m * v
a, b, m = map(int, input().split())
G = [set() for _ in range(a + 1)]
H = [set() for _ in range(b + 1)]
for i in range(m):
x, y = map(int, input().split())
u = f(i, y)
v = f(i, x)
G[x].add(u)
H[y].add(v)
cx = [0] * (a + 1)
cy = [0] * (b + 1)
for i in range(1, a + 1):
cx[i] = len(G[i])
for i in range(1, b + 1):
cy[i] = len(H[i])
c = max(max(cx), max(cy))
print(c)
okx = [0] * (a + 1)
oky = [0] * (b + 1)
ans = [0] * m
while c:
for i in range(1, a + 1):
if len(G[i]) ^ c:
continue
ma, k, e = 0, -1, -1
for j in G[i]:
u = j // m
if not oky[u] ^ c:
continue
if not len(H[u]) ^ c:
k, e = u, j % m
break
elif ma < len(H[u]):
ma, k, e = len(H[u]), u, j % m
ans[e] = c
G[i].remove(f(e, k))
H[k].remove(f(e, i))
okx[i], oky[k] = c, c
for i in range(1, b + 1):
if len(H[i]) ^ c:
continue
ma, k, e = 0, -1, -1
for j in H[i]:
u = j // m
if not okx[u] ^ c:
continue
if not len(G[u]) ^ c:
k, e = u, j % m
break
elif ma < len(G[u]):
ma, k, e = len(G[u]), u, j % m
ans[e] = c
H[i].remove(f(e, k))
G[k].remove(f(e, i))
oky[i], okx[k] = c, c
c -= 1
sys.stdout.write(" ".join(map(str, ans)))
``` | -1 |
|
478 | B | Random Teams | PROGRAMMING | 1,300 | [
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null | *n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition. | The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively. | The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively. | [
"5 1\n",
"3 2\n",
"6 3\n"
] | [
"10 10\n",
"1 1\n",
"3 6\n"
] | In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people. | 1,000 | [
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,645,490,676 | 2,147,483,647 | Python 3 | OK | TESTS | 26 | 31 | 0 | n, m = map(int, input().split())
a = n // m
b = n % m
print((m * a * (a - 1) // 2) + b * a, (n - m + 1) * (n - m) // 2)
| Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people. | ```python
n, m = map(int, input().split())
a = n // m
b = n % m
print((m * a * (a - 1) // 2) + b * a, (n - m + 1) * (n - m) // 2)
``` | 3 |
|
489 | B | BerSU Ball | PROGRAMMING | 1,200 | [
"dfs and similar",
"dp",
"graph matchings",
"greedy",
"sortings",
"two pointers"
] | null | null | The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves.
We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one.
For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill.
Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill. | Print a single number — the required maximum possible number of pairs. | [
"4\n1 4 6 2\n5\n5 1 5 7 9\n",
"4\n1 2 3 4\n4\n10 11 12 13\n",
"5\n1 1 1 1 1\n3\n1 2 3\n"
] | [
"3\n",
"0\n",
"2\n"
] | none | 1,000 | [
{
"input": "4\n1 4 6 2\n5\n5 1 5 7 9",
"output": "3"
},
{
"input": "4\n1 2 3 4\n4\n10 11 12 13",
"output": "0"
},
{
"input": "5\n1 1 1 1 1\n3\n1 2 3",
"output": "2"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 10\n1\n9",
"output": "1"
},
{
"input": "4\n4 5 4 4\n5\n5 3 4 2 4",
"output": "4"
},
{
"input": "1\n2\n1\n1",
"output": "1"
},
{
"input": "1\n3\n2\n3 2",
"output": "1"
},
{
"input": "1\n4\n3\n4 4 4",
"output": "1"
},
{
"input": "1\n2\n4\n3 1 4 2",
"output": "1"
},
{
"input": "1\n4\n5\n2 5 5 3 1",
"output": "1"
},
{
"input": "2\n2 2\n1\n2",
"output": "1"
},
{
"input": "2\n4 2\n2\n4 4",
"output": "1"
},
{
"input": "2\n4 1\n3\n2 3 2",
"output": "2"
},
{
"input": "2\n4 3\n4\n5 5 5 6",
"output": "1"
},
{
"input": "2\n5 7\n5\n4 6 7 2 5",
"output": "2"
},
{
"input": "3\n1 2 3\n1\n1",
"output": "1"
},
{
"input": "3\n5 4 5\n2\n2 1",
"output": "0"
},
{
"input": "3\n6 3 4\n3\n4 5 2",
"output": "3"
},
{
"input": "3\n7 7 7\n4\n2 7 2 4",
"output": "1"
},
{
"input": "3\n1 3 3\n5\n1 3 4 1 2",
"output": "3"
},
{
"input": "4\n1 2 1 3\n1\n4",
"output": "1"
},
{
"input": "4\n4 4 6 6\n2\n2 1",
"output": "0"
},
{
"input": "4\n3 1 1 1\n3\n1 6 7",
"output": "1"
},
{
"input": "4\n2 5 1 2\n4\n2 3 3 1",
"output": "3"
},
{
"input": "4\n9 1 7 1\n5\n9 9 9 8 4",
"output": "2"
},
{
"input": "5\n1 6 5 5 6\n1\n2",
"output": "1"
},
{
"input": "5\n5 2 4 5 6\n2\n7 4",
"output": "2"
},
{
"input": "5\n4 1 3 1 4\n3\n6 3 6",
"output": "1"
},
{
"input": "5\n5 2 3 1 4\n4\n1 3 1 7",
"output": "3"
},
{
"input": "5\n9 8 10 9 10\n5\n2 1 5 4 6",
"output": "0"
},
{
"input": "1\n48\n100\n76 90 78 44 29 30 35 85 98 38 27 71 51 100 15 98 78 45 85 26 48 66 98 71 45 85 83 77 92 17 23 95 98 43 11 15 39 53 71 25 74 53 77 41 39 35 66 4 92 44 44 55 35 87 91 6 44 46 57 24 46 82 15 44 81 40 65 17 64 24 42 52 13 12 64 82 26 7 66 85 93 89 58 92 92 77 37 91 47 73 35 69 31 22 60 60 97 21 52 6",
"output": "1"
},
{
"input": "100\n9 90 66 62 60 9 10 97 47 73 26 81 97 60 80 84 19 4 25 77 19 17 91 12 1 27 15 54 18 45 71 79 96 90 51 62 9 13 92 34 7 52 55 8 16 61 96 12 52 38 50 9 60 3 30 3 48 46 77 64 90 35 16 16 21 42 67 70 23 19 90 14 50 96 98 92 82 62 7 51 93 38 84 82 37 78 99 3 20 69 44 96 94 71 3 55 27 86 92 82\n1\n58",
"output": "0"
},
{
"input": "10\n20 87 3 39 20 20 8 40 70 51\n100\n69 84 81 84 35 97 69 68 63 97 85 80 95 58 70 91 100 65 72 80 41 87 87 87 22 49 96 96 78 96 97 56 90 31 62 98 89 74 100 86 95 88 66 54 93 62 41 60 95 79 29 69 63 70 52 63 87 58 54 52 48 57 26 75 39 61 98 78 52 73 99 49 74 50 59 90 31 97 16 85 63 72 81 68 75 59 70 67 73 92 10 88 57 95 3 71 80 95 84 96",
"output": "6"
},
{
"input": "100\n10 10 9 18 56 64 92 66 54 42 66 65 58 5 74 68 80 57 58 30 58 69 70 13 38 19 34 63 38 17 26 24 66 83 48 77 44 37 78 97 13 90 51 56 60 23 49 32 14 86 90 100 13 14 52 69 85 95 81 53 5 3 91 66 2 64 45 59 7 30 80 42 61 82 70 10 62 82 5 34 50 28 24 47 85 68 27 50 24 61 76 17 63 24 3 67 83 76 42 60\n10\n66 74 40 67 28 82 99 57 93 64",
"output": "9"
},
{
"input": "100\n4 1 1 1 3 3 2 5 1 2 1 2 1 1 1 6 1 3 1 1 1 1 2 4 1 1 4 2 2 8 2 2 1 8 2 4 3 3 8 1 3 2 3 2 1 3 8 2 2 3 1 1 2 2 5 1 4 3 1 1 3 1 3 1 7 1 1 1 3 2 1 2 2 3 7 2 1 4 3 2 1 1 3 4 1 1 3 5 1 8 4 1 1 1 3 10 2 2 1 2\n100\n1 1 5 2 13 2 2 3 6 12 1 13 8 1 1 16 1 1 5 6 2 4 6 4 2 7 4 1 7 3 3 9 5 3 1 7 4 1 6 6 8 2 2 5 2 3 16 3 6 3 8 6 1 8 1 2 6 5 3 4 11 3 4 8 2 13 2 5 2 7 3 3 1 8 1 4 4 2 4 7 7 1 5 7 6 3 6 9 1 1 1 3 1 11 5 2 5 11 13 1",
"output": "76"
},
{
"input": "4\n1 6 9 15\n2\n5 8",
"output": "2"
},
{
"input": "2\n2 4\n2\n3 1",
"output": "2"
},
{
"input": "3\n2 3 5\n3\n3 4 6",
"output": "3"
},
{
"input": "3\n1 3 4\n3\n2 1 5",
"output": "3"
},
{
"input": "2\n5 5\n4\n1 1 1 5",
"output": "1"
},
{
"input": "2\n3 2\n2\n3 4",
"output": "2"
},
{
"input": "2\n3 1\n2\n2 4",
"output": "2"
},
{
"input": "2\n2 3\n2\n2 1",
"output": "2"
},
{
"input": "2\n10 12\n2\n11 9",
"output": "2"
},
{
"input": "3\n1 2 3\n3\n3 2 1",
"output": "3"
},
{
"input": "2\n1 3\n2\n2 1",
"output": "2"
},
{
"input": "2\n4 5\n2\n5 3",
"output": "2"
},
{
"input": "2\n7 5\n2\n6 8",
"output": "2"
},
{
"input": "4\n4 3 2 1\n4\n1 2 3 4",
"output": "4"
},
{
"input": "2\n2 3\n2\n3 1",
"output": "2"
},
{
"input": "2\n2 4\n3\n3 1 8",
"output": "2"
},
{
"input": "3\n3 1 1\n3\n2 4 4",
"output": "2"
},
{
"input": "2\n5 3\n2\n4 6",
"output": "2"
},
{
"input": "4\n1 1 3 3\n4\n2 2 1 1",
"output": "4"
},
{
"input": "3\n3 2 1\n3\n2 4 3",
"output": "3"
},
{
"input": "5\n1 2 3 4 5\n5\n2 3 4 5 1",
"output": "5"
},
{
"input": "3\n3 2 1\n3\n1 2 3",
"output": "3"
},
{
"input": "2\n5 4\n2\n4 6",
"output": "2"
},
{
"input": "4\n3 3 5 5\n4\n4 4 2 2",
"output": "4"
},
{
"input": "3\n2 7 5\n3\n2 4 8",
"output": "3"
},
{
"input": "100\n2 3 3 4 2 1 4 4 5 5 2 1 5 2 3 3 5 4 3 2 4 2 3 3 2 2 3 4 2 2 2 3 1 2 3 2 2 3 5 3 3 3 3 4 5 2 2 1 1 1 3 1 2 2 3 5 5 2 5 1 3 4 5 3 5 4 1 1 2 3 4 4 5 3 2 4 5 5 5 2 1 4 2 4 5 4 4 5 5 3 2 5 1 4 4 2 2 2 5 3\n100\n4 5 3 3 2 2 4 3 1 5 4 3 3 2 2 4 5 2 5 2 1 4 3 4 2 3 5 3 4 4 1 2 3 5 2 2 1 5 4 2 4 3 4 3 4 2 3 1 3 3 4 1 1 1 4 4 5 3 1 4 2 3 2 1 3 3 2 3 2 1 1 2 3 2 1 3 3 4 3 3 1 1 3 3 3 1 1 3 5 3 3 3 3 4 4 5 2 5 4 5",
"output": "100"
},
{
"input": "1\n3\n2\n2 3",
"output": "1"
},
{
"input": "2\n5 6\n3\n1 5 100",
"output": "1"
},
{
"input": "2\n2 7\n2\n6 8",
"output": "1"
},
{
"input": "4\n4 10 15 17\n4\n3 12 16 16",
"output": "3"
},
{
"input": "2\n2 3\n2\n1 2",
"output": "2"
}
] | 1,680,144,026 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 81 | 62 | 0 | n = int(input())
b = list(map(int, input().split()))
m = int(input())
g = list(map(int, input().split()))
b.sort()
g.sort()
i = 0
j = 0
cnt = 0
while i < n and j < m:
if abs(b[i] - g[j]) <= 1:
cnt+=1
i += 1
j += 1
elif b[i] > g[j]:
j += 1
else:
# b[i] < g[j] :
i += 1
print(cnt) | Title: BerSU Ball
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Berland State University is hosting a ballroom dance in celebration of its 100500-th anniversary! *n* boys and *m* girls are already busy rehearsing waltz, minuet, polonaise and quadrille moves.
We know that several boy&girl pairs are going to be invited to the ball. However, the partners' dancing skill in each pair must differ by at most one.
For each boy, we know his dancing skills. Similarly, for each girl we know her dancing skills. Write a code that can determine the largest possible number of pairs that can be formed from *n* boys and *m* girls.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of boys. The second line contains sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is the *i*-th boy's dancing skill.
Similarly, the third line contains an integer *m* (1<=≤<=*m*<=≤<=100) — the number of girls. The fourth line contains sequence *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**j*<=≤<=100), where *b**j* is the *j*-th girl's dancing skill.
Output Specification:
Print a single number — the required maximum possible number of pairs.
Demo Input:
['4\n1 4 6 2\n5\n5 1 5 7 9\n', '4\n1 2 3 4\n4\n10 11 12 13\n', '5\n1 1 1 1 1\n3\n1 2 3\n']
Demo Output:
['3\n', '0\n', '2\n']
Note:
none | ```python
n = int(input())
b = list(map(int, input().split()))
m = int(input())
g = list(map(int, input().split()))
b.sort()
g.sort()
i = 0
j = 0
cnt = 0
while i < n and j < m:
if abs(b[i] - g[j]) <= 1:
cnt+=1
i += 1
j += 1
elif b[i] > g[j]:
j += 1
else:
# b[i] < g[j] :
i += 1
print(cnt)
``` | 3 |
|
909 | C | Python Indentation | PROGRAMMING | 1,800 | [
"dp"
] | null | null | In Python, code blocks don't have explicit begin/end or curly braces to mark beginning and end of the block. Instead, code blocks are defined by indentation.
We will consider an extremely simplified subset of Python with only two types of statements.
Simple statements are written in a single line, one per line. An example of a simple statement is assignment.
For statements are compound statements: they contain one or several other statements. For statement consists of a header written in a separate line which starts with "for" prefix, and loop body. Loop body is a block of statements indented one level further than the header of the loop. Loop body can contain both types of statements. Loop body can't be empty.
You are given a sequence of statements without indentation. Find the number of ways in which the statements can be indented to form a valid Python program. | The first line contains a single integer *N* (1<=≤<=*N*<=≤<=5000) — the number of commands in the program. *N* lines of the program follow, each line describing a single command. Each command is either "f" (denoting "for statement") or "s" ("simple statement"). It is guaranteed that the last line is a simple statement. | Output one line containing an integer - the number of ways the given sequence of statements can be indented modulo 109<=+<=7. | [
"4\ns\nf\nf\ns\n",
"4\nf\ns\nf\ns\n"
] | [
"1\n",
"2\n"
] | In the first test case, there is only one way to indent the program: the second for statement must be part of the body of the first one.
In the second test case, there are two ways to indent the program: the second for statement can either be part of the first one's body or a separate statement following the first one.
or | 1,500 | [
{
"input": "4\ns\nf\nf\ns",
"output": "1"
},
{
"input": "4\nf\ns\nf\ns",
"output": "2"
},
{
"input": "156\nf\ns\nf\ns\nf\ns\ns\ns\ns\nf\ns\ns\nf\nf\ns\nf\nf\nf\nf\ns\ns\ns\nf\ns\ns\nf\nf\nf\nf\nf\nf\ns\ns\ns\ns\nf\ns\nf\ns\nf\ns\nf\nf\nf\nf\ns\ns\nf\nf\ns\ns\ns\ns\nf\ns\nf\ns\nf\ns\nf\ns\ns\ns\nf\ns\ns\nf\ns\nf\nf\ns\ns\ns\nf\nf\nf\nf\ns\ns\nf\nf\nf\nf\nf\nf\nf\ns\nf\ns\ns\ns\nf\nf\ns\ns\ns\ns\ns\nf\nf\nf\nf\ns\nf\nf\ns\nf\ns\ns\nf\nf\nf\ns\ns\ns\nf\ns\ns\nf\ns\nf\nf\nf\ns\nf\nf\ns\ns\nf\ns\nf\nf\ns\ns\ns\ns\nf\ns\nf\nf\ns\ns\nf\nf\nf\ns\ns\nf\nf\nf\ns\nf\ns\nf\nf\ns",
"output": "666443222"
},
{
"input": "4\nf\nf\ns\ns",
"output": "3"
},
{
"input": "2\nf\ns",
"output": "1"
},
{
"input": "1\ns",
"output": "1"
},
{
"input": "3\nf\nf\ns",
"output": "1"
},
{
"input": "2\ns\ns",
"output": "1"
},
{
"input": "156\ns\nf\ns\ns\ns\ns\nf\ns\ns\ns\nf\nf\ns\nf\nf\ns\nf\nf\nf\ns\nf\nf\ns\nf\nf\ns\ns\nf\nf\ns\nf\nf\nf\nf\nf\ns\ns\nf\ns\nf\nf\nf\ns\nf\nf\nf\ns\ns\ns\nf\ns\ns\nf\nf\ns\ns\nf\ns\nf\nf\ns\nf\nf\nf\ns\ns\nf\nf\ns\nf\ns\ns\ns\ns\ns\ns\ns\nf\ns\nf\nf\nf\ns\ns\ns\ns\nf\nf\ns\nf\nf\ns\ns\nf\ns\nf\ns\ns\nf\nf\nf\nf\nf\ns\nf\ns\ns\nf\nf\ns\nf\nf\ns\ns\ns\nf\ns\ns\ns\ns\nf\nf\ns\nf\nf\nf\nf\ns\nf\ns\ns\nf\nf\ns\nf\ns\nf\nf\nf\nf\ns\ns\nf\nf\nf\nf\ns\nf\ns\nf\ns\ns\ns\nf\nf\ns",
"output": "479461584"
},
{
"input": "66\ns\nf\ns\ns\nf\ns\ns\ns\ns\nf\ns\ns\nf\nf\ns\ns\nf\ns\ns\nf\ns\ns\nf\nf\ns\ns\nf\nf\ns\ns\nf\ns\ns\ns\ns\nf\nf\ns\ns\nf\nf\ns\ns\nf\ns\ns\nf\ns\ns\nf\ns\ns\nf\nf\ns\nf\ns\ns\nf\nf\ns\nf\ns\nf\nf\ns",
"output": "392847498"
}
] | 1,594,856,744 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 108 | 20,172,800 | n=int(input())
b=[]
for j in range(n):
b.append(input())
ans=1
j=0
res=0
p=10**9+7
dp=[[0]*(n) for i in range(n)]
dp[0][0]=1
j=1
while(j<n):
if b[j-1]=="f":
dp[j][0]=0
for i in range(1,n):
dp[j][i]=dp[j-1][i-1]
else:
q=sum(dp[j-1])
for i in range(n):
dp[j][i] = q
q-=dp[j-1][i]
j+=1
print(dp)
print(sum(dp[n-1])%p)
| Title: Python Indentation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Python, code blocks don't have explicit begin/end or curly braces to mark beginning and end of the block. Instead, code blocks are defined by indentation.
We will consider an extremely simplified subset of Python with only two types of statements.
Simple statements are written in a single line, one per line. An example of a simple statement is assignment.
For statements are compound statements: they contain one or several other statements. For statement consists of a header written in a separate line which starts with "for" prefix, and loop body. Loop body is a block of statements indented one level further than the header of the loop. Loop body can contain both types of statements. Loop body can't be empty.
You are given a sequence of statements without indentation. Find the number of ways in which the statements can be indented to form a valid Python program.
Input Specification:
The first line contains a single integer *N* (1<=≤<=*N*<=≤<=5000) — the number of commands in the program. *N* lines of the program follow, each line describing a single command. Each command is either "f" (denoting "for statement") or "s" ("simple statement"). It is guaranteed that the last line is a simple statement.
Output Specification:
Output one line containing an integer - the number of ways the given sequence of statements can be indented modulo 109<=+<=7.
Demo Input:
['4\ns\nf\nf\ns\n', '4\nf\ns\nf\ns\n']
Demo Output:
['1\n', '2\n']
Note:
In the first test case, there is only one way to indent the program: the second for statement must be part of the body of the first one.
In the second test case, there are two ways to indent the program: the second for statement can either be part of the first one's body or a separate statement following the first one.
or | ```python
n=int(input())
b=[]
for j in range(n):
b.append(input())
ans=1
j=0
res=0
p=10**9+7
dp=[[0]*(n) for i in range(n)]
dp[0][0]=1
j=1
while(j<n):
if b[j-1]=="f":
dp[j][0]=0
for i in range(1,n):
dp[j][i]=dp[j-1][i-1]
else:
q=sum(dp[j-1])
for i in range(n):
dp[j][i] = q
q-=dp[j-1][i]
j+=1
print(dp)
print(sum(dp[n-1])%p)
``` | 0 |
|
165 | A | Supercentral Point | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*):
- point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=><=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=<<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=<<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=><=*y*
We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points.
Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set. | The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different. | Print the only number — the number of supercentral points of the given set. | [
"8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n",
"5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n"
] | [
"2\n",
"1\n"
] | In the first sample the supercentral points are only points (1, 1) and (1, 2).
In the second sample there is one supercental point — point (0, 0). | 500 | [
{
"input": "8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3",
"output": "2"
},
{
"input": "5\n0 0\n0 1\n1 0\n0 -1\n-1 0",
"output": "1"
},
{
"input": "9\n-565 -752\n-184 723\n-184 -752\n-184 1\n950 723\n-565 723\n950 -752\n950 1\n-565 1",
"output": "1"
},
{
"input": "25\n-651 897\n916 897\n-651 -808\n-748 301\n-734 414\n-651 -973\n-734 897\n916 -550\n-758 414\n916 180\n-758 -808\n-758 -973\n125 -550\n125 -973\n125 301\n916 414\n-748 -808\n-651 301\n-734 301\n-307 897\n-651 -550\n-651 414\n125 -808\n-748 -550\n916 -808",
"output": "7"
},
{
"input": "1\n487 550",
"output": "0"
},
{
"input": "10\n990 -396\n990 736\n990 646\n990 -102\n990 -570\n990 155\n990 528\n990 489\n990 268\n990 676",
"output": "0"
},
{
"input": "30\n507 836\n525 836\n-779 196\n507 -814\n525 -814\n525 42\n525 196\n525 -136\n-779 311\n507 -360\n525 300\n507 578\n507 311\n-779 836\n507 300\n525 -360\n525 311\n-779 -360\n-779 578\n-779 300\n507 42\n525 578\n-779 379\n507 196\n525 379\n507 379\n-779 -814\n-779 42\n-779 -136\n507 -136",
"output": "8"
},
{
"input": "25\n890 -756\n890 -188\n-37 -756\n-37 853\n523 998\n-261 853\n-351 853\n-351 -188\n523 -756\n-261 -188\n-37 998\n523 -212\n-351 998\n-37 -188\n-351 -756\n-37 -212\n890 998\n890 -212\n523 853\n-351 -212\n-261 -212\n-261 998\n-261 -756\n890 853\n523 -188",
"output": "9"
},
{
"input": "21\n-813 -11\n486 254\n685 254\n-708 254\n-55 -11\n-671 -191\n486 -11\n-671 -11\n685 -11\n685 -191\n486 -191\n-55 254\n-708 -11\n-813 254\n-708 -191\n41 -11\n-671 254\n-813 -191\n41 254\n-55 -191\n41 -191",
"output": "5"
},
{
"input": "4\n1 0\n2 0\n1 1\n1 -1",
"output": "0"
}
] | 1,620,750,670 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 216 | 21,504,000 | n = int(input())
l=[]
count=0
for i in range(n):
xy = list(map(int , input().split()))
l.append(xy)
def isRight(a,b):
for i in range(1,1001):
if([a+i,b] in l):
return True
return False
def isleft(a,b):
for i in range(1,1001):
if([a-i,b] in l):
return True
return False
def isup(a,b):
for i in range(1,1001):
if([a,b+i] in l):
return True
return False
def isDown(a,b):
for i in range(1,1001):
if([a,b-i] in l):
return True
return False
for i in l:
if(isRight(i[0], i[1]) and isDown(i[0], i[1]) and isleft(i[0], i[1]) and isup(i[0], i[1]) ):
count+=1
print(count)
| Title: Supercentral Point
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya painted a Cartesian coordinate system on a piece of paper and marked some set of points (*x*1,<=*y*1),<=(*x*2,<=*y*2),<=...,<=(*x**n*,<=*y**n*). Let's define neighbors for some fixed point from the given set (*x*,<=*y*):
- point (*x*',<=*y*') is (*x*,<=*y*)'s right neighbor, if *x*'<=><=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s left neighbor, if *x*'<=<<=*x* and *y*'<==<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s lower neighbor, if *x*'<==<=*x* and *y*'<=<<=*y* - point (*x*',<=*y*') is (*x*,<=*y*)'s upper neighbor, if *x*'<==<=*x* and *y*'<=><=*y*
We'll consider point (*x*,<=*y*) from the given set supercentral, if it has at least one upper, at least one lower, at least one left and at least one right neighbor among this set's points.
Vasya marked quite many points on the paper. Analyzing the picture manually is rather a challenge, so Vasya asked you to help him. Your task is to find the number of supercentral points in the given set.
Input Specification:
The first input line contains the only integer *n* (1<=≤<=*n*<=≤<=200) — the number of points in the given set. Next *n* lines contain the coordinates of the points written as "*x* *y*" (without the quotes) (|*x*|,<=|*y*|<=≤<=1000), all coordinates are integers. The numbers in the line are separated by exactly one space. It is guaranteed that all points are different.
Output Specification:
Print the only number — the number of supercentral points of the given set.
Demo Input:
['8\n1 1\n4 2\n3 1\n1 2\n0 2\n0 1\n1 0\n1 3\n', '5\n0 0\n0 1\n1 0\n0 -1\n-1 0\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the supercentral points are only points (1, 1) and (1, 2).
In the second sample there is one supercental point — point (0, 0). | ```python
n = int(input())
l=[]
count=0
for i in range(n):
xy = list(map(int , input().split()))
l.append(xy)
def isRight(a,b):
for i in range(1,1001):
if([a+i,b] in l):
return True
return False
def isleft(a,b):
for i in range(1,1001):
if([a-i,b] in l):
return True
return False
def isup(a,b):
for i in range(1,1001):
if([a,b+i] in l):
return True
return False
def isDown(a,b):
for i in range(1,1001):
if([a,b-i] in l):
return True
return False
for i in l:
if(isRight(i[0], i[1]) and isDown(i[0], i[1]) and isleft(i[0], i[1]) and isup(i[0], i[1]) ):
count+=1
print(count)
``` | 0 |
|
331 | C1 | The Great Julya Calendar | PROGRAMMING | 1,100 | [
"dp"
] | null | null | Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero. | The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3). | Print a single integer — the minimum number of subtractions that turns the magic number to a zero. | [
"24\n"
] | [
"5"
] | In the first test sample the minimum number of operations can be reached by the following sequence of subtractions: | 20 | [
{
"input": "24",
"output": "5"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "1"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "10",
"output": "2"
},
{
"input": "31",
"output": "6"
},
{
"input": "701",
"output": "116"
},
{
"input": "222",
"output": "39"
},
{
"input": "156",
"output": "28"
},
{
"input": "12343",
"output": "1778"
},
{
"input": "7984",
"output": "1178"
},
{
"input": "1000000",
"output": "128207"
},
{
"input": "1",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "1"
},
{
"input": "11",
"output": "3"
},
{
"input": "77",
"output": "14"
},
{
"input": "216",
"output": "37"
},
{
"input": "1468",
"output": "233"
},
{
"input": "1995",
"output": "305"
},
{
"input": "11010",
"output": "1568"
},
{
"input": "47320",
"output": "6746"
},
{
"input": "258634",
"output": "35024"
}
] | 1,625,553,881 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS1 | 0 | 2,000 | 12,800,000 | def get_digits(x):
return set(map(int, str(x).replace("0", "")))
N = int(input())
MAX = int(1e6)
dp = [0]*MAX
for i in range(1, 10):
dp[i] = 1
for i in range(10, MAX):
digits = get_digits(i)
dp[i] = 1+min([dp[i - digit] for digit in digits])
print(dp[N]) | Title: The Great Julya Calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
Input Specification:
The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
Output Specification:
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
Demo Input:
['24\n']
Demo Output:
['5']
Note:
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions: | ```python
def get_digits(x):
return set(map(int, str(x).replace("0", "")))
N = int(input())
MAX = int(1e6)
dp = [0]*MAX
for i in range(1, 10):
dp[i] = 1
for i in range(10, MAX):
digits = get_digits(i)
dp[i] = 1+min([dp[i - digit] for digit in digits])
print(dp[N])
``` | 0 |
|
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,695,171,907 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 92 | 0 | enter=input()
upper=0
for x in enter:
if x==x.upper():
upper=upper+1
two=len(enter)/2
if upper>two:
enter=enter.upper()
print(enter)
else:
enter=enter.lower()
print(enter) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
enter=input()
upper=0
for x in enter:
if x==x.upper():
upper=upper+1
two=len(enter)/2
if upper>two:
enter=enter.upper()
print(enter)
else:
enter=enter.lower()
print(enter)
``` | 3.977 |
0 | none | none | none | 0 | [
"none"
] | null | null | It's another Start[c]up finals, and that means there is pizza to order for the onsite contestants. There are only 2 types of pizza (obviously not, but let's just pretend for the sake of the problem), and all pizzas contain exactly *S* slices.
It is known that the *i*-th contestant will eat *s**i* slices of pizza, and gain *a**i* happiness for each slice of type 1 pizza they eat, and *b**i* happiness for each slice of type 2 pizza they eat. We can order any number of type 1 and type 2 pizzas, but we want to buy the minimum possible number of pizzas for all of the contestants to be able to eat their required number of slices. Given that restriction, what is the maximum possible total happiness that can be achieved? | The first line of input will contain integers *N* and *S* (1<=≤<=*N*<=≤<=105,<=1<=≤<=*S*<=≤<=105), the number of contestants and the number of slices per pizza, respectively. *N* lines follow.
The *i*-th such line contains integers *s**i*, *a**i*, and *b**i* (1<=≤<=*s**i*<=≤<=105,<=1<=≤<=*a**i*<=≤<=105,<=1<=≤<=*b**i*<=≤<=105), the number of slices the *i*-th contestant will eat, the happiness they will gain from each type 1 slice they eat, and the happiness they will gain from each type 2 slice they eat, respectively. | Print the maximum total happiness that can be achieved. | [
"3 12\n3 5 7\n4 6 7\n5 9 5\n",
"6 10\n7 4 7\n5 8 8\n12 5 8\n6 11 6\n3 3 7\n5 9 6\n"
] | [
"84\n",
"314\n"
] | In the first example, you only need to buy one pizza. If you buy a type 1 pizza, the total happiness will be 3·5 + 4·6 + 5·9 = 84, and if you buy a type 2 pizza, the total happiness will be 3·7 + 4·7 + 5·5 = 74. | 0 | [
{
"input": "3 12\n3 5 7\n4 6 7\n5 9 5",
"output": "84"
},
{
"input": "6 10\n7 4 7\n5 8 8\n12 5 8\n6 11 6\n3 3 7\n5 9 6",
"output": "314"
},
{
"input": "1 100\n97065 97644 98402",
"output": "9551390130"
},
{
"input": "1 100000\n1 82372 5587",
"output": "82372"
},
{
"input": "25 6\n1 10 5\n1 8 4\n1 8 2\n4 8 9\n3 2 8\n1 9 5\n2 10 10\n3 9 6\n3 5 4\n2 7 8\n2 3 2\n2 6 8\n3 7 8\n4 3 7\n1 8 1\n3 6 4\n3 2 8\n2 2 1\n4 8 8\n4 8 4\n3 10 2\n3 6 6\n2 2 5\n1 6 2\n4 1 5",
"output": "449"
},
{
"input": "3 10\n10 3 4\n5 1 100\n5 100 1",
"output": "1035"
},
{
"input": "3 3\n6 5 6\n2 5 4\n2 4 5",
"output": "56"
},
{
"input": "3 5\n6 4 5\n6 5 5\n8 7 5",
"output": "116"
},
{
"input": "3 5\n2 7 4\n6 5 9\n6 5 6",
"output": "102"
},
{
"input": "2 100000\n50000 1 100000\n50000 100000 1",
"output": "5000050000"
},
{
"input": "2 9\n6 1 7\n6 7 1",
"output": "84"
},
{
"input": "10 8\n7 1 4\n4 8 9\n3 4 10\n5 5 9\n1 5 6\n1 8 5\n5 7 4\n5 4 6\n10 5 7\n9 7 3",
"output": "351"
},
{
"input": "2 10\n7 2 1\n7 1 2",
"output": "28"
},
{
"input": "2 3\n5 10 5\n5 5 10",
"output": "100"
},
{
"input": "2 3\n5 5 10\n5 10 5",
"output": "100"
},
{
"input": "2 3\n2 10 1\n2 1 10",
"output": "40"
},
{
"input": "2 10\n9 1 2\n9 2 1",
"output": "36"
},
{
"input": "3 4\n2 1 10\n1 2 1\n1 3 1",
"output": "22"
}
] | 1,694,378,060 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 102,400 | def max_happiness(N, S, player_info):
pizzas_a = []
pizzas_b = []
total_slices = 0
for slices, hap_a, hap_b in player_info:
total_slices += slices
if hap_a > hap_b:
pizzas_a.append((hap_a - hap_b, slices))
else:
pizzas_b.append((hap_b - hap_a, slices))
pizzas_a.sort()
pizzas_b.sort()
slices_a = total_slices % S
slices_b = 0
if slices_a > 0:
slices_b = S - slices_a
while pizzas_a and slices_a > pizzas_a[-1][1]:
_, slices = pizzas_a.pop()
slices_a -= slices
while pizzas_b and slices_b > pizzas_b[-1][1]:
_, slices = pizzas_b.pop()
slices_b -= slices
happiness = 0
if slices_a and slices_b and pizzas_a and pizzas_b and pizzas_a[-1][0] + pizzas_b[-1][0] > S:
a = (pizzas_a[-1][0] * slices_a +
sum(slices for _, slices in pizzas_a) * S +
sum((h_diff + S) * slices for h_diff, slices in pizzas_b[:-1]) +
(pizzas_b[-1][0] - S) * (pizzas_b[-1][1] - slices_b))
b = (pizzas_b[-1][0] * slices_b +
sum(slices for _, slices in pizzas_b) * S +
sum((h_diff + S) * slices for h_diff, slices in pizzas_a[:-1]) +
(pizzas_a[-1][0] - S) * (pizzas_a[-1][1] - slices_a))
happiness = max(a, b)
else:
pizzas_a.append((0, slices_a))
pizzas_b.append((0, slices_b))
happiness = (
sum((h_diff + S) * slices for h_diff, slices in pizzas_a) +
sum((h_diff + S) * slices for h_diff, slices in pizzas_b))
return happiness // S
N, S = map(int, input().split())
player_info = [tuple(map(int, input().split())) for _ in range(N)]
print(max_happiness(N, S, player_info)) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's another Start[c]up finals, and that means there is pizza to order for the onsite contestants. There are only 2 types of pizza (obviously not, but let's just pretend for the sake of the problem), and all pizzas contain exactly *S* slices.
It is known that the *i*-th contestant will eat *s**i* slices of pizza, and gain *a**i* happiness for each slice of type 1 pizza they eat, and *b**i* happiness for each slice of type 2 pizza they eat. We can order any number of type 1 and type 2 pizzas, but we want to buy the minimum possible number of pizzas for all of the contestants to be able to eat their required number of slices. Given that restriction, what is the maximum possible total happiness that can be achieved?
Input Specification:
The first line of input will contain integers *N* and *S* (1<=≤<=*N*<=≤<=105,<=1<=≤<=*S*<=≤<=105), the number of contestants and the number of slices per pizza, respectively. *N* lines follow.
The *i*-th such line contains integers *s**i*, *a**i*, and *b**i* (1<=≤<=*s**i*<=≤<=105,<=1<=≤<=*a**i*<=≤<=105,<=1<=≤<=*b**i*<=≤<=105), the number of slices the *i*-th contestant will eat, the happiness they will gain from each type 1 slice they eat, and the happiness they will gain from each type 2 slice they eat, respectively.
Output Specification:
Print the maximum total happiness that can be achieved.
Demo Input:
['3 12\n3 5 7\n4 6 7\n5 9 5\n', '6 10\n7 4 7\n5 8 8\n12 5 8\n6 11 6\n3 3 7\n5 9 6\n']
Demo Output:
['84\n', '314\n']
Note:
In the first example, you only need to buy one pizza. If you buy a type 1 pizza, the total happiness will be 3·5 + 4·6 + 5·9 = 84, and if you buy a type 2 pizza, the total happiness will be 3·7 + 4·7 + 5·5 = 74. | ```python
def max_happiness(N, S, player_info):
pizzas_a = []
pizzas_b = []
total_slices = 0
for slices, hap_a, hap_b in player_info:
total_slices += slices
if hap_a > hap_b:
pizzas_a.append((hap_a - hap_b, slices))
else:
pizzas_b.append((hap_b - hap_a, slices))
pizzas_a.sort()
pizzas_b.sort()
slices_a = total_slices % S
slices_b = 0
if slices_a > 0:
slices_b = S - slices_a
while pizzas_a and slices_a > pizzas_a[-1][1]:
_, slices = pizzas_a.pop()
slices_a -= slices
while pizzas_b and slices_b > pizzas_b[-1][1]:
_, slices = pizzas_b.pop()
slices_b -= slices
happiness = 0
if slices_a and slices_b and pizzas_a and pizzas_b and pizzas_a[-1][0] + pizzas_b[-1][0] > S:
a = (pizzas_a[-1][0] * slices_a +
sum(slices for _, slices in pizzas_a) * S +
sum((h_diff + S) * slices for h_diff, slices in pizzas_b[:-1]) +
(pizzas_b[-1][0] - S) * (pizzas_b[-1][1] - slices_b))
b = (pizzas_b[-1][0] * slices_b +
sum(slices for _, slices in pizzas_b) * S +
sum((h_diff + S) * slices for h_diff, slices in pizzas_a[:-1]) +
(pizzas_a[-1][0] - S) * (pizzas_a[-1][1] - slices_a))
happiness = max(a, b)
else:
pizzas_a.append((0, slices_a))
pizzas_b.append((0, slices_b))
happiness = (
sum((h_diff + S) * slices for h_diff, slices in pizzas_a) +
sum((h_diff + S) * slices for h_diff, slices in pizzas_b))
return happiness // S
N, S = map(int, input().split())
player_info = [tuple(map(int, input().split())) for _ in range(N)]
print(max_happiness(N, S, player_info))
``` | 0 |
|
43 | A | Football | PROGRAMMING | 1,000 | [
"strings"
] | A. Football | 2 | 256 | One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. | Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. | [
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] | [
"ABC\n",
"A\n"
] | none | 500 | [
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,665,232,633 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 92 | 0 |
n=int(input())
a=[]
for i in range(n):
a.append(input())
count=0
for s in range(n):
if a[s]==a[0]:
count+=1
else:
b=a[s]
if count>len(a)/2:
print(a[0])
else:
print(b)
| Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none | ```python
n=int(input())
a=[]
for i in range(n):
a.append(input())
count=0
for s in range(n):
if a[s]==a[0]:
count+=1
else:
b=a[s]
if count>len(a)/2:
print(a[0])
else:
print(b)
``` | 3.977 |
363 | B | Fence | PROGRAMMING | 1,100 | [
"brute force",
"dp"
] | null | null | There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic). | The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence. | Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them. | [
"7 3\n1 2 6 1 1 7 1\n"
] | [
"3\n"
] | In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8. | 1,000 | [
{
"input": "7 3\n1 2 6 1 1 7 1",
"output": "3"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "2 1\n10 20",
"output": "1"
},
{
"input": "10 5\n1 2 3 1 2 2 3 1 4 5",
"output": "1"
},
{
"input": "10 2\n3 1 4 1 4 6 2 1 4 6",
"output": "7"
},
{
"input": "2 2\n20 10",
"output": "1"
},
{
"input": "2 1\n20 1",
"output": "2"
},
{
"input": "3 1\n1 2 3",
"output": "1"
},
{
"input": "3 1\n2 1 3",
"output": "2"
},
{
"input": "3 1\n3 2 1",
"output": "3"
},
{
"input": "3 2\n1 2 3",
"output": "1"
},
{
"input": "3 2\n3 2 1",
"output": "2"
},
{
"input": "3 3\n1 2 3",
"output": "1"
},
{
"input": "4 2\n9 8 11 7",
"output": "1"
},
{
"input": "4 2\n10 1 2 3",
"output": "2"
},
{
"input": "6 3\n56 56 56 2 1 2",
"output": "4"
},
{
"input": "8 3\n1 1 1 1 2 60 90 1",
"output": "1"
},
{
"input": "4 1\n1 5 2 2",
"output": "1"
},
{
"input": "4 2\n4 6 7 4",
"output": "1"
},
{
"input": "10 4\n1 1 1 4 4 4 4 4 4 3",
"output": "1"
},
{
"input": "6 3\n1 2 1 3 1 1",
"output": "1"
},
{
"input": "5 2\n100 100 100 1 1",
"output": "4"
}
] | 1,695,670,266 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 6 | 1,000 | 24,883,200 | n, k = map(int, input().split())
l = list(map(int, input().split()))
dp = [0] * (n-k+1)
dp[0] = sum(l[:k])
for i in range(1,n-k+1):
dp[i] = sum(l[i:k+i])
print(dp.index(min(dp))+1) | Title: Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
Input Specification:
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
Output Specification:
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
Demo Input:
['7 3\n1 2 6 1 1 7 1\n']
Demo Output:
['3\n']
Note:
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8. | ```python
n, k = map(int, input().split())
l = list(map(int, input().split()))
dp = [0] * (n-k+1)
dp[0] = sum(l[:k])
for i in range(1,n-k+1):
dp[i] = sum(l[i:k+i])
print(dp.index(min(dp))+1)
``` | 0 |
|
139 | A | Petr and Book | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book. | The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero. | Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday. | [
"100\n15 20 20 15 10 30 45\n",
"2\n1 0 0 0 0 0 0\n"
] | [
"6\n",
"1\n"
] | Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book. | 500 | [
{
"input": "100\n15 20 20 15 10 30 45",
"output": "6"
},
{
"input": "2\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100\n100 200 100 200 300 400 500",
"output": "1"
},
{
"input": "3\n1 1 1 1 1 1 1",
"output": "3"
},
{
"input": "1\n1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "20\n5 3 7 2 1 6 4",
"output": "6"
},
{
"input": "10\n5 1 1 1 1 1 5",
"output": "6"
},
{
"input": "50\n10 1 10 1 10 1 10",
"output": "1"
},
{
"input": "77\n11 11 11 11 11 11 10",
"output": "1"
},
{
"input": "1\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n100 100 100 100 100 100 100",
"output": "3"
},
{
"input": "999\n10 20 10 20 30 20 10",
"output": "3"
},
{
"input": "433\n109 58 77 10 39 125 15",
"output": "7"
},
{
"input": "1\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n1 0 1 0 1 0 1",
"output": "1"
},
{
"input": "997\n1 1 0 0 1 0 1",
"output": "1"
},
{
"input": "1000\n1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1000\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "1000\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "1000\n1 0 0 1 0 0 1",
"output": "1"
},
{
"input": "509\n105 23 98 0 7 0 155",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "2\n1 1 0 0 0 0 0",
"output": "2"
},
{
"input": "1\n0 0 0 0 0 1 0",
"output": "6"
},
{
"input": "10\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 6 0",
"output": "6"
},
{
"input": "3\n0 1 0 0 0 0 0",
"output": "2"
},
{
"input": "10\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "28\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "100\n5 5 5 5 5 5 5",
"output": "6"
},
{
"input": "4\n1 0 0 0 0 0 1",
"output": "7"
},
{
"input": "2\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "7\n0 0 0 0 0 0 7",
"output": "7"
},
{
"input": "7\n2 1 1 1 1 1 0",
"output": "6"
},
{
"input": "2\n0 0 1 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1 0",
"output": "6"
},
{
"input": "5\n1 1 1 0 0 1 1",
"output": "7"
},
{
"input": "100\n10 20 30 10 10 10 10",
"output": "7"
},
{
"input": "1\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "70\n10 10 10 10 10 10 10",
"output": "7"
},
{
"input": "22\n1 2 3 4 5 6 10",
"output": "7"
},
{
"input": "5\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "2\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 0 0 0 0 0 2",
"output": "7"
},
{
"input": "10\n1 2 2 1 2 1 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "4\n0 1 1 0 0 0 0",
"output": "3"
},
{
"input": "100\n0 0 0 0 0 1 0",
"output": "6"
}
] | 1,654,577,592 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 62 | 0 | n = int(input())
lis = list(map(int,input().split()))
temp = n
res = 0
while(n>0):
res = res%6
n-=lis[res]
res+=1
print(res)
| Title: Petr and Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
Input Specification:
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
Output Specification:
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
Demo Input:
['100\n15 20 20 15 10 30 45\n', '2\n1 0 0 0 0 0 0\n']
Demo Output:
['6\n', '1\n']
Note:
Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book. | ```python
n = int(input())
lis = list(map(int,input().split()))
temp = n
res = 0
while(n>0):
res = res%6
n-=lis[res]
res+=1
print(res)
``` | 0 |
|
124 | A | The number of positions | PROGRAMMING | 1,000 | [
"math"
] | null | null | Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy. | The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100). | Print the single number — the number of the sought positions. | [
"3 1 1\n",
"5 2 3\n"
] | [
"2\n",
"3\n"
] | The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5. | 500 | [
{
"input": "3 1 1",
"output": "2"
},
{
"input": "5 2 3",
"output": "3"
},
{
"input": "5 4 0",
"output": "1"
},
{
"input": "6 5 5",
"output": "1"
},
{
"input": "9 4 3",
"output": "4"
},
{
"input": "11 4 6",
"output": "7"
},
{
"input": "13 8 7",
"output": "5"
},
{
"input": "14 5 5",
"output": "6"
},
{
"input": "16 6 9",
"output": "10"
},
{
"input": "20 13 17",
"output": "7"
},
{
"input": "22 4 8",
"output": "9"
},
{
"input": "23 8 14",
"output": "15"
},
{
"input": "26 18 22",
"output": "8"
},
{
"input": "28 6 1",
"output": "2"
},
{
"input": "29 5 23",
"output": "24"
},
{
"input": "32 27 15",
"output": "5"
},
{
"input": "33 11 5",
"output": "6"
},
{
"input": "37 21 15",
"output": "16"
},
{
"input": "39 34 33",
"output": "5"
},
{
"input": "41 27 11",
"output": "12"
},
{
"input": "42 25 16",
"output": "17"
},
{
"input": "45 7 43",
"output": "38"
},
{
"input": "47 16 17",
"output": "18"
},
{
"input": "49 11 37",
"output": "38"
},
{
"input": "51 38 39",
"output": "13"
},
{
"input": "52 29 7",
"output": "8"
},
{
"input": "56 43 12",
"output": "13"
},
{
"input": "58 57 28",
"output": "1"
},
{
"input": "59 12 39",
"output": "40"
},
{
"input": "62 9 52",
"output": "53"
},
{
"input": "63 29 44",
"output": "34"
},
{
"input": "65 30 22",
"output": "23"
},
{
"input": "66 27 38",
"output": "39"
},
{
"input": "71 33 53",
"output": "38"
},
{
"input": "73 14 12",
"output": "13"
},
{
"input": "73 37 35",
"output": "36"
},
{
"input": "76 69 44",
"output": "7"
},
{
"input": "79 25 20",
"output": "21"
},
{
"input": "81 60 20",
"output": "21"
},
{
"input": "81 79 14",
"output": "2"
},
{
"input": "84 0 42",
"output": "43"
},
{
"input": "88 79 8",
"output": "9"
},
{
"input": "90 76 59",
"output": "14"
},
{
"input": "92 2 22",
"output": "23"
},
{
"input": "94 5 88",
"output": "89"
},
{
"input": "94 62 48",
"output": "32"
},
{
"input": "96 22 72",
"output": "73"
},
{
"input": "100 11 88",
"output": "89"
},
{
"input": "100 81 91",
"output": "19"
},
{
"input": "1 0 0",
"output": "1"
}
] | 1,643,786,900 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 92 | 0 | a=[int(s) for s in input().split()]
print(max(a)-min(a)) | Title: The number of positions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
Input Specification:
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
Output Specification:
Print the single number — the number of the sought positions.
Demo Input:
['3 1 1\n', '5 2 3\n']
Demo Output:
['2\n', '3\n']
Note:
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5. | ```python
a=[int(s) for s in input().split()]
print(max(a)-min(a))
``` | 0 |
|
753 | A | Santa Claus and Candies | PROGRAMMING | 1,000 | [
"dp",
"greedy",
"math"
] | null | null | Santa Claus has *n* candies, he dreams to give them as gifts to children.
What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has. | The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has. | Print to the first line integer number *k* — maximal number of kids which can get candies.
Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*.
If there are many solutions, print any of them. | [
"5\n",
"9\n",
"2\n"
] | [
"2\n2 3\n",
"3\n3 5 1\n",
"1\n2 \n"
] | none | 500 | [
{
"input": "5",
"output": "2\n1 4 "
},
{
"input": "9",
"output": "3\n1 2 6 "
},
{
"input": "2",
"output": "1\n2 "
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "3",
"output": "2\n1 2 "
},
{
"input": "1000",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 54 "
},
{
"input": "4",
"output": "2\n1 3 "
},
{
"input": "6",
"output": "3\n1 2 3 "
},
{
"input": "7",
"output": "3\n1 2 4 "
},
{
"input": "8",
"output": "3\n1 2 5 "
},
{
"input": "10",
"output": "4\n1 2 3 4 "
},
{
"input": "11",
"output": "4\n1 2 3 5 "
},
{
"input": "12",
"output": "4\n1 2 3 6 "
},
{
"input": "13",
"output": "4\n1 2 3 7 "
},
{
"input": "14",
"output": "4\n1 2 3 8 "
},
{
"input": "15",
"output": "5\n1 2 3 4 5 "
},
{
"input": "16",
"output": "5\n1 2 3 4 6 "
},
{
"input": "20",
"output": "5\n1 2 3 4 10 "
},
{
"input": "21",
"output": "6\n1 2 3 4 5 6 "
},
{
"input": "22",
"output": "6\n1 2 3 4 5 7 "
},
{
"input": "27",
"output": "6\n1 2 3 4 5 12 "
},
{
"input": "28",
"output": "7\n1 2 3 4 5 6 7 "
},
{
"input": "29",
"output": "7\n1 2 3 4 5 6 8 "
},
{
"input": "35",
"output": "7\n1 2 3 4 5 6 14 "
},
{
"input": "36",
"output": "8\n1 2 3 4 5 6 7 8 "
},
{
"input": "37",
"output": "8\n1 2 3 4 5 6 7 9 "
},
{
"input": "44",
"output": "8\n1 2 3 4 5 6 7 16 "
},
{
"input": "45",
"output": "9\n1 2 3 4 5 6 7 8 9 "
},
{
"input": "46",
"output": "9\n1 2 3 4 5 6 7 8 10 "
},
{
"input": "230",
"output": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 40 "
},
{
"input": "231",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 "
},
{
"input": "232",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 22 "
},
{
"input": "239",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 29 "
},
{
"input": "629",
"output": "34\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 68 "
},
{
"input": "630",
"output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 "
},
{
"input": "631",
"output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 36 "
},
{
"input": "945",
"output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 84 "
},
{
"input": "946",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 "
},
{
"input": "947",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 44 "
},
{
"input": "989",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 86 "
},
{
"input": "990",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 "
},
{
"input": "991",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 "
},
{
"input": "956",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 53 "
},
{
"input": "981",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 78 "
},
{
"input": "867",
"output": "41\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 47 "
},
{
"input": "906",
"output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 45 "
},
{
"input": "999",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 53 "
},
{
"input": "100",
"output": "13\n1 2 3 4 5 6 7 8 9 10 11 12 22 "
},
{
"input": "126",
"output": "15\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 21 "
}
] | 1,579,030,535 | 2,147,483,647 | PyPy 3 | OK | TESTS | 49 | 155 | 0 | a=int(input())
c=[]
d=0
for i in range(1,a+1):
c.append(i)
sum=0
for j in range(a):
if sum+c[j]>a:
sum+=c[j]
d+=1
break
else:
sum+=c[j]
d+=1
sum=0
e=[]
for i in range(d-2):
e.append(c[i])
sum+=c[i]
e.append(a-sum)
print(len(e))
print(*e)
| Title: Santa Claus and Candies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus has *n* candies, he dreams to give them as gifts to children.
What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has.
Input Specification:
The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has.
Output Specification:
Print to the first line integer number *k* — maximal number of kids which can get candies.
Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*.
If there are many solutions, print any of them.
Demo Input:
['5\n', '9\n', '2\n']
Demo Output:
['2\n2 3\n', '3\n3 5 1\n', '1\n2 \n']
Note:
none | ```python
a=int(input())
c=[]
d=0
for i in range(1,a+1):
c.append(i)
sum=0
for j in range(a):
if sum+c[j]>a:
sum+=c[j]
d+=1
break
else:
sum+=c[j]
d+=1
sum=0
e=[]
for i in range(d-2):
e.append(c[i])
sum+=c[i]
e.append(a-sum)
print(len(e))
print(*e)
``` | 3 |
|
670 | D1 | Magic Powder - 1 | PROGRAMMING | 1,400 | [
"binary search",
"brute force",
"implementation"
] | null | null | This problem is given in two versions that differ only by constraints. If you can solve this problem in large constraints, then you can just write a single solution to the both versions. If you find the problem too difficult in large constraints, you can write solution to the simplified version only.
Waking up in the morning, Apollinaria decided to bake cookies. To bake one cookie, she needs *n* ingredients, and for each ingredient she knows the value *a**i* — how many grams of this ingredient one needs to bake a cookie. To prepare one cookie Apollinaria needs to use all *n* ingredients.
Apollinaria has *b**i* gram of the *i*-th ingredient. Also she has *k* grams of a magic powder. Each gram of magic powder can be turned to exactly 1 gram of any of the *n* ingredients and can be used for baking cookies.
Your task is to determine the maximum number of cookies, which Apollinaria is able to bake using the ingredients that she has and the magic powder. | The first line of the input contains two positive integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1000) — the number of ingredients and the number of grams of the magic powder.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, needed to bake one cookie.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, which Apollinaria has. | Print the maximum number of cookies, which Apollinaria will be able to bake using the ingredients that she has and the magic powder. | [
"3 1\n2 1 4\n11 3 16\n",
"4 3\n4 3 5 6\n11 12 14 20\n"
] | [
"4\n",
"3\n"
] | In the first sample it is profitably for Apollinaria to make the existing 1 gram of her magic powder to ingredient with the index 2, then Apollinaria will be able to bake 4 cookies.
In the second sample Apollinaria should turn 1 gram of magic powder to ingredient with the index 1 and 1 gram of magic powder to ingredient with the index 3. Then Apollinaria will be able to bake 3 cookies. The remaining 1 gram of the magic powder can be left, because it can't be used to increase the answer. | 1,000 | [
{
"input": "3 1\n2 1 4\n11 3 16",
"output": "4"
},
{
"input": "4 3\n4 3 5 6\n11 12 14 20",
"output": "3"
},
{
"input": "10 926\n5 6 8 1 2 5 1 8 4 4\n351 739 998 725 953 970 906 691 707 1000",
"output": "137"
},
{
"input": "20 925\n7 3 1 2 1 3 1 3 1 2 3 1 5 8 1 3 7 3 4 2\n837 898 965 807 786 670 626 873 968 745 878 359 760 781 829 882 777 740 907 779",
"output": "150"
},
{
"input": "30 300\n1 4 2 1 2 5 6 4 1 3 2 1 1 1 1 1 2 3 1 3 4 2 2 3 2 2 2 1 1 1\n997 817 767 860 835 809 817 565 630 804 586 953 977 356 905 890 958 916 740 583 902 945 313 956 871 729 976 707 516 788",
"output": "164"
},
{
"input": "40 538\n1 3 3 1 4 1 1 1 1 5 3 3 4 1 4 2 7 1 4 1 1 2 2 1 1 1 1 4 1 4 2 3 3 3 1 3 4 1 3 5\n975 635 795 835 982 965 639 787 688 796 988 779 839 942 491 696 396 995 718 810 796 879 957 783 844 765 968 783 647 214 995 868 318 453 989 889 504 962 945 925",
"output": "104"
},
{
"input": "50 530\n2 3 3 1 1 1 3 4 4 2 4 2 5 1 3 1 2 6 1 1 2 5 3 2 1 5 1 3 3 2 1 1 1 1 2 1 1 2 2 1 4 2 1 3 1 2 1 1 4 2\n959 972 201 990 675 679 972 268 976 886 488 924 795 959 647 994 969 862 898 646 763 797 978 763 995 641 923 856 829 921 934 883 904 986 728 980 1000 775 716 745 833 832 999 651 571 626 827 456 636 795",
"output": "133"
},
{
"input": "60 735\n3 1 4 7 1 7 3 1 1 5 4 7 3 3 3 2 5 3 1 2 3 6 1 1 1 1 1 2 5 3 2 1 3 5 2 1 2 2 2 2 1 3 3 3 6 4 3 5 1 3 2 2 1 3 1 1 1 7 1 2\n596 968 975 493 665 571 598 834 948 941 737 649 923 848 950 907 929 865 227 836 956 796 861 801 746 667 539 807 405 355 501 879 994 890 573 848 597 873 130 985 924 426 999 550 586 924 601 807 994 878 410 817 922 898 982 525 611 685 806 847",
"output": "103"
},
{
"input": "1 1\n1\n1",
"output": "2"
},
{
"input": "70 130\n2 1 2 2 3 3 2 5 2 2 3 3 3 1 1 4 3 5 3 2 1 3 7 1 2 7 5 2 1 6 3 4 1 2 1 1 1 1 3 6 4 2 2 8 2 2 4 1 4 2 1 4 4 3 5 1 1 1 1 1 2 3 1 5 1 3 3 4 2 2\n473 311 758 768 797 572 656 898 991 534 989 702 934 767 777 799 1000 655 806 727 718 948 834 965 832 778 706 861 799 874 745 970 772 967 984 886 835 795 832 837 950 952 475 891 947 952 903 929 689 478 725 945 585 943 771 631 729 887 557 738 824 758 999 786 669 992 918 762 964 941",
"output": "119"
},
{
"input": "80 979\n2 1 1 1 2 1 1 1 3 1 4 4 2 1 1 3 1 1 2 1 4 1 1 2 5 4 8 1 3 6 5 7 2 3 4 1 2 2 6 1 2 2 4 1 1 2 3 2 8 1 1 3 3 4 1 1 2 1 4 4 1 4 3 2 6 5 2 1 4 1 2 3 2 1 3 3 1 2 1 3\n498 976 513 869 917 914 664 656 957 893 981 947 985 693 576 958 987 822 981 718 884 729 295 683 485 998 730 894 731 975 739 854 906 740 987 976 606 689 990 775 522 994 920 893 529 651 989 799 643 215 946 987 297 868 425 810 694 908 736 903 970 751 625 904 955 945 839 777 977 974 905 900 666 680 799 873 565 919 536 686",
"output": "128"
},
{
"input": "1 1000\n1000\n1000",
"output": "2"
},
{
"input": "1 1000\n1\n1000",
"output": "2000"
},
{
"input": "1 1\n4\n6",
"output": "1"
},
{
"input": "1 1\n10\n2",
"output": "0"
},
{
"input": "2 1\n2 2\n1 1",
"output": "0"
},
{
"input": "2 6\n1 3\n6 2",
"output": "2"
}
] | 1,695,832,255 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 46 | 307,200 | # list(map(int,input().split()))
import math
from collections import Counter
n,k=list(map(int,input().split()))
a=list(map(int,input().split()))
b=list(map(int,input().split()))
avail=[b[i]//a[i] for i in range(n)]
l,r=0,(10**12)+100
while(l<r):
mid=math.ceil((l+r)/2)
if sum([max(0,mid-avail[i])*a[i] - b[i] % a[i] for i in range(n) if a[i] > 0])<=k:
l=mid
else:
r=mid-1
print(l) | Title: Magic Powder - 1
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem is given in two versions that differ only by constraints. If you can solve this problem in large constraints, then you can just write a single solution to the both versions. If you find the problem too difficult in large constraints, you can write solution to the simplified version only.
Waking up in the morning, Apollinaria decided to bake cookies. To bake one cookie, she needs *n* ingredients, and for each ingredient she knows the value *a**i* — how many grams of this ingredient one needs to bake a cookie. To prepare one cookie Apollinaria needs to use all *n* ingredients.
Apollinaria has *b**i* gram of the *i*-th ingredient. Also she has *k* grams of a magic powder. Each gram of magic powder can be turned to exactly 1 gram of any of the *n* ingredients and can be used for baking cookies.
Your task is to determine the maximum number of cookies, which Apollinaria is able to bake using the ingredients that she has and the magic powder.
Input Specification:
The first line of the input contains two positive integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1000) — the number of ingredients and the number of grams of the magic powder.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, needed to bake one cookie.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=1000), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, which Apollinaria has.
Output Specification:
Print the maximum number of cookies, which Apollinaria will be able to bake using the ingredients that she has and the magic powder.
Demo Input:
['3 1\n2 1 4\n11 3 16\n', '4 3\n4 3 5 6\n11 12 14 20\n']
Demo Output:
['4\n', '3\n']
Note:
In the first sample it is profitably for Apollinaria to make the existing 1 gram of her magic powder to ingredient with the index 2, then Apollinaria will be able to bake 4 cookies.
In the second sample Apollinaria should turn 1 gram of magic powder to ingredient with the index 1 and 1 gram of magic powder to ingredient with the index 3. Then Apollinaria will be able to bake 3 cookies. The remaining 1 gram of the magic powder can be left, because it can't be used to increase the answer. | ```python
# list(map(int,input().split()))
import math
from collections import Counter
n,k=list(map(int,input().split()))
a=list(map(int,input().split()))
b=list(map(int,input().split()))
avail=[b[i]//a[i] for i in range(n)]
l,r=0,(10**12)+100
while(l<r):
mid=math.ceil((l+r)/2)
if sum([max(0,mid-avail[i])*a[i] - b[i] % a[i] for i in range(n) if a[i] > 0])<=k:
l=mid
else:
r=mid-1
print(l)
``` | 0 |
|
337 | A | Puzzles | PROGRAMMING | 900 | [
"greedy"
] | null | null | The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*. | The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop. | Print a single integer — the least possible difference the teacher can obtain. | [
"4 6\n10 12 10 7 5 22\n"
] | [
"5\n"
] | Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5. | 500 | [
{
"input": "4 6\n10 12 10 7 5 22",
"output": "5"
},
{
"input": "2 2\n4 4",
"output": "0"
},
{
"input": "2 10\n4 5 6 7 8 9 10 11 12 12",
"output": "0"
},
{
"input": "4 5\n818 136 713 59 946",
"output": "759"
},
{
"input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903",
"output": "13"
},
{
"input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94",
"output": "3"
},
{
"input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190",
"output": "31"
},
{
"input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997",
"output": "0"
},
{
"input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176",
"output": "412"
},
{
"input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886",
"output": "938"
},
{
"input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993",
"output": "937"
},
{
"input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7",
"output": "0"
},
{
"input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19",
"output": "12"
},
{
"input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17",
"output": "31"
},
{
"input": "2 2\n1000 4",
"output": "996"
},
{
"input": "2 3\n4 502 1000",
"output": "498"
},
{
"input": "3 3\n4 1000 4",
"output": "996"
}
] | 1,685,960,402 | 2,147,483,647 | Python 3 | OK | TESTS | 18 | 62 | 0 | n,m = map(int,input().split())
f = list(map(int,input().split()))
f.sort()
best = 1000
for i in range(m-n+1):
best = min(best , f[n+i-1] - f[i])
print(best) | Title: Puzzles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
Input Specification:
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Output Specification:
Print a single integer — the least possible difference the teacher can obtain.
Demo Input:
['4 6\n10 12 10 7 5 22\n']
Demo Output:
['5\n']
Note:
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5. | ```python
n,m = map(int,input().split())
f = list(map(int,input().split()))
f.sort()
best = 1000
for i in range(m-n+1):
best = min(best , f[n+i-1] - f[i])
print(best)
``` | 3 |
|
894 | A | QAQ | PROGRAMMING | 800 | [
"brute force",
"dp"
] | null | null | "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. | The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. | Print a single integer — the number of subsequences "QAQ" in the string. | [
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] | [
"4\n",
"3\n"
] | In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | 500 | [
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,668,839,139 | 2,147,483,647 | Python 3 | OK | TESTS | 43 | 46 | 0 | k=input()
s=0
for i in range(len(k)):
if k[i]=='A':
s=s+k[:i].count("Q")*k[i:].count("Q")
print(s)
| Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | ```python
k=input()
s=0
for i in range(len(k)):
if k[i]=='A':
s=s+k[:i].count("Q")*k[i:].count("Q")
print(s)
``` | 3 |
|
330 | A | Cakeminator | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat. | The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry. | Output the maximum number of cake cells that the cakeminator can eat. | [
"3 4\nS...\n....\n..S.\n"
] | [
"8\n"
] | For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | 500 | [
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,623,176,882 | 2,147,483,647 | Python 3 | OK | TESTS | 42 | 218 | 0 | rows,columns = map(int,input().split())
grid = [list(input()) for i in range(rows)]
count = 0
## column slicing
for i in range(columns):
for j in range(rows):
if grid[j][i] == ".":
continue
else:break
else:
count += rows
for j in range(rows):
grid[j][i] =0
## row slicing
for i in grid:
if "S" not in i:
for j in i:
if j==".":count += 1
print(count) | Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | ```python
rows,columns = map(int,input().split())
grid = [list(input()) for i in range(rows)]
count = 0
## column slicing
for i in range(columns):
for j in range(rows):
if grid[j][i] == ".":
continue
else:break
else:
count += rows
for j in range(rows):
grid[j][i] =0
## row slicing
for i in grid:
if "S" not in i:
for j in i:
if j==".":count += 1
print(count)
``` | 3 |
|
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,639,232,779 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 |
n=int(input())
s=[0,0,0]
for i in range(n):
l=list(map(int,input().split()))
s[0]+=l[0]
s[1]+=l[1]
s[2]+=l[2]
if s[0]==0 and s[1]==0 and s[2]==0:
print('yes')
else:
print('no')
| Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
n=int(input())
s=[0,0,0]
for i in range(n):
l=list(map(int,input().split()))
s[0]+=l[0]
s[1]+=l[1]
s[2]+=l[2]
if s[0]==0 and s[1]==0 and s[2]==0:
print('yes')
else:
print('no')
``` | 0 |
47 | B | Coins | PROGRAMMING | 1,200 | [
"implementation"
] | B. Coins | 2 | 256 | One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal. | The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B. | It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights. | [
"A>B\nC<B\nA>C\n",
"A<B\nB>C\nC>A\n"
] | [
"CBA",
"ACB"
] | none | 1,000 | [
{
"input": "A>B\nC<B\nA>C",
"output": "CBA"
},
{
"input": "A<B\nB>C\nC>A",
"output": "ACB"
},
{
"input": "A<C\nB<A\nB>C",
"output": "Impossible"
},
{
"input": "A<B\nA<C\nB>C",
"output": "ACB"
},
{
"input": "B>A\nC<B\nC>A",
"output": "ACB"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "A>C\nA>B\nB<C",
"output": "BCA"
},
{
"input": "C<B\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nA>B\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nA<C",
"output": "ABC"
},
{
"input": "C<B\nB<A\nC>A",
"output": "Impossible"
},
{
"input": "B<C\nC<A\nA>B",
"output": "BCA"
},
{
"input": "A>B\nC<B\nC<A",
"output": "CBA"
},
{
"input": "B>A\nC>B\nA>C",
"output": "Impossible"
},
{
"input": "B<A\nC>B\nC>A",
"output": "BAC"
},
{
"input": "A<B\nC>B\nA<C",
"output": "ABC"
},
{
"input": "A<B\nC<A\nB<C",
"output": "Impossible"
},
{
"input": "A>C\nC<B\nB>A",
"output": "CAB"
},
{
"input": "C>A\nA<B\nB>C",
"output": "ACB"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "B>C\nB>A\nA<C",
"output": "ACB"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA<B\nB>C",
"output": "ACB"
},
{
"input": "B>A\nA>C\nB>C",
"output": "CAB"
},
{
"input": "B<A\nA<C\nC<B",
"output": "Impossible"
},
{
"input": "A<C\nB>C\nA>B",
"output": "Impossible"
},
{
"input": "B>A\nC<A\nC>B",
"output": "Impossible"
},
{
"input": "A>C\nC>B\nB<A",
"output": "BCA"
},
{
"input": "B<C\nB<A\nA>C",
"output": "BCA"
},
{
"input": "A>B\nC>B\nA<C",
"output": "BAC"
},
{
"input": "C<B\nC<A\nB<A",
"output": "CBA"
},
{
"input": "A<C\nA>B\nB>C",
"output": "Impossible"
},
{
"input": "B>A\nB>C\nA<C",
"output": "ACB"
},
{
"input": "B>C\nC<A\nB<A",
"output": "CBA"
},
{
"input": "C>A\nB>A\nB>C",
"output": "ACB"
},
{
"input": "B<A\nB>C\nA<C",
"output": "Impossible"
},
{
"input": "B<C\nA<B\nC>A",
"output": "ABC"
},
{
"input": "C<B\nB>A\nA>C",
"output": "CAB"
},
{
"input": "A>B\nC>A\nB<C",
"output": "BAC"
},
{
"input": "A>B\nB>C\nC<A",
"output": "CBA"
},
{
"input": "B>C\nC>A\nA>B",
"output": "Impossible"
},
{
"input": "B<A\nB>C\nC<A",
"output": "CBA"
},
{
"input": "C>B\nB>A\nC>A",
"output": "ABC"
},
{
"input": "A>C\nA>B\nB>C",
"output": "CBA"
},
{
"input": "B<C\nA>B\nA<C",
"output": "BAC"
},
{
"input": "C>A\nC<B\nB>A",
"output": "ACB"
},
{
"input": "C>B\nA<B\nC<A",
"output": "Impossible"
},
{
"input": "A<C\nC<B\nA>B",
"output": "Impossible"
},
{
"input": "B>C\nA<B\nA<C",
"output": "ACB"
},
{
"input": "C>A\nA<B\nC>B",
"output": "ABC"
}
] | 1,658,442,770 | 2,147,483,647 | Python 3 | OK | TESTS | 50 | 92 | 0 | s=[]
arr=[]
let=["A",'B','C']
for i in range(3):
arr.append(input())
if "<" in arr[0]:
s+=[arr[0][0]]+[arr[0][2]]
let.remove(arr[0][2])
let.remove(arr[0][0])
else:
s+=[arr[0][2]]+[arr[0][0]]
let.remove(arr[0][2])
let.remove(arr[0][0])
x="".join(let)
if (x+">"+s[1] in arr or s[1]+"<"+x in arr) and (x+"<"+s[0] in arr or s[0]+">"+x in arr):
print("Impossible")
elif x+">"+s[1] in arr or s[1]+"<"+x in arr:
z="".join(s)
print(z+x)
elif x+"<"+s[0] in arr or s[0]+">"+x in arr:
z="".join(s)
print(x+z)
else:
s.insert(1,x)
print("".join(s)) | Title: Coins
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
Input Specification:
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(> or < sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A<B.
Output Specification:
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
Demo Input:
['A>B\nC<B\nA>C\n', 'A<B\nB>C\nC>A\n']
Demo Output:
['CBA', 'ACB']
Note:
none | ```python
s=[]
arr=[]
let=["A",'B','C']
for i in range(3):
arr.append(input())
if "<" in arr[0]:
s+=[arr[0][0]]+[arr[0][2]]
let.remove(arr[0][2])
let.remove(arr[0][0])
else:
s+=[arr[0][2]]+[arr[0][0]]
let.remove(arr[0][2])
let.remove(arr[0][0])
x="".join(let)
if (x+">"+s[1] in arr or s[1]+"<"+x in arr) and (x+"<"+s[0] in arr or s[0]+">"+x in arr):
print("Impossible")
elif x+">"+s[1] in arr or s[1]+"<"+x in arr:
z="".join(s)
print(z+x)
elif x+"<"+s[0] in arr or s[0]+">"+x in arr:
z="".join(s)
print(x+z)
else:
s.insert(1,x)
print("".join(s))
``` | 3.977 |
140 | A | New Year Table | PROGRAMMING | 1,700 | [
"geometry",
"math"
] | null | null | Gerald is setting the New Year table. The table has the form of a circle; its radius equals *R*. Gerald invited many guests and is concerned whether the table has enough space for plates for all those guests. Consider all plates to be round and have the same radii that equal *r*. Each plate must be completely inside the table and must touch the edge of the table. Of course, the plates must not intersect, but they can touch each other. Help Gerald determine whether the table is large enough for *n* plates. | The first line contains three integers *n*, *R* and *r* (1<=≤<=*n*<=≤<=100, 1<=≤<=*r*,<=*R*<=≤<=1000) — the number of plates, the radius of the table and the plates' radius. | Print "YES" (without the quotes) if it is possible to place *n* plates on the table by the rules given above. If it is impossible, print "NO".
Remember, that each plate must touch the edge of the table. | [
"4 10 4\n",
"5 10 4\n",
"1 10 10\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | The possible arrangement of the plates for the first sample is: | 500 | [
{
"input": "4 10 4",
"output": "YES"
},
{
"input": "5 10 4",
"output": "NO"
},
{
"input": "1 10 10",
"output": "YES"
},
{
"input": "3 10 20",
"output": "NO"
},
{
"input": "2 20 11",
"output": "NO"
},
{
"input": "6 9 3",
"output": "YES"
},
{
"input": "1 999 1000",
"output": "NO"
},
{
"input": "1 1000 999",
"output": "YES"
},
{
"input": "2 1000 500",
"output": "YES"
},
{
"input": "2 1000 499",
"output": "YES"
},
{
"input": "10 1000 236",
"output": "YES"
},
{
"input": "10 1000 237",
"output": "NO"
},
{
"input": "6 999 334",
"output": "NO"
},
{
"input": "100 1000 1",
"output": "YES"
},
{
"input": "100 1000 50",
"output": "NO"
},
{
"input": "13 927 179",
"output": "YES"
},
{
"input": "13 145 28",
"output": "NO"
},
{
"input": "37 307 24",
"output": "YES"
},
{
"input": "37 857 67",
"output": "NO"
},
{
"input": "100 821 25",
"output": "YES"
},
{
"input": "100 197 6",
"output": "NO"
},
{
"input": "93 704 23",
"output": "YES"
},
{
"input": "93 857 28",
"output": "NO"
},
{
"input": "85 870 31",
"output": "YES"
},
{
"input": "85 449 16",
"output": "NO"
},
{
"input": "29 10 1",
"output": "NO"
},
{
"input": "3 10 5",
"output": "NO"
},
{
"input": "2 4 2",
"output": "YES"
},
{
"input": "2 10 5",
"output": "YES"
},
{
"input": "4 2 1",
"output": "NO"
},
{
"input": "3 2 1",
"output": "NO"
},
{
"input": "59 486 43",
"output": "NO"
},
{
"input": "4 997 413",
"output": "NO"
},
{
"input": "100 100 5",
"output": "NO"
},
{
"input": "2 100 50",
"output": "YES"
},
{
"input": "2 2 1",
"output": "YES"
},
{
"input": "1 100 45",
"output": "YES"
},
{
"input": "2 20 10",
"output": "YES"
},
{
"input": "36 474 38",
"output": "NO"
},
{
"input": "6 996 333",
"output": "NO"
},
{
"input": "23 100 12",
"output": "NO"
},
{
"input": "100 886 27",
"output": "NO"
},
{
"input": "7 997 332",
"output": "NO"
},
{
"input": "10 72 17",
"output": "NO"
},
{
"input": "85 449 16",
"output": "NO"
},
{
"input": "2 10 10",
"output": "NO"
}
] | 1,552,568,887 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 4 | 404 | 1,024,000 | import math
n,R,r=[int(i) for i in input().split()]
if r>R:
ans='NO'
elif r==R and n==1:
ans='YES'
elif n==2:
if r*2<=R:
ans='YES'
else:
a=2*(R-r)*math.sin(math.pi/n)
if a>=2*r:
ans='YES'
else:
ans='NO'
print(ans) | Title: New Year Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald is setting the New Year table. The table has the form of a circle; its radius equals *R*. Gerald invited many guests and is concerned whether the table has enough space for plates for all those guests. Consider all plates to be round and have the same radii that equal *r*. Each plate must be completely inside the table and must touch the edge of the table. Of course, the plates must not intersect, but they can touch each other. Help Gerald determine whether the table is large enough for *n* plates.
Input Specification:
The first line contains three integers *n*, *R* and *r* (1<=≤<=*n*<=≤<=100, 1<=≤<=*r*,<=*R*<=≤<=1000) — the number of plates, the radius of the table and the plates' radius.
Output Specification:
Print "YES" (without the quotes) if it is possible to place *n* plates on the table by the rules given above. If it is impossible, print "NO".
Remember, that each plate must touch the edge of the table.
Demo Input:
['4 10 4\n', '5 10 4\n', '1 10 10\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
The possible arrangement of the plates for the first sample is: | ```python
import math
n,R,r=[int(i) for i in input().split()]
if r>R:
ans='NO'
elif r==R and n==1:
ans='YES'
elif n==2:
if r*2<=R:
ans='YES'
else:
a=2*(R-r)*math.sin(math.pi/n)
if a>=2*r:
ans='YES'
else:
ans='NO'
print(ans)
``` | -1 |
|
214 | A | System of Equations | PROGRAMMING | 800 | [
"brute force"
] | null | null | Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system. | A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space. | On a single line print the answer to the problem. | [
"9 3\n",
"14 28\n",
"4 20\n"
] | [
"1\n",
"1\n",
"0\n"
] | In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair. | 500 | [
{
"input": "9 3",
"output": "1"
},
{
"input": "14 28",
"output": "1"
},
{
"input": "4 20",
"output": "0"
},
{
"input": "18 198",
"output": "1"
},
{
"input": "22 326",
"output": "1"
},
{
"input": "26 104",
"output": "1"
},
{
"input": "14 10",
"output": "0"
},
{
"input": "8 20",
"output": "0"
},
{
"input": "2 8",
"output": "0"
},
{
"input": "20 11",
"output": "0"
},
{
"input": "57 447",
"output": "1"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "66 296",
"output": "1"
},
{
"input": "75 683",
"output": "1"
},
{
"input": "227 975",
"output": "1"
},
{
"input": "247 499",
"output": "1"
},
{
"input": "266 116",
"output": "1"
},
{
"input": "286 916",
"output": "1"
},
{
"input": "307 341",
"output": "1"
},
{
"input": "451 121",
"output": "1"
},
{
"input": "471 921",
"output": "1"
},
{
"input": "502 346",
"output": "1"
},
{
"input": "535 59",
"output": "1"
},
{
"input": "555 699",
"output": "1"
},
{
"input": "747 351",
"output": "1"
},
{
"input": "790 64",
"output": "1"
},
{
"input": "810 704",
"output": "1"
},
{
"input": "855 225",
"output": "1"
},
{
"input": "902 34",
"output": "1"
},
{
"input": "922 514",
"output": "1"
},
{
"input": "971 131",
"output": "1"
},
{
"input": "991 931",
"output": "1"
},
{
"input": "840 780",
"output": "0"
},
{
"input": "102 595",
"output": "0"
},
{
"input": "139 433",
"output": "0"
},
{
"input": "968 288",
"output": "0"
},
{
"input": "563 354",
"output": "0"
},
{
"input": "994 975",
"output": "0"
},
{
"input": "456 221",
"output": "0"
},
{
"input": "205 210",
"output": "0"
},
{
"input": "1 11",
"output": "0"
},
{
"input": "1000 1000",
"output": "0"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "11 99",
"output": "0"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "11 1",
"output": "0"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "100 452",
"output": "0"
},
{
"input": "420 380",
"output": "0"
},
{
"input": "31 31",
"output": "0"
},
{
"input": "2 6",
"output": "0"
},
{
"input": "112 134",
"output": "0"
},
{
"input": "13 13",
"output": "0"
},
{
"input": "1 571",
"output": "0"
}
] | 1,689,741,364 | 2,147,483,647 | Python 3 | OK | TESTS | 54 | 92 | 0 | m= input()
n= m.split(" ")
k = list(map(int,n))
dem=0
for a in range(100):
for b in range(100):
if a**2 + b == k[0] and b**2 + a ==k[1]:
dem+=1
print(dem) | Title: System of Equations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
Input Specification:
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
Output Specification:
On a single line print the answer to the problem.
Demo Input:
['9 3\n', '14 28\n', '4 20\n']
Demo Output:
['1\n', '1\n', '0\n']
Note:
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair. | ```python
m= input()
n= m.split(" ")
k = list(map(int,n))
dem=0
for a in range(100):
for b in range(100):
if a**2 + b == k[0] and b**2 + a ==k[1]:
dem+=1
print(dem)
``` | 3 |
|
16 | A | Flag | PROGRAMMING | 800 | [
"implementation"
] | A. Flag | 2 | 64 | According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard. | The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square. | Output YES, if the flag meets the new ISO standard, and NO otherwise. | [
"3 3\n000\n111\n222\n",
"3 3\n000\n000\n111\n",
"3 3\n000\n111\n002\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 0 | [
{
"input": "3 3\n000\n111\n222",
"output": "YES"
},
{
"input": "3 3\n000\n000\n111",
"output": "NO"
},
{
"input": "3 3\n000\n111\n002",
"output": "NO"
},
{
"input": "10 10\n2222222222\n5555555555\n0000000000\n4444444444\n1111111111\n3333333393\n3333333333\n5555555555\n0000000000\n8888888888",
"output": "NO"
},
{
"input": "10 13\n4442444444444\n8888888888888\n6666666666666\n0000000000000\n3333333333333\n4444444444444\n7777777777777\n8388888888888\n1111111111111\n5555555555555",
"output": "NO"
},
{
"input": "10 8\n33333333\n44444444\n11111115\n81888888\n44444444\n11111111\n66666666\n33330333\n33333333\n33333333",
"output": "NO"
},
{
"input": "5 5\n88888\n44444\n66666\n55555\n88888",
"output": "YES"
},
{
"input": "20 19\n1111111111111111111\n5555555555555555555\n0000000000000000000\n3333333333333333333\n1111111111111111111\n2222222222222222222\n4444444444444444444\n5555555555555555555\n0000000000000000000\n4444444444444444444\n0000000000000000000\n5555555555555555555\n7777777777777777777\n9999999999999999999\n2222222222222222222\n4444444444444444444\n1111111111111111111\n6666666666666666666\n7777777777777777777\n2222222222222222222",
"output": "YES"
},
{
"input": "1 100\n8888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888",
"output": "YES"
},
{
"input": "100 1\n5\n7\n9\n4\n7\n2\n5\n1\n6\n7\n2\n7\n6\n8\n7\n4\n0\n2\n9\n8\n9\n1\n6\n4\n3\n4\n7\n1\n9\n3\n0\n8\n3\n1\n7\n5\n3\n9\n5\n1\n3\n5\n8\n1\n9\n3\n9\n0\n6\n0\n7\n6\n5\n2\n8\n3\n7\n6\n5\n1\n8\n3\n6\n9\n6\n0\n5\n8\n5\n2\n9\n1\n0\n1\n8\n3\n2\n1\n0\n3\n9\n0\n5\n1\n0\n4\n9\n3\n0\n4\n8\n4\n8\n6\n3\n0\n4\n6\n8\n4",
"output": "YES"
},
{
"input": "1 1\n2",
"output": "YES"
},
{
"input": "1 100\n1111111111111111111111111111111111111111111111111111111111111111111111111111181111111111111111111111",
"output": "NO"
},
{
"input": "100 1\n3\n6\n4\n3\n0\n2\n8\n7\n3\n2\n1\n7\n1\n3\n2\n3\n6\n9\n0\n8\n5\n9\n7\n9\n2\n1\n4\n5\n1\n9\n2\n5\n1\n4\n6\n4\n9\n1\n0\n2\n1\n4\n7\n1\n4\n8\n0\n9\n2\n1\n6\n2\n8\n6\n9\n5\n8\n6\n4\n5\n9\n2\n7\n4\n1\n5\n8\n0\n9\n5\n4\n6\n5\n0\n6\n3\n6\n9\n7\n2\n0\n9\n7\n3\n2\n4\n9\n4\n7\n1\n2\n3\n1\n7\n9\n1\n9\n0\n4\n0",
"output": "YES"
}
] | 1,673,113,458 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 92 | 0 | n,m=list(map(int,input().split()))
a=[]
for i in range(n):
b=input()
a.append(b)
c=0
for i in range(n):
for j in range(m):
if(j<m-1 and a[i][j]!=a[i][j+1]):
c=1
if(i<n-1 and a[i][j]==a[i+1][j]):
c=1
if(c==0):
print("YES\n") | Title: Flag
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
According to a new ISO standard, a flag of every country should have a chequered field *n*<=×<=*m*, each square should be of one of 10 colours, and the flag should be «striped»: each horizontal row of the flag should contain squares of the same colour, and the colours of adjacent horizontal rows should be different. Berland's government asked you to find out whether their flag meets the new ISO standard.
Input Specification:
The first line of the input contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), *n* — the amount of rows, *m* — the amount of columns on the flag of Berland. Then there follows the description of the flag: each of the following *n* lines contain *m* characters. Each character is a digit between 0 and 9, and stands for the colour of the corresponding square.
Output Specification:
Output YES, if the flag meets the new ISO standard, and NO otherwise.
Demo Input:
['3 3\n000\n111\n222\n', '3 3\n000\n000\n111\n', '3 3\n000\n111\n002\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
n,m=list(map(int,input().split()))
a=[]
for i in range(n):
b=input()
a.append(b)
c=0
for i in range(n):
for j in range(m):
if(j<m-1 and a[i][j]!=a[i][j+1]):
c=1
if(i<n-1 and a[i][j]==a[i+1][j]):
c=1
if(c==0):
print("YES\n")
``` | 0 |
488 | A | Giga Tower | PROGRAMMING | 1,100 | [
"brute force"
] | null | null | Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view.
In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?).
Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number. | The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109). | Print the minimum *b* in a line. | [
"179\n",
"-1\n",
"18\n"
] | [
"1\n",
"9\n",
"10\n"
] | For the first sample, he has to arrive at the floor numbered 180.
For the second sample, he will arrive at 8.
Note that *b* should be positive, so the answer for the third sample is 10, not 0. | 500 | [
{
"input": "179",
"output": "1"
},
{
"input": "-1",
"output": "9"
},
{
"input": "18",
"output": "10"
},
{
"input": "-410058385",
"output": "1"
},
{
"input": "-586825624",
"output": "1"
},
{
"input": "852318890",
"output": "1"
},
{
"input": "919067153",
"output": "5"
},
{
"input": "690422411",
"output": "7"
},
{
"input": "-408490162",
"output": "1"
},
{
"input": "-8",
"output": "16"
},
{
"input": "-6",
"output": "14"
},
{
"input": "-4",
"output": "12"
},
{
"input": "-2",
"output": "10"
},
{
"input": "0",
"output": "8"
},
{
"input": "2",
"output": "6"
},
{
"input": "4",
"output": "4"
},
{
"input": "6",
"output": "2"
},
{
"input": "8",
"output": "10"
},
{
"input": "1000000000",
"output": "8"
},
{
"input": "-1000000000",
"output": "2"
},
{
"input": "88888",
"output": "1"
},
{
"input": "89",
"output": "9"
},
{
"input": "-80000000",
"output": "2"
},
{
"input": "-8888",
"output": "1"
},
{
"input": "-17",
"output": "9"
},
{
"input": "78",
"output": "2"
},
{
"input": "-19",
"output": "1"
},
{
"input": "-999999998",
"output": "9"
},
{
"input": "-999999997",
"output": "8"
},
{
"input": "999999997",
"output": "1"
},
{
"input": "811111111",
"output": "1"
},
{
"input": "-8",
"output": "16"
},
{
"input": "-5",
"output": "13"
},
{
"input": "-7",
"output": "15"
},
{
"input": "1000000000",
"output": "8"
}
] | 1,697,036,771 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 35 | 62 | 0 | n=int(input())+1
s=1
while '8' not in str(n):
n+=1
s+=1
print(s) | Title: Giga Tower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Giga Tower is the tallest and deepest building in Cyberland. There are 17<=777<=777<=777 floors, numbered from <=-<=8<=888<=888<=888 to 8<=888<=888<=888. In particular, there is floor 0 between floor <=-<=1 and floor 1. Every day, thousands of tourists come to this place to enjoy the wonderful view.
In Cyberland, it is believed that the number "8" is a lucky number (that's why Giga Tower has 8<=888<=888<=888 floors above the ground), and, an integer is lucky, if and only if its decimal notation contains at least one digit "8". For example, 8,<=<=-<=180,<=808 are all lucky while 42,<=<=-<=10 are not. In the Giga Tower, if you write code at a floor with lucky floor number, good luck will always be with you (Well, this round is #278, also lucky, huh?).
Tourist Henry goes to the tower to seek good luck. Now he is at the floor numbered *a*. He wants to find the minimum positive integer *b*, such that, if he walks *b* floors higher, he will arrive at a floor with a lucky number.
Input Specification:
The only line of input contains an integer *a* (<=-<=109<=≤<=*a*<=≤<=109).
Output Specification:
Print the minimum *b* in a line.
Demo Input:
['179\n', '-1\n', '18\n']
Demo Output:
['1\n', '9\n', '10\n']
Note:
For the first sample, he has to arrive at the floor numbered 180.
For the second sample, he will arrive at 8.
Note that *b* should be positive, so the answer for the third sample is 10, not 0. | ```python
n=int(input())+1
s=1
while '8' not in str(n):
n+=1
s+=1
print(s)
``` | 3 |
|
460 | A | Vasya and Socks | PROGRAMMING | 900 | [
"brute force",
"implementation",
"math"
] | null | null | Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? | The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space. | Print a single integer — the answer to the problem. | [
"2 2\n",
"9 3\n"
] | [
"3\n",
"13\n"
] | In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day. | 500 | [
{
"input": "2 2",
"output": "3"
},
{
"input": "9 3",
"output": "13"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "1 99",
"output": "1"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "10 2",
"output": "19"
},
{
"input": "10 9",
"output": "11"
},
{
"input": "100 100",
"output": "101"
},
{
"input": "2 27",
"output": "2"
},
{
"input": "99 100",
"output": "99"
},
{
"input": "99 2",
"output": "197"
},
{
"input": "100 3",
"output": "149"
},
{
"input": "98 3",
"output": "146"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "100 2",
"output": "199"
},
{
"input": "62 4",
"output": "82"
},
{
"input": "99 10",
"output": "109"
},
{
"input": "100 5",
"output": "124"
},
{
"input": "80 80",
"output": "81"
},
{
"input": "95 16",
"output": "101"
},
{
"input": "75 16",
"output": "79"
},
{
"input": "99 74",
"output": "100"
},
{
"input": "20 21",
"output": "20"
},
{
"input": "52 96",
"output": "52"
},
{
"input": "24 5",
"output": "29"
}
] | 1,652,018,891 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | N,M=map(int,input().split())
count=1
N1=(N+M)*2
while N1>0:
count+=1
N1-=2
print(count)
| Title: Vasya and Socks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
Input Specification:
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['2 2\n', '9 3\n']
Demo Output:
['3\n', '13\n']
Note:
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day. | ```python
N,M=map(int,input().split())
count=1
N1=(N+M)*2
while N1>0:
count+=1
N1-=2
print(count)
``` | 0 |
|
20 | C | Dijkstra? | PROGRAMMING | 1,900 | [
"graphs",
"shortest paths"
] | C. Dijkstra? | 1 | 64 | You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*. | The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge.
It is possible that the graph has loops and multiple edges between pair of vertices. | Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them. | [
"5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n",
"5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n"
] | [
"1 4 3 5 ",
"1 4 3 5 "
] | none | 1,500 | [
{
"input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1",
"output": "1 4 3 5 "
},
{
"input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1",
"output": "1 4 3 5 "
},
{
"input": "2 1\n1 2 1",
"output": "1 2 "
},
{
"input": "3 1\n1 2 1",
"output": "-1"
},
{
"input": "3 3\n1 2 1\n1 3 2\n2 3 1",
"output": "1 3 "
},
{
"input": "10 10\n1 5 12\n2 4 140\n2 10 149\n3 6 154\n3 7 9\n3 8 226\n3 10 132\n4 10 55\n5 8 33\n7 8 173",
"output": "1 5 8 7 3 10 "
},
{
"input": "10 10\n1 5 178\n1 8 221\n2 7 92\n2 8 159\n3 5 55\n3 6 179\n3 10 237\n4 8 205\n5 6 191\n8 10 157",
"output": "1 8 10 "
},
{
"input": "10 10\n1 4 200\n1 9 197\n3 4 79\n3 5 213\n3 6 149\n5 8 3\n5 9 189\n6 7 130\n6 9 51\n8 10 135",
"output": "1 9 5 8 10 "
},
{
"input": "10 10\n1 4 201\n2 3 238\n3 4 40\n3 6 231\n3 8 45\n4 5 227\n4 6 58\n4 9 55\n5 7 14\n6 10 242",
"output": "1 4 6 10 "
}
] | 1,505,935,209 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 15 | 62 | 204,800 | from heapq import heappush, heappop
from sys import stdin
#Respectively, n nodes and m edges
n, m = map(int, stdin.readline().rstrip().split())
graph = {} #Initializes graph
visited = set() #Intializes visited set
path_exists = False #Initializes boolean to track if there is a path
#Loops through each edge
for line in range(0, m):
a, b, w = map(int, stdin.readline().rstrip().split())
#Populates undirected graph, so node a the key for a value tuple of neighbor and edge weight. Same for node b.
if a not in graph:
graph[a] = [(b,w)]
else:
graph[a].append((b, w))
if b not in graph:
graph[b] = [(a, w)]
else:
graph[b].append((a, w))
#At this point, graph built
priority_q = [] #Initializes priority queue for Dijkstra's
heappush(priority_q,(0, 1, -1)) #First adds tuple of the priority cost of the node, node label 1, and "null" prev to priority queue
path = "" #Initializes path variable to return
path_so_far = {} #Initializes dictionary w/ node label as key, and value tuple of (edge_weight, prev node)
while priority_q: #While priority queue not empty
current = heappop(priority_q) #Pops off the element in queue
#Current node label hasn't been visited
if current[1] not in visited:
path_so_far[current[1]] = (current[0], current[2]) # node label: (edge_weight, prev_node)
if current[1] == n: #If current node is the goal node n
path_exists = True #yes, path
break #Stop search
else: #Current node is not goal node n
visited.add(current[1]) #Add node label to visited set
for neighbor, priority in graph[current[1]]: #Pushes current node's neighbors and priorities onto priority queue
heappush(priority_q,(priority + current[0], neighbor, current[1])) #Must update priority cost of neighbor and prev node label
#Here, priority queue is empty
path_stack = []
path_stack.append(n) #Starts from end node and traverses backwards to print path, following cheapest dest.
if path_exists: #Cheapest path exists
while 1 not in path_stack:
prev_node = path_so_far[path_stack[len(path_stack)-1]]
path_stack.append(prev_node[1])
while path_stack:
path += str(path_stack.pop()) + ' '
print(path)
else: #No path exists
print(str(-1))
| Title: Dijkstra?
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*.
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge.
It is possible that the graph has loops and multiple edges between pair of vertices.
Output Specification:
Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them.
Demo Input:
['5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n', '5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n']
Demo Output:
['1 4 3 5 ', '1 4 3 5 ']
Note:
none | ```python
from heapq import heappush, heappop
from sys import stdin
#Respectively, n nodes and m edges
n, m = map(int, stdin.readline().rstrip().split())
graph = {} #Initializes graph
visited = set() #Intializes visited set
path_exists = False #Initializes boolean to track if there is a path
#Loops through each edge
for line in range(0, m):
a, b, w = map(int, stdin.readline().rstrip().split())
#Populates undirected graph, so node a the key for a value tuple of neighbor and edge weight. Same for node b.
if a not in graph:
graph[a] = [(b,w)]
else:
graph[a].append((b, w))
if b not in graph:
graph[b] = [(a, w)]
else:
graph[b].append((a, w))
#At this point, graph built
priority_q = [] #Initializes priority queue for Dijkstra's
heappush(priority_q,(0, 1, -1)) #First adds tuple of the priority cost of the node, node label 1, and "null" prev to priority queue
path = "" #Initializes path variable to return
path_so_far = {} #Initializes dictionary w/ node label as key, and value tuple of (edge_weight, prev node)
while priority_q: #While priority queue not empty
current = heappop(priority_q) #Pops off the element in queue
#Current node label hasn't been visited
if current[1] not in visited:
path_so_far[current[1]] = (current[0], current[2]) # node label: (edge_weight, prev_node)
if current[1] == n: #If current node is the goal node n
path_exists = True #yes, path
break #Stop search
else: #Current node is not goal node n
visited.add(current[1]) #Add node label to visited set
for neighbor, priority in graph[current[1]]: #Pushes current node's neighbors and priorities onto priority queue
heappush(priority_q,(priority + current[0], neighbor, current[1])) #Must update priority cost of neighbor and prev node label
#Here, priority queue is empty
path_stack = []
path_stack.append(n) #Starts from end node and traverses backwards to print path, following cheapest dest.
if path_exists: #Cheapest path exists
while 1 not in path_stack:
prev_node = path_so_far[path_stack[len(path_stack)-1]]
path_stack.append(prev_node[1])
while path_stack:
path += str(path_stack.pop()) + ' '
print(path)
else: #No path exists
print(str(-1))
``` | -1 |
154 | B | Colliders | PROGRAMMING | 1,600 | [
"math",
"number theory"
] | null | null | By 2312 there were *n* Large Hadron Colliders in the inhabited part of the universe. Each of them corresponded to a single natural number from 1 to *n*. However, scientists did not know what activating several colliders simultaneously could cause, so the colliders were deactivated.
In 2312 there was a startling discovery: a collider's activity is safe if and only if all numbers of activated colliders are pairwise relatively prime to each other (two numbers are relatively prime if their greatest common divisor equals 1)! If two colliders with relatively nonprime numbers are activated, it will cause a global collapse.
Upon learning this, physicists rushed to turn the colliders on and off and carry out all sorts of experiments. To make sure than the scientists' quickness doesn't end with big trouble, the Large Hadron Colliders' Large Remote Control was created. You are commissioned to write the software for the remote (well, you do not expect anybody to operate it manually, do you?).
Initially, all colliders are deactivated. Your program receives multiple requests of the form "activate/deactivate the *i*-th collider". The program should handle requests in the order of receiving them. The program should print the processed results in the format described below.
To the request of "+ i" (that is, to activate the *i*-th collider), the program should print exactly one of the following responses:
- "Success" if the activation was successful. - "Already on", if the *i*-th collider was already activated before the request. - "Conflict with j", if there is a conflict with the *j*-th collider (that is, the *j*-th collider is on, and numbers *i* and *j* are not relatively prime). In this case, the *i*-th collider shouldn't be activated. If a conflict occurs with several colliders simultaneously, you should print the number of any of them.
The request of "- i" (that is, to deactivate the *i*-th collider), should receive one of the following responses from the program:
- "Success", if the deactivation was successful. - "Already off", if the *i*-th collider was already deactivated before the request.
You don't need to print quotes in the output of the responses to the requests. | The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of colliders and the number of requests, correspondingly.
Next *m* lines contain numbers of requests, one per line, in the form of either "+ i" (without the quotes) — activate the *i*-th collider, or "- i" (without the quotes) — deactivate the *i*-th collider (1<=≤<=*i*<=≤<=*n*). | Print *m* lines — the results of executing requests in the above given format. The requests should be processed in the order, in which they are given in the input. Don't forget that the responses to the requests should be printed without quotes. | [
"10 10\n+ 6\n+ 10\n+ 5\n- 10\n- 5\n- 6\n+ 10\n+ 3\n+ 6\n+ 3\n"
] | [
"Success\nConflict with 6\nSuccess\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 10\nAlready on\n"
] | Note that in the sample the colliders don't turn on after the second and ninth requests. The ninth request could also receive response "Conflict with 3". | 1,000 | [
{
"input": "10 10\n+ 6\n+ 10\n+ 5\n- 10\n- 5\n- 6\n+ 10\n+ 3\n+ 6\n+ 3",
"output": "Success\nConflict with 6\nSuccess\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 10\nAlready on"
},
{
"input": "7 5\n+ 7\n+ 6\n+ 4\n+ 3\n- 7",
"output": "Success\nSuccess\nConflict with 6\nConflict with 6\nSuccess"
},
{
"input": "10 5\n+ 2\n- 8\n- 4\n- 10\n+ 1",
"output": "Success\nAlready off\nAlready off\nAlready off\nSuccess"
},
{
"input": "10 10\n+ 1\n+ 10\n- 1\n- 10\n+ 1\n- 1\n+ 7\n+ 8\n+ 6\n- 7",
"output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 8\nSuccess"
},
{
"input": "15 15\n+ 12\n+ 6\n+ 13\n- 13\n+ 7\n+ 14\n+ 8\n+ 13\n- 13\n+ 15\n+ 4\n+ 10\n+ 11\n+ 2\n- 14",
"output": "Success\nConflict with 12\nSuccess\nSuccess\nSuccess\nConflict with 12\nConflict with 12\nSuccess\nSuccess\nConflict with 12\nConflict with 12\nConflict with 12\nSuccess\nConflict with 12\nAlready off"
},
{
"input": "2 20\n+ 1\n+ 2\n- 2\n+ 2\n- 1\n- 2\n+ 2\n- 2\n+ 2\n+ 1\n- 1\n+ 1\n- 1\n- 2\n+ 1\n- 1\n+ 1\n- 1\n+ 2\n+ 1",
"output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess"
},
{
"input": "2 20\n- 1\n- 2\n- 1\n- 2\n+ 2\n+ 1\n- 1\n+ 1\n+ 1\n+ 2\n- 2\n+ 1\n- 2\n+ 2\n+ 1\n+ 1\n+ 1\n- 1\n- 1\n- 2",
"output": "Already off\nAlready off\nAlready off\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nAlready on\nAlready on\nSuccess\nAlready on\nAlready off\nSuccess\nAlready on\nAlready on\nAlready on\nSuccess\nAlready off\nSuccess"
},
{
"input": "25 20\n+ 7\n+ 14\n- 7\n+ 11\n+ 15\n+ 10\n+ 20\n- 15\n+ 13\n- 14\n+ 4\n- 11\n- 20\n+ 15\n+ 16\n+ 3\n+ 11\n+ 22\n- 16\n- 22",
"output": "Success\nConflict with 7\nSuccess\nSuccess\nSuccess\nConflict with 15\nConflict with 15\nSuccess\nSuccess\nAlready off\nSuccess\nSuccess\nAlready off\nSuccess\nConflict with 4\nConflict with 15\nSuccess\nConflict with 4\nAlready off\nAlready off"
},
{
"input": "50 30\n- 39\n- 2\n+ 37\n- 10\n+ 27\n- 25\n+ 41\n+ 23\n- 36\n+ 49\n+ 5\n- 28\n+ 22\n+ 45\n+ 1\n+ 23\n+ 36\n+ 35\n- 4\n- 28\n- 10\n- 36\n- 38\n- 2\n- 38\n- 38\n- 37\n+ 8\n- 27\n- 28",
"output": "Already off\nAlready off\nSuccess\nAlready off\nSuccess\nAlready off\nSuccess\nSuccess\nAlready off\nSuccess\nSuccess\nAlready off\nSuccess\nConflict with 27\nSuccess\nAlready on\nConflict with 22\nConflict with 5\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nAlready off\nSuccess\nConflict with 22\nSuccess\nAlready off"
},
{
"input": "50 50\n+ 14\n+ 4\n+ 20\n+ 37\n+ 50\n+ 46\n+ 19\n- 20\n+ 25\n+ 47\n+ 10\n+ 6\n+ 34\n+ 12\n+ 41\n- 47\n+ 9\n+ 22\n+ 28\n- 41\n- 34\n+ 47\n+ 40\n- 12\n+ 42\n- 9\n- 4\n+ 15\n- 15\n+ 27\n+ 8\n+ 38\n+ 9\n+ 4\n+ 17\n- 8\n+ 13\n- 47\n+ 7\n- 9\n- 38\n+ 30\n+ 48\n- 50\n- 7\n+ 41\n+ 34\n+ 23\n+ 11\n+ 16",
"output": "Success\nConflict with 14\nConflict with 14\nSuccess\nConflict with 14\nConflict with 14\nSuccess\nAlready off\nSuccess\nSuccess\nConflict with 14\nConflict with 14\nConflict with 14\nConflict with 14\nSuccess\nSuccess\nSuccess\nConflict with 14\nConflict with 14\nSuccess\nAlready off\nSuccess\nConflict with 14\nAlready off\nConflict with 14\nSuccess\nAlready off\nConflict with 25\nAlready off\nSuccess\nConflict with 14\nConflict with 14\nConflict with 27\nConflict with 14\nSuccess\nAlready off\nSuccess\nS..."
},
{
"input": "100 1\n+ 51",
"output": "Success"
},
{
"input": "1 100\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1\n+ 1\n- 1",
"output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess..."
},
{
"input": "100 50\n+ 2\n+ 3\n+ 5\n+ 7\n+ 11\n+ 13\n+ 17\n+ 19\n+ 23\n+ 29\n+ 31\n+ 37\n+ 41\n+ 43\n+ 47\n+ 53\n+ 59\n+ 61\n+ 67\n+ 71\n+ 73\n+ 79\n+ 83\n+ 89\n+ 97\n+ 52\n+ 96\n+ 54\n+ 56\n+ 88\n+ 69\n+ 65\n+ 84\n+ 10\n+ 85\n- 37\n+ 80\n- 53\n+ 25\n- 5\n+ 45\n+ 90\n+ 95\n+ 33\n+ 81\n+ 6\n+ 20\n- 10\n+ 94\n- 61",
"output": "Success\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 2\nConflict with 2\nConflict with 2\nConflict with 2\nConflict with 2\nConflict with 3\nConflict with 5\nConflict with 2\nConflict with 2\nConflict with 5\nSuccess\nConflict with 2\nSuccess\nConflict with 5\nSuccess\nConflict with 3\nConflict with 2\nConflict with 19\nCon..."
},
{
"input": "100000 1\n+ 12345",
"output": "Success"
},
{
"input": "4 2\n+ 2\n+ 4",
"output": "Success\nConflict with 2"
},
{
"input": "100000 2\n+ 57314\n+ 85971",
"output": "Success\nConflict with 57314"
},
{
"input": "100000 4\n+ 81799\n+ 81799\n- 81799\n+ 81799",
"output": "Success\nAlready on\nSuccess\nSuccess"
}
] | 1,678,641,768 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 22 | 2,000 | 0 | import math
str=input()
n=int(str.split()[0])
m=int(str.split()[1])
activated=[]
for i in range(m):
request=input()
if request[0]=='+':
req=int(request[1:])
flag=True
conflict=0
if req in activated:
print("Already on")
else:
for Ai in activated:
if math.gcd(Ai,req)!=1:
flag=False
conflict=Ai
break
if flag==True:
print("Success")
activated.append(req)
else:
print(f"Conflict with {conflict}")
else:
req=int(request[1:])
if req in activated:
print("Success")
activated.remove(req)
else:
print("Already off")
| Title: Colliders
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
By 2312 there were *n* Large Hadron Colliders in the inhabited part of the universe. Each of them corresponded to a single natural number from 1 to *n*. However, scientists did not know what activating several colliders simultaneously could cause, so the colliders were deactivated.
In 2312 there was a startling discovery: a collider's activity is safe if and only if all numbers of activated colliders are pairwise relatively prime to each other (two numbers are relatively prime if their greatest common divisor equals 1)! If two colliders with relatively nonprime numbers are activated, it will cause a global collapse.
Upon learning this, physicists rushed to turn the colliders on and off and carry out all sorts of experiments. To make sure than the scientists' quickness doesn't end with big trouble, the Large Hadron Colliders' Large Remote Control was created. You are commissioned to write the software for the remote (well, you do not expect anybody to operate it manually, do you?).
Initially, all colliders are deactivated. Your program receives multiple requests of the form "activate/deactivate the *i*-th collider". The program should handle requests in the order of receiving them. The program should print the processed results in the format described below.
To the request of "+ i" (that is, to activate the *i*-th collider), the program should print exactly one of the following responses:
- "Success" if the activation was successful. - "Already on", if the *i*-th collider was already activated before the request. - "Conflict with j", if there is a conflict with the *j*-th collider (that is, the *j*-th collider is on, and numbers *i* and *j* are not relatively prime). In this case, the *i*-th collider shouldn't be activated. If a conflict occurs with several colliders simultaneously, you should print the number of any of them.
The request of "- i" (that is, to deactivate the *i*-th collider), should receive one of the following responses from the program:
- "Success", if the deactivation was successful. - "Already off", if the *i*-th collider was already deactivated before the request.
You don't need to print quotes in the output of the responses to the requests.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of colliders and the number of requests, correspondingly.
Next *m* lines contain numbers of requests, one per line, in the form of either "+ i" (without the quotes) — activate the *i*-th collider, or "- i" (without the quotes) — deactivate the *i*-th collider (1<=≤<=*i*<=≤<=*n*).
Output Specification:
Print *m* lines — the results of executing requests in the above given format. The requests should be processed in the order, in which they are given in the input. Don't forget that the responses to the requests should be printed without quotes.
Demo Input:
['10 10\n+ 6\n+ 10\n+ 5\n- 10\n- 5\n- 6\n+ 10\n+ 3\n+ 6\n+ 3\n']
Demo Output:
['Success\nConflict with 6\nSuccess\nAlready off\nSuccess\nSuccess\nSuccess\nSuccess\nConflict with 10\nAlready on\n']
Note:
Note that in the sample the colliders don't turn on after the second and ninth requests. The ninth request could also receive response "Conflict with 3". | ```python
import math
str=input()
n=int(str.split()[0])
m=int(str.split()[1])
activated=[]
for i in range(m):
request=input()
if request[0]=='+':
req=int(request[1:])
flag=True
conflict=0
if req in activated:
print("Already on")
else:
for Ai in activated:
if math.gcd(Ai,req)!=1:
flag=False
conflict=Ai
break
if flag==True:
print("Success")
activated.append(req)
else:
print(f"Conflict with {conflict}")
else:
req=int(request[1:])
if req in activated:
print("Success")
activated.remove(req)
else:
print("Already off")
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Alice has a string consisting of characters 'A', 'B' and 'C'. Bob can use the following transitions on any substring of our string in any order any number of times:
- A BC - B AC - C AB - AAA empty string
Note that a substring is one or more consecutive characters. For given queries, determine whether it is possible to obtain the target string from source. | The first line contains a string *S* (1<=≤<=|*S*|<=≤<=105). The second line contains a string *T* (1<=≤<=|*T*|<=≤<=105), each of these strings consists only of uppercase English letters 'A', 'B' and 'C'.
The third line contains the number of queries *Q* (1<=≤<=*Q*<=≤<=105).
The following *Q* lines describe queries. The *i*-th of these lines contains four space separated integers *a**i*, *b**i*, *c**i*, *d**i*. These represent the *i*-th query: is it possible to create *T*[*c**i*..*d**i*] from *S*[*a**i*..*b**i*] by applying the above transitions finite amount of times?
Here, *U*[*x*..*y*] is a substring of *U* that begins at index *x* (indexed from 1) and ends at index *y*. In particular, *U*[1..|*U*|] is the whole string *U*.
It is guaranteed that 1<=≤<=*a*<=≤<=*b*<=≤<=|*S*| and 1<=≤<=*c*<=≤<=*d*<=≤<=|*T*|. | Print a string of *Q* characters, where the *i*-th character is '1' if the answer to the *i*-th query is positive, and '0' otherwise. | [
"AABCCBAAB\nABCB\n5\n1 3 1 2\n2 2 2 4\n7 9 1 1\n3 4 2 3\n4 5 1 3\n"
] | [
"10011\n"
] | In the first query we can achieve the result, for instance, by using transitions <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c164f8b6e335aa51b97bbd019ca0d7326927314.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
The third query asks for changing AAB to A — but in this case we are not able to get rid of the character 'B'. | 0 | [] | 1,552,655,657 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 1 | 124 | 0 | s = input()
t = input()
l = [0 for i in range(len(s)+1)]
m = [0 for i in range(len(t)+1)]
c = 0
for i in range(1,len(s)+1):
if s[i-1] == 'C' or s[i-1] == 'B':
c += 1
l[i] = c
c = 0
for i in range(1,len(t)+1):
if t[i-1] == 'C' or t[i-1] == 'B':
c += 1
m[i] = c
n = int(input())
s = ''
for i in range(n):
a,b,c,d = map(int, input().strip().split())
q = l[b] - l[a-1]
p = m[d] - m[c-1]
if q%2 == p%2:
s += '1'
else:
s += '0'
print (s) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice has a string consisting of characters 'A', 'B' and 'C'. Bob can use the following transitions on any substring of our string in any order any number of times:
- A BC - B AC - C AB - AAA empty string
Note that a substring is one or more consecutive characters. For given queries, determine whether it is possible to obtain the target string from source.
Input Specification:
The first line contains a string *S* (1<=≤<=|*S*|<=≤<=105). The second line contains a string *T* (1<=≤<=|*T*|<=≤<=105), each of these strings consists only of uppercase English letters 'A', 'B' and 'C'.
The third line contains the number of queries *Q* (1<=≤<=*Q*<=≤<=105).
The following *Q* lines describe queries. The *i*-th of these lines contains four space separated integers *a**i*, *b**i*, *c**i*, *d**i*. These represent the *i*-th query: is it possible to create *T*[*c**i*..*d**i*] from *S*[*a**i*..*b**i*] by applying the above transitions finite amount of times?
Here, *U*[*x*..*y*] is a substring of *U* that begins at index *x* (indexed from 1) and ends at index *y*. In particular, *U*[1..|*U*|] is the whole string *U*.
It is guaranteed that 1<=≤<=*a*<=≤<=*b*<=≤<=|*S*| and 1<=≤<=*c*<=≤<=*d*<=≤<=|*T*|.
Output Specification:
Print a string of *Q* characters, where the *i*-th character is '1' if the answer to the *i*-th query is positive, and '0' otherwise.
Demo Input:
['AABCCBAAB\nABCB\n5\n1 3 1 2\n2 2 2 4\n7 9 1 1\n3 4 2 3\n4 5 1 3\n']
Demo Output:
['10011\n']
Note:
In the first query we can achieve the result, for instance, by using transitions <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c164f8b6e335aa51b97bbd019ca0d7326927314.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
The third query asks for changing AAB to A — but in this case we are not able to get rid of the character 'B'. | ```python
s = input()
t = input()
l = [0 for i in range(len(s)+1)]
m = [0 for i in range(len(t)+1)]
c = 0
for i in range(1,len(s)+1):
if s[i-1] == 'C' or s[i-1] == 'B':
c += 1
l[i] = c
c = 0
for i in range(1,len(t)+1):
if t[i-1] == 'C' or t[i-1] == 'B':
c += 1
m[i] = c
n = int(input())
s = ''
for i in range(n):
a,b,c,d = map(int, input().strip().split())
q = l[b] - l[a-1]
p = m[d] - m[c-1]
if q%2 == p%2:
s += '1'
else:
s += '0'
print (s)
``` | 0 |
|
962 | A | Equator | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first.
On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems.
Determine the index of day when Polycarp will celebrate the equator. | The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests.
The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day. | Print the index of the day when Polycarp will celebrate the equator. | [
"4\n1 3 2 1\n",
"6\n2 2 2 2 2 2\n"
] | [
"2\n",
"3\n"
] | In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training.
In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training. | 0 | [
{
"input": "4\n1 3 2 1",
"output": "2"
},
{
"input": "6\n2 2 2 2 2 2",
"output": "3"
},
{
"input": "1\n10000",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "2\n1 3",
"output": "2"
},
{
"input": "4\n2 1 1 3",
"output": "3"
},
{
"input": "3\n1 1 3",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "2"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "5\n1 2 4 3 5",
"output": "4"
},
{
"input": "5\n2 2 2 4 3",
"output": "4"
},
{
"input": "4\n1 2 3 1",
"output": "3"
},
{
"input": "6\n7 3 10 7 3 11",
"output": "4"
},
{
"input": "2\n3 4",
"output": "2"
},
{
"input": "5\n1 1 1 1 1",
"output": "3"
},
{
"input": "4\n1 3 2 3",
"output": "3"
},
{
"input": "2\n2 3",
"output": "2"
},
{
"input": "3\n32 10 23",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "3\n1 2 4",
"output": "3"
},
{
"input": "6\n3 3 3 2 4 4",
"output": "4"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "5\n1 3 3 1 1",
"output": "3"
},
{
"input": "4\n1 1 1 2",
"output": "3"
},
{
"input": "4\n1 2 1 3",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "2"
},
{
"input": "4\n2 3 3 3",
"output": "3"
},
{
"input": "4\n3 2 3 3",
"output": "3"
},
{
"input": "4\n2 1 1 1",
"output": "2"
},
{
"input": "3\n2 1 4",
"output": "3"
},
{
"input": "2\n6 7",
"output": "2"
},
{
"input": "4\n3 3 4 3",
"output": "3"
},
{
"input": "4\n1 1 2 5",
"output": "4"
},
{
"input": "4\n1 8 7 3",
"output": "3"
},
{
"input": "6\n2 2 2 2 2 3",
"output": "4"
},
{
"input": "3\n2 2 5",
"output": "3"
},
{
"input": "4\n1 1 2 1",
"output": "3"
},
{
"input": "5\n1 1 2 2 3",
"output": "4"
},
{
"input": "5\n9 5 3 4 8",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "2"
},
{
"input": "4\n1 2 2 2",
"output": "3"
},
{
"input": "3\n1 3 5",
"output": "3"
},
{
"input": "4\n1 1 3 6",
"output": "4"
},
{
"input": "6\n1 2 1 1 1 1",
"output": "3"
},
{
"input": "3\n3 1 3",
"output": "2"
},
{
"input": "5\n3 4 5 1 2",
"output": "3"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "5\n3 1 2 5 2",
"output": "4"
},
{
"input": "4\n1 1 1 4",
"output": "4"
},
{
"input": "4\n2 6 1 10",
"output": "4"
},
{
"input": "4\n2 2 3 2",
"output": "3"
},
{
"input": "4\n4 2 2 1",
"output": "2"
},
{
"input": "6\n1 1 1 1 1 4",
"output": "5"
},
{
"input": "3\n3 2 2",
"output": "2"
},
{
"input": "6\n1 3 5 1 7 4",
"output": "5"
},
{
"input": "5\n1 2 4 8 16",
"output": "5"
},
{
"input": "5\n1 2 4 4 4",
"output": "4"
},
{
"input": "6\n4 2 1 2 3 1",
"output": "3"
},
{
"input": "4\n3 2 1 5",
"output": "3"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "3\n2 4 7",
"output": "3"
},
{
"input": "5\n1 1 1 1 3",
"output": "4"
},
{
"input": "3\n3 1 5",
"output": "3"
},
{
"input": "4\n1 2 3 7",
"output": "4"
},
{
"input": "3\n1 4 6",
"output": "3"
},
{
"input": "4\n2 1 2 2",
"output": "3"
},
{
"input": "2\n4 5",
"output": "2"
},
{
"input": "5\n1 2 1 2 1",
"output": "3"
},
{
"input": "3\n2 3 6",
"output": "3"
},
{
"input": "6\n1 1 4 1 1 5",
"output": "4"
},
{
"input": "5\n2 2 2 2 1",
"output": "3"
},
{
"input": "2\n5 6",
"output": "2"
},
{
"input": "4\n2 2 1 4",
"output": "3"
},
{
"input": "5\n2 2 3 4 4",
"output": "4"
},
{
"input": "4\n3 1 1 2",
"output": "2"
},
{
"input": "5\n3 4 1 4 5",
"output": "4"
},
{
"input": "4\n1 3 1 6",
"output": "4"
},
{
"input": "5\n1 1 1 2 2",
"output": "4"
},
{
"input": "4\n1 4 2 4",
"output": "3"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 8",
"output": "9"
},
{
"input": "4\n1 4 5 1",
"output": "3"
},
{
"input": "5\n1 1 1 1 5",
"output": "5"
},
{
"input": "4\n1 3 4 1",
"output": "3"
},
{
"input": "4\n2 2 2 3",
"output": "3"
},
{
"input": "4\n2 3 2 4",
"output": "3"
},
{
"input": "5\n2 2 1 2 2",
"output": "3"
},
{
"input": "3\n4 3 2",
"output": "2"
},
{
"input": "3\n6 5 2",
"output": "2"
},
{
"input": "69\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "35"
},
{
"input": "6\n1 1 1 1 1 2",
"output": "4"
},
{
"input": "5\n1 2 5 4 5",
"output": "4"
},
{
"input": "2\n9 10",
"output": "2"
},
{
"input": "3\n1 1 5",
"output": "3"
},
{
"input": "4\n3 4 3 5",
"output": "3"
},
{
"input": "4\n1 4 3 3",
"output": "3"
},
{
"input": "4\n7 1 3 4",
"output": "2"
},
{
"input": "3\n100 100 1",
"output": "2"
},
{
"input": "4\n5 2 2 2",
"output": "2"
}
] | 1,523,482,968 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 2,000 | 19,660,800 | #Equator .. 962A
def equator(B):
B = [int(x) for x in a]
c = 0
while c < len(B):
if sum(B[0:c]) < sum(B)//2:
c+=1
else:
break
return c
n = int(input())
a = input().split()
print(equator(a))
| Title: Equator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has created his own training plan to prepare for the programming contests. He will train for $n$ days, all days are numbered from $1$ to $n$, beginning from the first.
On the $i$-th day Polycarp will necessarily solve $a_i$ problems. One evening Polycarp plans to celebrate the equator. He will celebrate it on the first evening of such a day that from the beginning of the training and to this day inclusive he will solve half or more of all the problems.
Determine the index of day when Polycarp will celebrate the equator.
Input Specification:
The first line contains a single integer $n$ ($1 \le n \le 200\,000$) — the number of days to prepare for the programming contests.
The second line contains a sequence $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10\,000$), where $a_i$ equals to the number of problems, which Polycarp will solve on the $i$-th day.
Output Specification:
Print the index of the day when Polycarp will celebrate the equator.
Demo Input:
['4\n1 3 2 1\n', '6\n2 2 2 2 2 2\n']
Demo Output:
['2\n', '3\n']
Note:
In the first example Polycarp will celebrate the equator on the evening of the second day, because up to this day (inclusive) he will solve $4$ out of $7$ scheduled problems on four days of the training.
In the second example Polycarp will celebrate the equator on the evening of the third day, because up to this day (inclusive) he will solve $6$ out of $12$ scheduled problems on six days of the training. | ```python
#Equator .. 962A
def equator(B):
B = [int(x) for x in a]
c = 0
while c < len(B):
if sum(B[0:c]) < sum(B)//2:
c+=1
else:
break
return c
n = int(input())
a = input().split()
print(equator(a))
``` | 0 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
] | A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] | [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] | none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,614,157,837 | 2,147,483,647 | Python 3 | OK | TESTS | 102 | 77 | 0 | n1 = input()
n2 = input()
def split(num):
return [int for int in num]
lst1 = []
lst2 = []
s = ''
lst1 = split(n1)
lst2 = split(n2)
for i in range(0, len(lst1)):
k = int(lst1[i])^int(lst2[i])
s = s+str(k)
print(s)
| Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
n1 = input()
n2 = input()
def split(num):
return [int for int in num]
lst1 = []
lst2 = []
s = ''
lst1 = split(n1)
lst2 = split(n2)
for i in range(0, len(lst1)):
k = int(lst1[i])^int(lst2[i])
s = s+str(k)
print(s)
``` | 3.98075 |
66 | B | Petya and Countryside | PROGRAMMING | 1,100 | [
"brute force",
"implementation"
] | B. Petya and Countryside | 2 | 256 | Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000. | Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section. | [
"1\n2\n",
"5\n1 2 1 2 1\n",
"8\n1 2 1 1 1 3 3 4\n"
] | [
"1\n",
"3\n",
"6\n"
] | none | 1,000 | [
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 2 1 2 1",
"output": "3"
},
{
"input": "8\n1 2 1 1 1 3 3 4",
"output": "6"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "10"
},
{
"input": "2\n100 100",
"output": "2"
},
{
"input": "3\n100 100 100",
"output": "3"
},
{
"input": "11\n1 2 3 4 5 6 5 4 3 2 1",
"output": "11"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 100 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 1 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 1 82 83 84 85 86 87 88 89 90 91 92 93 94 100 5 4 3 2 1",
"output": "81"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 1 86 87 88 89 90 91 92 93 100 6 5 4 3 2 1",
"output": "85"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 1 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 100 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 100 8 7 6 1 4 3 2 1",
"output": "96"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 100 10 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 1 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 100 11 10 9 8 7 6 5 4 3 2 1",
"output": "55"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 1 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 100 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "59"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 100 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "86"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 100 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "83"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 100 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 1 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "74"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 100 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 100 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 1 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "52"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 100 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 1 2 1",
"output": "98"
},
{
"input": "10\n1 4 4 4 4 4 1 2 4 3",
"output": "7"
}
] | 1,635,450,617 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 60 | 124 | 4,505,600 | n = int(input())
arr = [int(x) for x in input().split()]
lis = []
np = True
sum = 1
for i in range(n-1):
if arr[i] >= arr[i+1]:
# lis.append(sum)
# sum = 2
sum += 1
np = False
elif arr[i] <arr[i+1] :
if np is True:
sum += 1
else:
lis.append(sum)
sum = 2
np = True
arr.reverse()
np = True
sum = 1
for i in range(n-1):
if arr[i] >= arr[i+1]:
# lis.append(sum)
# sum = 2
sum += 1
np = False
elif arr[i] < arr[i+1]:
if np is True:
sum += 1
else:
lis.append(sum)
sum = 2
np = True
if lis:
print(max(lis))
else:
print(n)
# for i in range(n-1):
# count = 1
# for j in range(i+1, n):
# if a[j] >= a[i]:
# count += 1
# else:
# if j == n-1:
# continue
# elif a[j+1] <= a[j]:
# continue
# else:
# break
# l.append(count)
# for i in range(n-1):
# count1 = 0
# for j in range(i+1, n):
# if a[j] <= a[i]:
# count1 += 1
# else:
# break
# l.append(count1)
# print(l)
# if n == 1:
# print(1)
# else:
# print(max(l))
# for i in range(n-1):
# count = 0
# for j in range(i+1, n):
# if a[i]>= a[j] :
# count+=1
# else:
# break
# l.append(count)
# for i in range(n-1):
# count1 = 0
# for j in range(i+1, n):
# if a[i] <= a[j]:
# count1 += 1
# else:
# break
# l.append(count1)
# if n== 1:
# print(1)
# else:
# # print(max(l)-1)
# n = int(input())
# a = [int(x) for x in input().split()]
# l = []
# for i in range(n-1):
# count = 1
# j = i+1
# k = i+1
# while(j < n):
# if a[j] >= a[i]:
# count += 1
# # i += 1
# j += 1
# else:
# if j == n-1:
# j+=1
# continue
# elif a[j+1] <= a[j]:
# count += 1
# # i += 1
# j += 1
# l.append(count)
# while(k < n):
# count1 = 1
# if a[k] <= a[i]:
# count1 += 1
# # i += 1
# k += 1
# else:
# l.append(count1)
# break
# l.append(count1)
# print(max(l))
| Title: Petya and Countryside
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
Output Specification:
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
Demo Input:
['1\n2\n', '5\n1 2 1 2 1\n', '8\n1 2 1 1 1 3 3 4\n']
Demo Output:
['1\n', '3\n', '6\n']
Note:
none | ```python
n = int(input())
arr = [int(x) for x in input().split()]
lis = []
np = True
sum = 1
for i in range(n-1):
if arr[i] >= arr[i+1]:
# lis.append(sum)
# sum = 2
sum += 1
np = False
elif arr[i] <arr[i+1] :
if np is True:
sum += 1
else:
lis.append(sum)
sum = 2
np = True
arr.reverse()
np = True
sum = 1
for i in range(n-1):
if arr[i] >= arr[i+1]:
# lis.append(sum)
# sum = 2
sum += 1
np = False
elif arr[i] < arr[i+1]:
if np is True:
sum += 1
else:
lis.append(sum)
sum = 2
np = True
if lis:
print(max(lis))
else:
print(n)
# for i in range(n-1):
# count = 1
# for j in range(i+1, n):
# if a[j] >= a[i]:
# count += 1
# else:
# if j == n-1:
# continue
# elif a[j+1] <= a[j]:
# continue
# else:
# break
# l.append(count)
# for i in range(n-1):
# count1 = 0
# for j in range(i+1, n):
# if a[j] <= a[i]:
# count1 += 1
# else:
# break
# l.append(count1)
# print(l)
# if n == 1:
# print(1)
# else:
# print(max(l))
# for i in range(n-1):
# count = 0
# for j in range(i+1, n):
# if a[i]>= a[j] :
# count+=1
# else:
# break
# l.append(count)
# for i in range(n-1):
# count1 = 0
# for j in range(i+1, n):
# if a[i] <= a[j]:
# count1 += 1
# else:
# break
# l.append(count1)
# if n== 1:
# print(1)
# else:
# # print(max(l)-1)
# n = int(input())
# a = [int(x) for x in input().split()]
# l = []
# for i in range(n-1):
# count = 1
# j = i+1
# k = i+1
# while(j < n):
# if a[j] >= a[i]:
# count += 1
# # i += 1
# j += 1
# else:
# if j == n-1:
# j+=1
# continue
# elif a[j+1] <= a[j]:
# count += 1
# # i += 1
# j += 1
# l.append(count)
# while(k < n):
# count1 = 1
# if a[k] <= a[i]:
# count1 += 1
# # i += 1
# k += 1
# else:
# l.append(count1)
# break
# l.append(count1)
# print(max(l))
``` | 0 |
892 | B | Wrath | PROGRAMMING | 1,200 | [
"greedy",
"implementation",
"two pointers"
] | null | null | Hands that shed innocent blood!
There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=<<=*i* and *j*<=≥<=*i*<=-<=*L**i*.
You are given lengths of the claws. You need to find the total number of alive people after the bell rings. | The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people.
Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw. | Print one integer — the total number of alive people after the bell rings. | [
"4\n0 1 0 10\n",
"2\n0 0\n",
"10\n1 1 3 0 0 0 2 1 0 3\n"
] | [
"1\n",
"2\n",
"3\n"
] | In first sample the last person kills everyone in front of him. | 1,000 | [
{
"input": "4\n0 1 0 10",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "10\n1 1 3 0 0 0 2 1 0 3",
"output": "3"
},
{
"input": "10\n0 0 2 0 0 3 3 2 2 0",
"output": "2"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "5\n0 0 0 1 0",
"output": "4"
},
{
"input": "6\n3 1 1 0 3 3",
"output": "1"
},
{
"input": "8\n0 0 0 1 0 0 1 2",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "2\n1 3",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "1"
},
{
"input": "11\n1 0 0 1 1 3 2 0 0 2 3",
"output": "4"
},
{
"input": "1\n1",
"output": "1"
}
] | 1,655,519,080 | 2,147,483,647 | PyPy 3 | OK | TESTS | 43 | 935 | 74,854,400 | import sys
input = sys.stdin.readline
n = int(input())
w = list(map(int, input().split()))
d = n-1-w[-1]
c = 1
for i in range(n-2, -1, -1):
if i < d:
c += 1
d1 = i-w[i]
d = min(d, d1)
print(c) | Title: Wrath
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Hands that shed innocent blood!
There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=<<=*i* and *j*<=≥<=*i*<=-<=*L**i*.
You are given lengths of the claws. You need to find the total number of alive people after the bell rings.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people.
Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw.
Output Specification:
Print one integer — the total number of alive people after the bell rings.
Demo Input:
['4\n0 1 0 10\n', '2\n0 0\n', '10\n1 1 3 0 0 0 2 1 0 3\n']
Demo Output:
['1\n', '2\n', '3\n']
Note:
In first sample the last person kills everyone in front of him. | ```python
import sys
input = sys.stdin.readline
n = int(input())
w = list(map(int, input().split()))
d = n-1-w[-1]
c = 1
for i in range(n-2, -1, -1):
if i < d:
c += 1
d1 = i-w[i]
d = min(d, d1)
print(c)
``` | 3 |
|
330 | A | Cakeminator | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat. | The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry. | Output the maximum number of cake cells that the cakeminator can eat. | [
"3 4\nS...\n....\n..S.\n"
] | [
"8\n"
] | For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | 500 | [
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,588,258,917 | 2,147,483,647 | Python 3 | OK | TESTS | 42 | 218 | 0 | r, c = map(int, input().split())
lst = [[s for s in input()] for _ in range(r)]
count, col = 0, set()
for i in range(r):
if 'S' not in lst[i]:
count += 1
for j in range(c):
if lst[i][j] == 'S':
col.add(j)
print((c - len(col)) * (r - count) + count * c) | Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | ```python
r, c = map(int, input().split())
lst = [[s for s in input()] for _ in range(r)]
count, col = 0, set()
for i in range(r):
if 'S' not in lst[i]:
count += 1
for j in range(c):
if lst[i][j] == 'S':
col.add(j)
print((c - len(col)) * (r - count) + count * c)
``` | 3 |
|
75 | A | Life Without Zeros | PROGRAMMING | 1,000 | [
"implementation"
] | A. Life Without Zeros | 2 | 256 | Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation. | The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*. | The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise. | [
"101\n102\n",
"105\n106\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "101\n102",
"output": "YES"
},
{
"input": "105\n106",
"output": "NO"
},
{
"input": "544\n397",
"output": "YES"
},
{
"input": "822\n280",
"output": "NO"
},
{
"input": "101\n413",
"output": "NO"
},
{
"input": "309\n139",
"output": "NO"
},
{
"input": "693\n970",
"output": "NO"
},
{
"input": "981\n1",
"output": "YES"
},
{
"input": "352\n276",
"output": "YES"
},
{
"input": "164\n691",
"output": "YES"
},
{
"input": "110036\n43",
"output": "YES"
},
{
"input": "100\n1000",
"output": "NO"
},
{
"input": "1000000000\n1000000000",
"output": "YES"
},
{
"input": "999999999\n999999999",
"output": "YES"
},
{
"input": "6\n4",
"output": "NO"
},
{
"input": "123456\n876543",
"output": "YES"
},
{
"input": "1234567\n9876543",
"output": "NO"
},
{
"input": "1111111\n1119111",
"output": "NO"
},
{
"input": "10502405\n40403403",
"output": "YES"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "5\n4",
"output": "YES"
},
{
"input": "1\n6",
"output": "YES"
},
{
"input": "40\n17",
"output": "NO"
},
{
"input": "35\n81",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "2081\n7450",
"output": "NO"
},
{
"input": "84355694\n373629503",
"output": "NO"
},
{
"input": "885992048\n510468672",
"output": "NO"
},
{
"input": "540144752\n647307841",
"output": "NO"
},
{
"input": "341781108\n784147010",
"output": "NO"
},
{
"input": "960440938\n572334653",
"output": "NO"
},
{
"input": "657414510\n768771903",
"output": "NO"
},
{
"input": "501871728\n725074574",
"output": "NO"
},
{
"input": "968\n851",
"output": "YES"
},
{
"input": "943\n939",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "611\n41",
"output": "YES"
},
{
"input": "737\n289",
"output": "NO"
},
{
"input": "168\n571",
"output": "YES"
},
{
"input": "868\n463",
"output": "YES"
},
{
"input": "815732007\n913882008",
"output": "NO"
},
{
"input": "459039901\n453033850",
"output": "NO"
},
{
"input": "975305404\n484601256",
"output": "NO"
}
] | 1,572,374,876 | 2,147,483,647 | PyPy 3 | OK | TESTS | 43 | 310 | 0 | a=input()
b=input()
c=int(a)+int(b)
c=str(c)
# print(a,b,c)
a0=a.count('0')
b0=b.count('0')
c0=c.count('0')
a=a.replace('0','',a0)
b=b.replace('0','',b0)
c=c.replace('0','',c0)
# print(a,b,c)
if int(a)+int(b)==int(c):
print('YES')
else:
print('NO')
| Title: Life Without Zeros
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
Input Specification:
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
Output Specification:
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
Demo Input:
['101\n102\n', '105\n106\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
a=input()
b=input()
c=int(a)+int(b)
c=str(c)
# print(a,b,c)
a0=a.count('0')
b0=b.count('0')
c0=c.count('0')
a=a.replace('0','',a0)
b=b.replace('0','',b0)
c=c.replace('0','',c0)
# print(a,b,c)
if int(a)+int(b)==int(c):
print('YES')
else:
print('NO')
``` | 3.9225 |
813 | C | The Tag Game | PROGRAMMING | 1,700 | [
"dfs and similar",
"graphs"
] | null | null | Alice got tired of playing the tag game by the usual rules so she offered Bob a little modification to it. Now the game should be played on an undirected rooted tree of *n* vertices. Vertex 1 is the root of the tree.
Alice starts at vertex 1 and Bob starts at vertex *x* (*x*<=≠<=1). The moves are made in turns, Bob goes first. In one move one can either stay at the current vertex or travel to the neighbouring one.
The game ends when Alice goes to the same vertex where Bob is standing. Alice wants to minimize the total number of moves and Bob wants to maximize it.
You should write a program which will determine how many moves will the game last. | The first line contains two integer numbers *n* and *x* (2<=≤<=*n*<=≤<=2·105, 2<=≤<=*x*<=≤<=*n*).
Each of the next *n*<=-<=1 lines contains two integer numbers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=*n*) — edges of the tree. It is guaranteed that the edges form a valid tree. | Print the total number of moves Alice and Bob will make. | [
"4 3\n1 2\n2 3\n2 4\n",
"5 2\n1 2\n2 3\n3 4\n2 5\n"
] | [
"4\n",
"6\n"
] | In the first example the tree looks like this:
The red vertex is Alice's starting position, the blue one is Bob's. Bob will make the game run the longest by standing at the vertex 3 during all the game. So here are the moves:
B: stay at vertex 3
A: go to vertex 2
B: stay at vertex 3
A: go to vertex 3
In the second example the tree looks like this:
The moves in the optimal strategy are:
B: go to vertex 3
A: go to vertex 2
B: go to vertex 4
A: go to vertex 3
B: stay at vertex 4
A: go to vertex 4 | 0 | [
{
"input": "4 3\n1 2\n2 3\n2 4",
"output": "4"
},
{
"input": "5 2\n1 2\n2 3\n3 4\n2 5",
"output": "6"
},
{
"input": "2 2\n2 1",
"output": "2"
},
{
"input": "3 3\n2 1\n3 1",
"output": "2"
},
{
"input": "3 3\n1 2\n3 2",
"output": "4"
},
{
"input": "10 4\n5 4\n8 3\n4 6\n5 3\n7 9\n1 3\n5 10\n2 9\n9 8",
"output": "8"
},
{
"input": "10 7\n8 7\n2 8\n2 3\n10 6\n4 6\n4 1\n10 5\n7 5\n9 8",
"output": "16"
},
{
"input": "8 3\n2 1\n3 1\n4 3\n5 1\n6 1\n7 1\n8 6",
"output": "4"
},
{
"input": "34 33\n2 1\n3 2\n4 3\n5 2\n6 3\n7 2\n8 5\n9 7\n10 8\n11 7\n12 7\n13 8\n14 2\n15 10\n16 1\n17 9\n18 14\n19 1\n20 2\n21 8\n22 21\n23 9\n24 6\n25 2\n26 20\n27 5\n28 20\n29 2\n30 10\n31 14\n32 12\n33 15\n34 8",
"output": "12"
}
] | 1,550,649,886 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 13 | 1,000 | 22,323,200 | def prog():
from sys import stdin
n,x = map(int,stdin.readline().split())
x-=1
d = [[] for i in range(n)]
for i in range(n-1):
a,b = map(int,stdin.readline().split())
d[a-1].append(b-1)
d[b-1].append(a-1)
Alice = [1000000 for i in range(n)]
Bob = [1000000 for i in range(n)]
queue=[[0,0]]
while queue:
q1 = queue.pop(0)
Alice[q1[0]]=min(Alice[q1[0]],q1[1])
for i,item in enumerate(d[q1[0]]):
if Alice[item]==1000000:
queue.append([item,q1[1]+1])
queue=[[x,0]]
while queue:
q2 = queue.pop(0)
Bob[q2[0]]=min(Bob[q2[0]],q2[1])
for i,item in enumerate(d[q2[0]]):
if Bob[item]==1000000:
queue.append([item,q2[1]+1])
res = 0
for i in range(n):
A=Alice[i]
if A>Bob[i]:
if A>res:
res=A
print(2*res)
prog() | Title: The Tag Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice got tired of playing the tag game by the usual rules so she offered Bob a little modification to it. Now the game should be played on an undirected rooted tree of *n* vertices. Vertex 1 is the root of the tree.
Alice starts at vertex 1 and Bob starts at vertex *x* (*x*<=≠<=1). The moves are made in turns, Bob goes first. In one move one can either stay at the current vertex or travel to the neighbouring one.
The game ends when Alice goes to the same vertex where Bob is standing. Alice wants to minimize the total number of moves and Bob wants to maximize it.
You should write a program which will determine how many moves will the game last.
Input Specification:
The first line contains two integer numbers *n* and *x* (2<=≤<=*n*<=≤<=2·105, 2<=≤<=*x*<=≤<=*n*).
Each of the next *n*<=-<=1 lines contains two integer numbers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=*n*) — edges of the tree. It is guaranteed that the edges form a valid tree.
Output Specification:
Print the total number of moves Alice and Bob will make.
Demo Input:
['4 3\n1 2\n2 3\n2 4\n', '5 2\n1 2\n2 3\n3 4\n2 5\n']
Demo Output:
['4\n', '6\n']
Note:
In the first example the tree looks like this:
The red vertex is Alice's starting position, the blue one is Bob's. Bob will make the game run the longest by standing at the vertex 3 during all the game. So here are the moves:
B: stay at vertex 3
A: go to vertex 2
B: stay at vertex 3
A: go to vertex 3
In the second example the tree looks like this:
The moves in the optimal strategy are:
B: go to vertex 3
A: go to vertex 2
B: go to vertex 4
A: go to vertex 3
B: stay at vertex 4
A: go to vertex 4 | ```python
def prog():
from sys import stdin
n,x = map(int,stdin.readline().split())
x-=1
d = [[] for i in range(n)]
for i in range(n-1):
a,b = map(int,stdin.readline().split())
d[a-1].append(b-1)
d[b-1].append(a-1)
Alice = [1000000 for i in range(n)]
Bob = [1000000 for i in range(n)]
queue=[[0,0]]
while queue:
q1 = queue.pop(0)
Alice[q1[0]]=min(Alice[q1[0]],q1[1])
for i,item in enumerate(d[q1[0]]):
if Alice[item]==1000000:
queue.append([item,q1[1]+1])
queue=[[x,0]]
while queue:
q2 = queue.pop(0)
Bob[q2[0]]=min(Bob[q2[0]],q2[1])
for i,item in enumerate(d[q2[0]]):
if Bob[item]==1000000:
queue.append([item,q2[1]+1])
res = 0
for i in range(n):
A=Alice[i]
if A>Bob[i]:
if A>res:
res=A
print(2*res)
prog()
``` | 0 |
|
572 | A | Arrays | PROGRAMMING | 900 | [
"sortings"
] | null | null | You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array. | The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*. | Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes). | [
"3 3\n2 1\n1 2 3\n3 4 5\n",
"3 3\n3 3\n1 2 3\n3 4 5\n",
"5 2\n3 1\n1 1 1 1 1\n2 2\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 500 | [
{
"input": "3 3\n2 1\n1 2 3\n3 4 5",
"output": "YES"
},
{
"input": "3 3\n3 3\n1 2 3\n3 4 5",
"output": "NO"
},
{
"input": "5 2\n3 1\n1 1 1 1 1\n2 2",
"output": "YES"
},
{
"input": "3 5\n1 1\n5 5 5\n5 5 5 5 5",
"output": "NO"
},
{
"input": "1 1\n1 1\n1\n1",
"output": "NO"
},
{
"input": "3 3\n1 1\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n1 2\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n2 2\n1 2 3\n1 2 3",
"output": "NO"
},
{
"input": "10 15\n10 1\n1 1 5 17 22 29 32 36 39 48\n9 10 20 23 26 26 32 32 33 39 43 45 47 49 49",
"output": "YES"
},
{
"input": "10 15\n1 15\n91 91 91 92 92 94 94 95 98 100\n92 92 93 93 93 94 95 96 97 98 98 99 99 100 100",
"output": "YES"
},
{
"input": "15 10\n12 5\n9 25 25 32 32 38 40 41 46 46 48 51 64 64 73\n5 14 30 35 50 52 67 79 89 99",
"output": "YES"
},
{
"input": "15 10\n4 10\n22 32 35 45 45 50 51 55 79 80 83 88 90 92 93\n46 48 52 55 60 60 68 75 80 81",
"output": "YES"
},
{
"input": "20 30\n2 8\n6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 10\n1 1 2 2 2 2 2 2 2 3 3 4 5 5 5 5 6 6 6 6 6 6 7 7 7 8 8 9 10 10",
"output": "NO"
},
{
"input": "20 30\n19 29\n1 1 2 2 2 3 4 4 7 7 7 8 8 8 8 8 9 9 9 9\n6 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "1 1\n1 1\n-1000000000\n30",
"output": "YES"
},
{
"input": "3 3\n1 3\n1 3 3\n3 3 3",
"output": "YES"
},
{
"input": "3 3\n1 1\n3 3 3\n2 2 2",
"output": "NO"
},
{
"input": "5 5\n3 3\n1 5 6 7 8\n1 2 5 6 7",
"output": "NO"
},
{
"input": "3 4\n2 2\n5 6 7\n1 2 3 4",
"output": "NO"
},
{
"input": "3 3\n3 3\n1 2 3\n4 5 6",
"output": "YES"
},
{
"input": "5 5\n4 5\n2 2 3 4 5\n5 6 7 8 9",
"output": "YES"
}
] | 1,615,491,988 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 8 | 2,000 | 7,270,400 | bos = input('')
adet = input('').split()
for i in adet:
adet[adet.index(i)] = int(i)
list1 = input('').split()
for i in list1:
list1[list1.index(i)] = int(i)
list2 = input('').split()
for i in list2:
list2[list2.index(i)] = int(i)
list2[::] = list2[::-1]
if list1[adet[0]-1]>=list2[adet[1]-1]:
print('NO')
else:
print('YES') | Title: Arrays
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
Input Specification:
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
Output Specification:
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
Demo Input:
['3 3\n2 1\n1 2 3\n3 4 5\n', '3 3\n3 3\n1 2 3\n3 4 5\n', '5 2\n3 1\n1 1 1 1 1\n2 2\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
bos = input('')
adet = input('').split()
for i in adet:
adet[adet.index(i)] = int(i)
list1 = input('').split()
for i in list1:
list1[list1.index(i)] = int(i)
list2 = input('').split()
for i in list2:
list2[list2.index(i)] = int(i)
list2[::] = list2[::-1]
if list1[adet[0]-1]>=list2[adet[1]-1]:
print('NO')
else:
print('YES')
``` | 0 |
|
5 | C | Longest Regular Bracket Sequence | PROGRAMMING | 1,900 | [
"constructive algorithms",
"data structures",
"dp",
"greedy",
"sortings",
"strings"
] | C. Longest Regular Bracket Sequence | 2 | 256 | This is yet another problem dealing with regular bracket sequences.
We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well. | The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106. | Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1". | [
")((())))(()())\n",
"))(\n"
] | [
"6 2\n",
"0 1\n"
] | none | 0 | [
{
"input": ")((())))(()())",
"output": "6 2"
},
{
"input": "))(",
"output": "0 1"
},
{
"input": "()(())()",
"output": "8 1"
},
{
"input": "((((()(((",
"output": "2 1"
},
{
"input": "))))()())))",
"output": "4 1"
},
{
"input": "(()())()(())()()())())()((()(()(())()()())((()(())()(()()()()))()(())()(((()())()(()((())()(())(()))",
"output": "28 1"
},
{
"input": ")(()(((((())))))(((()))))))((()(((((((())())()))))((((((((())))((((((())))))(()((((()))))(()))))))))",
"output": "68 1"
},
{
"input": "())(((((())())((((()))(())))())())(((()(()()()())(())()))((()(())())()()))()(()())))))(()))((())((((",
"output": "80 1"
},
{
"input": "))(((((((()((((())(((((((((()()))))(()())()((())())))((((()))(()()()))))(()()))())))))((())())()))((",
"output": "92 1"
}
] | 1,625,315,245 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 13 | 2,000 | 614,400 | string=input()
n=len(string)
brackets=[]
bracket_sum=[]
bracket_len=[]
valid_brackets=[0]
invalid_index=[]
for char in string:
bracket_sum.append(0)
bracket_len.append(0)
if char=='(':
bracket_sum=[i+1 for i in bracket_sum]
else:
bracket_sum=[i-1 for i in bracket_sum]
for j in range(len(bracket_sum)):
if bracket_sum[j]<0 :
if j not in invalid_index:
invalid_index.append(j)
for ind in invalid_index:
bracket_sum[ind]=-1
if 0 in bracket_sum :
index=bracket_sum.index(0)
valid_brackets.append(len(bracket_len)-index)
if bracket_sum[0]<0 :
brackets.extend(valid_brackets)
bracket_sum=[]
bracket_len=[]
valid_brackets=[0]
invalid_index=[]
try:
brackets.extend(valid_brackets)
except:
pass
m=max(brackets)
if m==0:
print(0,1)
else:
print(m,brackets.count(m))
| Title: Longest Regular Bracket Sequence
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
This is yet another problem dealing with regular bracket sequences.
We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well.
Input Specification:
The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106.
Output Specification:
Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1".
Demo Input:
[')((())))(()())\n', '))(\n']
Demo Output:
['6 2\n', '0 1\n']
Note:
none | ```python
string=input()
n=len(string)
brackets=[]
bracket_sum=[]
bracket_len=[]
valid_brackets=[0]
invalid_index=[]
for char in string:
bracket_sum.append(0)
bracket_len.append(0)
if char=='(':
bracket_sum=[i+1 for i in bracket_sum]
else:
bracket_sum=[i-1 for i in bracket_sum]
for j in range(len(bracket_sum)):
if bracket_sum[j]<0 :
if j not in invalid_index:
invalid_index.append(j)
for ind in invalid_index:
bracket_sum[ind]=-1
if 0 in bracket_sum :
index=bracket_sum.index(0)
valid_brackets.append(len(bracket_len)-index)
if bracket_sum[0]<0 :
brackets.extend(valid_brackets)
bracket_sum=[]
bracket_len=[]
valid_brackets=[0]
invalid_index=[]
try:
brackets.extend(valid_brackets)
except:
pass
m=max(brackets)
if m==0:
print(0,1)
else:
print(m,brackets.count(m))
``` | 0 |
544 | A | Set of Strings | PROGRAMMING | 1,100 | [
"implementation",
"strings"
] | null | null | You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct.
Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist. | The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence.
The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive. | If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*.
If there are multiple possible answers, print any of them. | [
"1\nabca\n",
"2\naaacas\n",
"4\nabc\n"
] | [
"YES\nabca\n",
"YES\naaa\ncas\n",
"NO\n"
] | In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}. | 500 | [
{
"input": "1\nabca",
"output": "YES\nabca"
},
{
"input": "2\naaacas",
"output": "YES\naaa\ncas"
},
{
"input": "4\nabc",
"output": "NO"
},
{
"input": "3\nnddkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk",
"output": "YES\nn\ndd\nkhkhkdndknndkhrnhddkrdhrnrrnkkdnnndndrdhnknknhnrnnkrrdhrkhkrkhnkhkhhrhdnrndnknrrhdrdrkhdrkkhkrnkk"
},
{
"input": "26\nbiibfmmfifmffbmmfmbmbmiimbmiffmffibibfbiffibibiiimbffbbfbifmiibffbmbbbfmfibmibfffibfbffmfmimbmmmfmfm",
"output": "NO"
},
{
"input": "3\nkydoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia",
"output": "YES\nk\ny\ndoybxlfeugtrbvqnrjtzshorrsrwsxkvlwyolbaadtzpmyyfllxuciia"
},
{
"input": "3\nssussususskkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus",
"output": "YES\nss\nussususs\nkkskkskuusksuuussksukkskuksukukusssususuususkkuukssuksskusukkssuksskskuskusussusskskksksus"
},
{
"input": "5\naaaaabcdef",
"output": "YES\naaaaa\nb\nc\nd\nef"
},
{
"input": "3\niiiiiiimiriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc",
"output": "YES\niiiiiii\nmi\nriiriwmimtmwrhhxmbmhwgghhgbqhywebrblyhlxjrthoooltehrmdhqhuodjmsjwcgrfnttiitpmqvbhlafwtzyikc"
},
{
"input": "20\ngggggllglgllltgtlglttstsgtttsslhhlssghgagtlsaghhoggtfgsaahtotdodthfltdxggxislnttlanxonhnkddtigppitdh",
"output": "NO"
},
{
"input": "16\nkkkkkkyykkynkknkkonyokdndkyonokdywkwykdkdotknnwzkoywiooinkcyzyntcdnitnppnpziomyzdspomoqmomcyrrospppn",
"output": "NO"
},
{
"input": "15\nwwwgggowgwwhoohwgwghwyohhggywhyyodgwydwgggkhgyydqyggkgkpokgthqghidhworprodtcogqkwgtfiodwdurcctkmrfmh",
"output": "YES\nwww\nggg\nowgww\nhoohwgwghw\nyohhggywhyyo\ndgwydwggg\nkhgyyd\nqyggkgk\npokg\nthqgh\nidhwo\nrprodt\ncogqkwgt\nfiodwd\nurcctkmrfmh"
},
{
"input": "15\nnnnnnntnttttttqqnqqynnqqwwnnnwneenhwtyhhoqeyeqyeuthwtnhtpnphhwetjhouhwnpojvvovoswwjryrwerbwwpbvrwvjj",
"output": "YES\nnnnnnn\ntntttttt\nqqnqq\nynnqq\nwwnnnwn\neen\nhwtyhh\noqeyeqye\nuthwtnht\npnphhwet\njhouhwnpoj\nvvovo\nswwj\nryrwer\nbwwpbvrwvjj"
},
{
"input": "15\nvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "1\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai",
"output": "YES\niiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiaaaaaiiiiaiaiiiiaaiaiiiaiiaiaaiaiiaiiiiiaiiiaiiiaiaiaai"
},
{
"input": "26\nvvvnnsnnnpsnnswwspncvshtncwphaphmwnwkhvvhuvctvnehemowkmtzissswjaxuuvphzrmfzihamdqmmyhhijbitlipgltyy",
"output": "YES\nvvv\nnn\nsnnn\npsnns\nwwspn\ncvs\nh\ntncwph\naph\nmwnw\nkhvvh\nuvctvn\nehem\nowkmt\nz\nisssw\nja\nxuuvphz\nrm\nfziham\nd\nqmm\nyhhij\nbit\nlip\ngltyy"
},
{
"input": "26\njexzsbwaih",
"output": "NO"
},
{
"input": "1\nk",
"output": "YES\nk"
},
{
"input": "1\nzz",
"output": "YES\nzz"
},
{
"input": "3\nziw",
"output": "YES\nz\ni\nw"
},
{
"input": "26\ntjmbyqwuahlixegopkzrfndcsv",
"output": "YES\nt\nj\nm\nb\ny\nq\nw\nu\na\nh\nl\ni\nx\ne\ng\no\np\nk\nz\nr\nf\nn\nd\nc\ns\nv"
},
{
"input": "25\nvobekscyadzqwnjxruplifmthg",
"output": "YES\nv\no\nb\ne\nk\ns\nc\ny\na\nd\nz\nq\nw\nn\nj\nx\nr\nu\np\nl\ni\nf\nm\nt\nhg"
},
{
"input": "26\nlllplzkkzflzflffzznnnnfgflqlttlmtnkzlztskngyymitqagattkdllyutzimsrskpapcmuupjdopxqlnhqcscwvdtxbflefy",
"output": "YES\nlll\npl\nz\nkkz\nflzflffzz\nnnnnf\ngfl\nql\nttl\nmtnkzlzt\nskng\nyym\nitq\nagattk\ndlly\nutzims\nrskpap\ncmuup\njd\nop\nxqln\nhqcsc\nw\nvdtx\nbfl\nefy"
},
{
"input": "25\nkkrrkrkrkrsrskpskbrppdsdbgbkrbllkbswdwcchgskmkhwiidicczlscsodtjglxbmeotzxnmbjmoqgkquglaoxgcykxvbhdi",
"output": "YES\nkk\nrrkrkrkr\nsrsk\npsk\nbrpp\ndsdb\ngbkrb\nllkbs\nwdw\ncc\nhgsk\nmkhw\niidicc\nzlscs\nod\nt\njgl\nxbm\neotzx\nnmbjmo\nqgkq\nugl\naoxgc\nykx\nvbhdi"
},
{
"input": "25\nuuuuuccpucubccbupxubcbpujiliwbpqbpyiweuywaxwqasbsllwehceruytjvphytraawgbjmerfeymoayujqranlvkpkiypadr",
"output": "YES\nuuuuu\ncc\npucu\nbccbup\nxubcbpu\nj\ni\nli\nwbp\nqbp\nyiw\neuyw\naxwqa\nsbsllwe\nhce\nruy\ntj\nvphytraaw\ngbj\nmer\nfeym\noayujqra\nnlv\nkpkiypa\ndr"
},
{
"input": "26\nxxjxodrogovufvohrodliretxxyjqnrbzmicorptkjafiwmsbwml",
"output": "YES\nxx\njx\no\nd\nro\ngo\nv\nu\nfvo\nhrod\nl\nir\ne\ntxx\nyj\nq\nnr\nb\nz\nmi\ncor\npt\nkj\nafi\nwm\nsbwml"
},
{
"input": "26\npjhsxjbvkqntwmsdnrguecaofylzti",
"output": "YES\np\nj\nh\ns\nxj\nb\nv\nk\nq\nn\nt\nw\nms\ndn\nr\ng\nu\ne\nc\na\no\nf\ny\nl\nzt\ni"
},
{
"input": "25\nrrrrqqwrlqrwglrlylwhrrwyvrhvzgvqahrhgsvavtggyduayivxzgeicinlnrkapoepbsfyjjrt",
"output": "YES\nrrrr\nqq\nwr\nlqrw\nglrl\nylw\nhrrwy\nvrhv\nzgvq\nahrhg\nsvav\ntggy\nd\nuay\niv\nxzg\nei\nci\nnlnr\nka\np\noep\nbs\nfy\njjrt"
},
{
"input": "26\ncccccccaacwwaxxaacczacnnnqqwnaggzqrwagcnabxnrcvgjqjamqzgdntzanaxvjfwqlvdttuzjoxiwtkqvrydospmpeirhg",
"output": "YES\nccccccc\naac\nwwa\nxxaacc\nzac\nnnn\nqqwna\nggzq\nrwagcna\nbxnrc\nvg\njqja\nmqzg\ndn\ntzanaxvj\nfwq\nlvdtt\nuzj\nox\niwt\nkqvr\nydo\ns\npmp\neir\nhg"
},
{
"input": "4\nsssssssssssssssssssssssssslsslslsllsslssslslssllaaslsaalsasaassllasasalrlrslarlaarlsrsaslasarlr",
"output": "YES\nssssssssssssssssssssssssss\nlsslslsllsslssslslssll\naaslsaalsasaassllasasal\nrlrslarlaarlsrsaslasarlr"
},
{
"input": "26\na",
"output": "NO"
},
{
"input": "26\nab",
"output": "NO"
},
{
"input": "2\nab",
"output": "YES\na\nb"
}
] | 1,474,273,430 | 2,147,483,647 | Python 3 | OK | TESTS | 33 | 61 | 0 | I=input
P=print
k=int(I())
r=[]
i=0
s=I()
while i<len(s) and k>0:
j=i+1
while j<len(s)and any(map(lambda x:x[0]==s[j],[s[i]]+r)):j+=1
r+=[s[i:j]];k-=1;i=j
if k:P('NO')
else:
P('YES',end='')
t=0
for i in r:P('\n'+i,end='');t+=len(i)
P(s[t:]) | Title: Set of Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *q*. A sequence of *k* strings *s*1,<=*s*2,<=...,<=*s**k* is called beautiful, if the concatenation of these strings is string *q* (formally, *s*1<=+<=*s*2<=+<=...<=+<=*s**k*<==<=*q*) and the first characters of these strings are distinct.
Find any beautiful sequence of strings or determine that the beautiful sequence doesn't exist.
Input Specification:
The first line contains a positive integer *k* (1<=≤<=*k*<=≤<=26) — the number of strings that should be in a beautiful sequence.
The second line contains string *q*, consisting of lowercase Latin letters. The length of the string is within range from 1 to 100, inclusive.
Output Specification:
If such sequence doesn't exist, then print in a single line "NO" (without the quotes). Otherwise, print in the first line "YES" (without the quotes) and in the next *k* lines print the beautiful sequence of strings *s*1,<=*s*2,<=...,<=*s**k*.
If there are multiple possible answers, print any of them.
Demo Input:
['1\nabca\n', '2\naaacas\n', '4\nabc\n']
Demo Output:
['YES\nabca\n', 'YES\naaa\ncas\n', 'NO\n']
Note:
In the second sample there are two possible answers: {"*aaaca*", "*s*"} and {"*aaa*", "*cas*"}. | ```python
I=input
P=print
k=int(I())
r=[]
i=0
s=I()
while i<len(s) and k>0:
j=i+1
while j<len(s)and any(map(lambda x:x[0]==s[j],[s[i]]+r)):j+=1
r+=[s[i:j]];k-=1;i=j
if k:P('NO')
else:
P('YES',end='')
t=0
for i in r:P('\n'+i,end='');t+=len(i)
P(s[t:])
``` | 3 |
|
609 | B | The Best Gift | PROGRAMMING | 1,100 | [
"constructive algorithms",
"implementation"
] | null | null | Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*. | The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre. | Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109. | [
"4 3\n2 1 3 1\n",
"7 4\n4 2 3 1 2 4 3\n"
] | [
"5\n",
"18\n"
] | The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books. | 0 | [
{
"input": "4 3\n2 1 3 1",
"output": "5"
},
{
"input": "7 4\n4 2 3 1 2 4 3",
"output": "18"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "3 2\n1 2 2",
"output": "2"
},
{
"input": "10 10\n1 2 3 4 5 6 7 8 9 10",
"output": "45"
},
{
"input": "9 2\n1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "12 3\n1 2 3 1 2 3 1 2 3 1 2 3",
"output": "48"
},
{
"input": "100 3\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3",
"output": "3296"
},
{
"input": "100 5\n5 5 2 4 5 4 4 4 4 2 5 3 4 2 4 4 1 1 5 3 2 2 1 3 3 2 5 3 4 5 1 3 5 4 4 4 3 1 4 4 3 4 5 2 5 4 2 1 2 2 3 5 5 5 1 4 5 3 1 4 2 2 5 1 5 3 4 1 5 1 2 2 3 5 1 3 2 4 2 4 2 2 4 1 3 5 2 2 2 3 3 4 3 2 2 5 5 4 2 5",
"output": "3953"
},
{
"input": "100 10\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "4428"
}
] | 1,620,194,604 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 77 | 0 | n, m = list(map(int, input().split()))
a = list(map(int, input().split()))
c = {}
for i in a:
if i in c:
c[i] += 1
else:
c[i] = 0
t = 0
for i in range(n):
c[a[i]] -= 1
t += len(a[i+1:]) - c[a[i]]
print(t) | Title: The Best Gift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*.
Input Specification:
The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre.
Output Specification:
Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109.
Demo Input:
['4 3\n2 1 3 1\n', '7 4\n4 2 3 1 2 4 3\n']
Demo Output:
['5\n', '18\n']
Note:
The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books. | ```python
n, m = list(map(int, input().split()))
a = list(map(int, input().split()))
c = {}
for i in a:
if i in c:
c[i] += 1
else:
c[i] = 0
t = 0
for i in range(n):
c[a[i]] -= 1
t += len(a[i+1:]) - c[a[i]]
print(t)
``` | 0 |
|
952 | A | Quirky Quantifiers | PROGRAMMING | 800 | [
"math"
] | null | null | The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output 0 or 1. | The input contains a single integer *a* (10<=≤<=*a*<=≤<=999). | Output 0 or 1. | [
"13\n",
"927\n",
"48\n"
] | [
"1\n",
"1\n",
"0\n"
] | none | 0 | [
{
"input": "13",
"output": "1"
},
{
"input": "927",
"output": "1"
},
{
"input": "48",
"output": "0"
},
{
"input": "10",
"output": "0"
},
{
"input": "999",
"output": "1"
},
{
"input": "142",
"output": "0"
},
{
"input": "309",
"output": "1"
},
{
"input": "572",
"output": "0"
},
{
"input": "835",
"output": "1"
},
{
"input": "990",
"output": "0"
},
{
"input": "168",
"output": "0"
},
{
"input": "431",
"output": "1"
},
{
"input": "694",
"output": "0"
},
{
"input": "957",
"output": "1"
},
{
"input": "932",
"output": "0"
}
] | 1,693,044,881 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 15 | 62 | 0 | from sys import stdin,stdout
# from os import _exit
# from bisect import bisect_left,bisect
# from heapq import heapify,heappop,heappush
# from sys import setrecursionlimit
# from collections import defaultdict,Counter
# from itertools import permutations
# from math import gcd,ceil,sqrt,factorial
# setrecursionlimit(int(1e5))
input,print = stdin.readline,stdout.write
n = int(input())
if n%2==0:
ans = 0
else:
ans = 1
print(str(ans)+"\n")
| Title: Quirky Quantifiers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output 0 or 1.
Input Specification:
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output Specification:
Output 0 or 1.
Demo Input:
['13\n', '927\n', '48\n']
Demo Output:
['1\n', '1\n', '0\n']
Note:
none | ```python
from sys import stdin,stdout
# from os import _exit
# from bisect import bisect_left,bisect
# from heapq import heapify,heappop,heappush
# from sys import setrecursionlimit
# from collections import defaultdict,Counter
# from itertools import permutations
# from math import gcd,ceil,sqrt,factorial
# setrecursionlimit(int(1e5))
input,print = stdin.readline,stdout.write
n = int(input())
if n%2==0:
ans = 0
else:
ans = 1
print(str(ans)+"\n")
``` | 3 |
|
686 | A | Free Ice Cream | PROGRAMMING | 800 | [
"constructive algorithms",
"implementation"
] | null | null | After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. | The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. | Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. | [
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] | [
"22 1\n",
"3 2\n"
] | Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining. | 500 | [
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,646,831,675 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 31 | 0 | n,x=[int(i) for i in input().split()]
g=x
h=0
for i in range(n):
f=input()
if "+" in f:
g+=int(f[1:])
else:
if g>int(f[1:]):
g-=int(f[1:])
else:
h+=1
print(g,h)
| Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining. | ```python
n,x=[int(i) for i in input().split()]
g=x
h=0
for i in range(n):
f=input()
if "+" in f:
g+=int(f[1:])
else:
if g>int(f[1:]):
g-=int(f[1:])
else:
h+=1
print(g,h)
``` | 0 |
|
87 | A | Trains | PROGRAMMING | 1,500 | [
"implementation",
"math"
] | A. Trains | 2 | 256 | Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence.
When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample).
We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously.
Help Vasya count to which girlfriend he will go more often. | The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106). | Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency. | [
"3 7\n",
"5 3\n",
"2 3\n"
] | [
"Dasha\n",
"Masha\n",
"Equal\n"
] | Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often.
If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute.
If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute.
If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute.
If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction.
In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often. | 500 | [
{
"input": "3 7",
"output": "Dasha"
},
{
"input": "5 3",
"output": "Masha"
},
{
"input": "2 3",
"output": "Equal"
},
{
"input": "31 88",
"output": "Dasha"
},
{
"input": "8 75",
"output": "Dasha"
},
{
"input": "32 99",
"output": "Dasha"
},
{
"input": "77 4",
"output": "Masha"
},
{
"input": "27 1",
"output": "Masha"
},
{
"input": "84 11",
"output": "Masha"
},
{
"input": "4 6",
"output": "Equal"
},
{
"input": "52 53",
"output": "Equal"
},
{
"input": "397 568",
"output": "Dasha"
},
{
"input": "22 332",
"output": "Dasha"
},
{
"input": "419 430",
"output": "Dasha"
},
{
"input": "638 619",
"output": "Masha"
},
{
"input": "393 325",
"output": "Masha"
},
{
"input": "876 218",
"output": "Masha"
},
{
"input": "552 551",
"output": "Equal"
},
{
"input": "906 912",
"output": "Equal"
},
{
"input": "999 996",
"output": "Equal"
},
{
"input": "652 653",
"output": "Equal"
},
{
"input": "3647 7698",
"output": "Dasha"
},
{
"input": "2661 8975",
"output": "Dasha"
},
{
"input": "251 9731",
"output": "Dasha"
},
{
"input": "9886 8671",
"output": "Masha"
},
{
"input": "8545 7312",
"output": "Masha"
},
{
"input": "4982 2927",
"output": "Masha"
},
{
"input": "7660 7658",
"output": "Equal"
},
{
"input": "9846 9844",
"output": "Equal"
},
{
"input": "9632 9640",
"output": "Equal"
},
{
"input": "5036 5037",
"output": "Equal"
},
{
"input": "64854 77725",
"output": "Dasha"
},
{
"input": "4965 85708",
"output": "Dasha"
},
{
"input": "20393 86640",
"output": "Dasha"
},
{
"input": "99207 30728",
"output": "Masha"
},
{
"input": "77545 13842",
"output": "Masha"
},
{
"input": "30362 10712",
"output": "Masha"
},
{
"input": "51291 51292",
"output": "Equal"
},
{
"input": "55381 55382",
"output": "Equal"
},
{
"input": "91560 91550",
"output": "Equal"
},
{
"input": "99087 99090",
"output": "Equal"
},
{
"input": "983794 986389",
"output": "Dasha"
},
{
"input": "779183 786727",
"output": "Dasha"
},
{
"input": "450766 610961",
"output": "Dasha"
},
{
"input": "664690 630787",
"output": "Masha"
},
{
"input": "461363 256765",
"output": "Masha"
},
{
"input": "638067 409048",
"output": "Masha"
},
{
"input": "929061 929052",
"output": "Equal"
},
{
"input": "996219 996216",
"output": "Equal"
},
{
"input": "716249 716248",
"output": "Equal"
},
{
"input": "782250 782252",
"output": "Equal"
},
{
"input": "1 2",
"output": "Equal"
},
{
"input": "2 1",
"output": "Equal"
},
{
"input": "999999 1000000",
"output": "Equal"
},
{
"input": "999997 1000000",
"output": "Dasha"
},
{
"input": "1000000 999993",
"output": "Masha"
},
{
"input": "999983 999979",
"output": "Masha"
}
] | 1,420,305,438 | 2,147,483,647 | Python 3 | OK | TESTS | 57 | 156 | 0 | import sys
def gcd(a, b):
if(b == 0):
return a
r = a % b
return gcd(b, r)
a, b = [int(x) for x in (sys.stdin.readline()).split()]
t = gcd(a, b)
a /= t
b /= t
if(a > b):
if(a != b + 1):
print("Masha")
else:
print("Equal")
else:
if(b != a + 1):
print("Dasha")
else:
print("Equal")
| Title: Trains
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya the programmer lives in the middle of the Programming subway branch. He has two girlfriends: Dasha and Masha, who live at the different ends of the branch, each one is unaware of the other one's existence.
When Vasya has some free time, he goes to one of his girlfriends. He descends into the subway at some time, waits the first train to come and rides on it to the end of the branch to the corresponding girl. However, the trains run with different frequencies: a train goes to Dasha's direction every *a* minutes, but a train goes to Masha's direction every *b* minutes. If two trains approach at the same time, Vasya goes toward the direction with the lower frequency of going trains, that is, to the girl, to whose directions the trains go less frequently (see the note to the third sample).
We know that the trains begin to go simultaneously before Vasya appears. That is the train schedule is such that there exists a moment of time when the two trains arrive simultaneously.
Help Vasya count to which girlfriend he will go more often.
Input Specification:
The first line contains two integers *a* and *b* (*a*<=≠<=*b*,<=1<=≤<=*a*,<=*b*<=≤<=106).
Output Specification:
Print "Dasha" if Vasya will go to Dasha more frequently, "Masha" if he will go to Masha more frequently, or "Equal" if he will go to both girlfriends with the same frequency.
Demo Input:
['3 7\n', '5 3\n', '2 3\n']
Demo Output:
['Dasha\n', 'Masha\n', 'Equal\n']
Note:
Let's take a look at the third sample. Let the trains start to go at the zero moment of time. It is clear that the moments of the trains' arrival will be periodic with period 6. That's why it is enough to show that if Vasya descends to the subway at a moment of time inside the interval (0, 6], he will go to both girls equally often.
If he descends to the subway at a moment of time from 0 to 2, he leaves for Dasha on the train that arrives by the second minute.
If he descends to the subway at a moment of time from 2 to 3, he leaves for Masha on the train that arrives by the third minute.
If he descends to the subway at a moment of time from 3 to 4, he leaves for Dasha on the train that arrives by the fourth minute.
If he descends to the subway at a moment of time from 4 to 6, he waits for both trains to arrive by the sixth minute and goes to Masha as trains go less often in Masha's direction.
In sum Masha and Dasha get equal time — three minutes for each one, thus, Vasya will go to both girlfriends equally often. | ```python
import sys
def gcd(a, b):
if(b == 0):
return a
r = a % b
return gcd(b, r)
a, b = [int(x) for x in (sys.stdin.readline()).split()]
t = gcd(a, b)
a /= t
b /= t
if(a > b):
if(a != b + 1):
print("Masha")
else:
print("Equal")
else:
if(b != a + 1):
print("Dasha")
else:
print("Equal")
``` | 3.961 |
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,644,335,812 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 80 | 92 | 0 | n=int(input())
ar=[]
for i in range(n):
ar.append(sum(list(map(int,input().split()))))
print("YES" if sum(ar)==0 else "NO") | Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
n=int(input())
ar=[]
for i in range(n):
ar.append(sum(list(map(int,input().split()))))
print("YES" if sum(ar)==0 else "NO")
``` | 0 |
43 | A | Football | PROGRAMMING | 1,000 | [
"strings"
] | A. Football | 2 | 256 | One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. | Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. | [
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] | [
"ABC\n",
"A\n"
] | none | 500 | [
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,696,840,072 | 2,147,483,647 | PyPy 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <iostream>
#include <unordered_map>
#include <algorithm>
#include <ctime>
#include <cstdlib>
#include <cmath>
#include <limits>
using namespace std;
int main(){
int t; cin>>t;
string s;
unordered_map<string,int>mpo;
while(t-->0){
cin>>s;
mpo[s]++;
int lar=-1;
for(auto e:mpo){
if(e.second>lar){
lar=e.second;
s=e.first;
}
}
}
cout<<s<<endl;
} | Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none | ```python
#include <iostream>
#include <unordered_map>
#include <algorithm>
#include <ctime>
#include <cstdlib>
#include <cmath>
#include <limits>
using namespace std;
int main(){
int t; cin>>t;
string s;
unordered_map<string,int>mpo;
while(t-->0){
cin>>s;
mpo[s]++;
int lar=-1;
for(auto e:mpo){
if(e.second>lar){
lar=e.second;
s=e.first;
}
}
}
cout<<s<<endl;
}
``` | -1 |
330 | A | Cakeminator | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat. | The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry. | Output the maximum number of cake cells that the cakeminator can eat. | [
"3 4\nS...\n....\n..S.\n"
] | [
"8\n"
] | For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | 500 | [
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,642,477,943 | 2,147,483,647 | PyPy 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <bits/stdc++.h>
using namespace std;
#define ll long long
#define F first
#define S second
int main(){
ios_base::sync_with_stdio(false);
cin.tie(NULL);
cout.tie(NULL);
//freopen(".inp", "r", stdin);
//freopen(".out", "w", stdout);
//int t; cin>>t; while(t--)
int n,m,ans=0;
cin>>n>>m;
char a[n][m];
map <int,int> o,p;
for(int i=0; i<n; i++){
for(int j=0; j<m; j++){
cin>>a[i][j];
if(a[i][j]=='S'){
o[i]++;
p[j]++;
}
}
}
for(int i=0; i<n; i++){
for(int j=0; j<m; j++){
if(o[i]==0 || p[j]==0) ans++;
}
}
cout<<ans;
} | Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | ```python
#include <bits/stdc++.h>
using namespace std;
#define ll long long
#define F first
#define S second
int main(){
ios_base::sync_with_stdio(false);
cin.tie(NULL);
cout.tie(NULL);
//freopen(".inp", "r", stdin);
//freopen(".out", "w", stdout);
//int t; cin>>t; while(t--)
int n,m,ans=0;
cin>>n>>m;
char a[n][m];
map <int,int> o,p;
for(int i=0; i<n; i++){
for(int j=0; j<m; j++){
cin>>a[i][j];
if(a[i][j]=='S'){
o[i]++;
p[j]++;
}
}
}
for(int i=0; i<n; i++){
for(int j=0; j<m; j++){
if(o[i]==0 || p[j]==0) ans++;
}
}
cout<<ans;
}
``` | -1 |
|
34 | B | Sale | PROGRAMMING | 900 | [
"greedy",
"sortings"
] | B. Sale | 2 | 256 | Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn. | The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets. | Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets. | [
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] | [
"8\n",
"7\n"
] | none | 1,000 | [
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,683,561,122 | 2,147,483,647 | Python 3 | OK | TESTS | 25 | 62 | 0 | n, m = map(int, input().split())
a = sorted(list(map(int, input().split())))
res = 0
for i in range(m):
if a[i] < 0:
res += abs(a[i])
else:
break
print(res)
| Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none | ```python
n, m = map(int, input().split())
a = sorted(list(map(int, input().split())))
res = 0
for i in range(m):
if a[i] < 0:
res += abs(a[i])
else:
break
print(res)
``` | 3.9845 |
858 | A | k-rounding | PROGRAMMING | 1,100 | [
"brute force",
"math",
"number theory"
] | null | null | For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*. | The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8). | Print the *k*-rounding of *n*. | [
"375 4\n",
"10000 1\n",
"38101 0\n",
"123456789 8\n"
] | [
"30000\n",
"10000\n",
"38101\n",
"12345678900000000\n"
] | none | 750 | [
{
"input": "375 4",
"output": "30000"
},
{
"input": "10000 1",
"output": "10000"
},
{
"input": "38101 0",
"output": "38101"
},
{
"input": "123456789 8",
"output": "12345678900000000"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "2"
},
{
"input": "100 0",
"output": "100"
},
{
"input": "1000000000 0",
"output": "1000000000"
},
{
"input": "160 2",
"output": "800"
},
{
"input": "3 0",
"output": "3"
},
{
"input": "10 0",
"output": "10"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "3 1",
"output": "30"
},
{
"input": "4 1",
"output": "20"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "6 1",
"output": "30"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "8 1",
"output": "40"
},
{
"input": "9 1",
"output": "90"
},
{
"input": "10 1",
"output": "10"
},
{
"input": "11 1",
"output": "110"
},
{
"input": "12 1",
"output": "60"
},
{
"input": "16 2",
"output": "400"
},
{
"input": "2 2",
"output": "100"
},
{
"input": "1 2",
"output": "100"
},
{
"input": "5 2",
"output": "100"
},
{
"input": "15 2",
"output": "300"
},
{
"input": "36 2",
"output": "900"
},
{
"input": "1 8",
"output": "100000000"
},
{
"input": "8 8",
"output": "100000000"
},
{
"input": "96 8",
"output": "300000000"
},
{
"input": "175 8",
"output": "700000000"
},
{
"input": "9999995 8",
"output": "199999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "12345678 8",
"output": "617283900000000"
},
{
"input": "78125 8",
"output": "100000000"
},
{
"input": "390625 8",
"output": "100000000"
},
{
"input": "1953125 8",
"output": "500000000"
},
{
"input": "9765625 8",
"output": "2500000000"
},
{
"input": "68359375 8",
"output": "17500000000"
},
{
"input": "268435456 8",
"output": "104857600000000"
},
{
"input": "125829120 8",
"output": "9830400000000"
},
{
"input": "128000 8",
"output": "400000000"
},
{
"input": "300000 8",
"output": "300000000"
},
{
"input": "3711871 8",
"output": "371187100000000"
},
{
"input": "55555 8",
"output": "1111100000000"
},
{
"input": "222222222 8",
"output": "11111111100000000"
},
{
"input": "479001600 8",
"output": "7484400000000"
},
{
"input": "655360001 7",
"output": "6553600010000000"
},
{
"input": "655360001 8",
"output": "65536000100000000"
},
{
"input": "1000000000 1",
"output": "1000000000"
},
{
"input": "1000000000 7",
"output": "1000000000"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "10000000 8",
"output": "100000000"
},
{
"input": "1000000 8",
"output": "100000000"
},
{
"input": "10000009 8",
"output": "1000000900000000"
},
{
"input": "10000005 8",
"output": "200000100000000"
},
{
"input": "10000002 8",
"output": "500000100000000"
},
{
"input": "999999997 8",
"output": "99999999700000000"
},
{
"input": "999999997 7",
"output": "9999999970000000"
},
{
"input": "999999995 8",
"output": "19999999900000000"
},
{
"input": "123 8",
"output": "12300000000"
},
{
"input": "24 2",
"output": "600"
},
{
"input": "16 4",
"output": "10000"
},
{
"input": "123456787 8",
"output": "12345678700000000"
},
{
"input": "100000000 8",
"output": "100000000"
},
{
"input": "7 1",
"output": "70"
},
{
"input": "101 1",
"output": "1010"
},
{
"input": "50 2",
"output": "100"
},
{
"input": "999999818 1",
"output": "4999999090"
},
{
"input": "2 1",
"output": "10"
},
{
"input": "123 1",
"output": "1230"
},
{
"input": "16 1",
"output": "80"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "1000000000 8",
"output": "1000000000"
},
{
"input": "15304 6",
"output": "1913000000"
},
{
"input": "3 8",
"output": "300000000"
},
{
"input": "4 2",
"output": "100"
},
{
"input": "100000 7",
"output": "10000000"
},
{
"input": "5 8",
"output": "100000000"
},
{
"input": "16724 6",
"output": "4181000000"
},
{
"input": "999999999 1",
"output": "9999999990"
},
{
"input": "999999990 8",
"output": "9999999900000000"
},
{
"input": "999999999 8",
"output": "99999999900000000"
},
{
"input": "100000 1",
"output": "100000"
},
{
"input": "8 3",
"output": "1000"
},
{
"input": "16768 6",
"output": "262000000"
},
{
"input": "123456789 1",
"output": "1234567890"
},
{
"input": "2 8",
"output": "100000000"
},
{
"input": "999999937 8",
"output": "99999993700000000"
},
{
"input": "5 1",
"output": "10"
},
{
"input": "2000000 7",
"output": "10000000"
},
{
"input": "1999998 2",
"output": "99999900"
},
{
"input": "125 3",
"output": "1000"
}
] | 1,599,592,440 | 2,147,483,647 | PyPy 3 | OK | TESTS | 96 | 140 | 0 | n, k = list(map(int, input().split()))
t, two, f, five = 1, 2, 1, 5
while True:
if n % two == 0:
t += 1
two *= 2
elif n % five == 0:
f += 1
five *= 5
else:
break
while t <= k:
n *= 2
t += 1
while f <= k:
n *= 5
f += 1
print(n)
| Title: k-rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For a given positive integer *n* denote its *k*-rounding as the minimum positive integer *x*, such that *x* ends with *k* or more zeros in base 10 and is divisible by *n*.
For example, 4-rounding of 375 is 375·80<==<=30000. 30000 is the minimum integer such that it ends with 4 or more zeros and is divisible by 375.
Write a program that will perform the *k*-rounding of *n*.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=109, 0<=≤<=*k*<=≤<=8).
Output Specification:
Print the *k*-rounding of *n*.
Demo Input:
['375 4\n', '10000 1\n', '38101 0\n', '123456789 8\n']
Demo Output:
['30000\n', '10000\n', '38101\n', '12345678900000000\n']
Note:
none | ```python
n, k = list(map(int, input().split()))
t, two, f, five = 1, 2, 1, 5
while True:
if n % two == 0:
t += 1
two *= 2
elif n % five == 0:
f += 1
five *= 5
else:
break
while t <= k:
n *= 2
t += 1
while f <= k:
n *= 5
f += 1
print(n)
``` | 3 |
|
149 | A | Business trip | PROGRAMMING | 900 | [
"greedy",
"implementation",
"sortings"
] | null | null | What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters. | The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100). | Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1. | [
"5\n1 1 1 1 2 2 3 2 2 1 1 1\n",
"0\n0 0 0 0 0 0 0 1 1 2 3 0\n",
"11\n1 1 4 1 1 5 1 1 4 1 1 1\n"
] | [
"2\n",
"0\n",
"3\n"
] | Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all. | 500 | [
{
"input": "5\n1 1 1 1 2 2 3 2 2 1 1 1",
"output": "2"
},
{
"input": "0\n0 0 0 0 0 0 0 1 1 2 3 0",
"output": "0"
},
{
"input": "11\n1 1 4 1 1 5 1 1 4 1 1 1",
"output": "3"
},
{
"input": "15\n20 1 1 1 1 2 2 1 2 2 1 1",
"output": "1"
},
{
"input": "7\n8 9 100 12 14 17 21 10 11 100 23 10",
"output": "1"
},
{
"input": "52\n1 12 3 11 4 5 10 6 9 7 8 2",
"output": "6"
},
{
"input": "50\n2 2 3 4 5 4 4 5 7 3 2 7",
"output": "-1"
},
{
"input": "0\n55 81 28 48 99 20 67 95 6 19 10 93",
"output": "0"
},
{
"input": "93\n85 40 93 66 92 43 61 3 64 51 90 21",
"output": "1"
},
{
"input": "99\n36 34 22 0 0 0 52 12 0 0 33 47",
"output": "2"
},
{
"input": "99\n28 32 31 0 10 35 11 18 0 0 32 28",
"output": "3"
},
{
"input": "99\n19 17 0 1 18 11 29 9 29 22 0 8",
"output": "4"
},
{
"input": "76\n2 16 11 10 12 0 20 4 4 14 11 14",
"output": "5"
},
{
"input": "41\n2 1 7 7 4 2 4 4 9 3 10 0",
"output": "6"
},
{
"input": "47\n8 2 2 4 3 1 9 4 2 7 7 8",
"output": "7"
},
{
"input": "58\n6 11 7 0 5 6 3 9 4 9 5 1",
"output": "8"
},
{
"input": "32\n5 2 4 1 5 0 5 1 4 3 0 3",
"output": "9"
},
{
"input": "31\n6 1 0 4 4 5 1 0 5 3 2 0",
"output": "9"
},
{
"input": "35\n2 3 0 0 6 3 3 4 3 5 0 6",
"output": "9"
},
{
"input": "41\n3 1 3 4 3 6 6 1 4 4 0 6",
"output": "11"
},
{
"input": "97\n0 5 3 12 10 16 22 8 21 17 21 10",
"output": "5"
},
{
"input": "100\n21 21 0 0 4 13 0 26 0 0 0 15",
"output": "6"
},
{
"input": "100\n0 0 16 5 22 0 5 0 25 0 14 13",
"output": "7"
},
{
"input": "97\n17 0 10 0 0 0 18 0 14 23 15 0",
"output": "6"
},
{
"input": "100\n0 9 0 18 7 0 0 14 33 3 0 16",
"output": "7"
},
{
"input": "95\n5 2 13 0 15 18 17 0 6 11 0 8",
"output": "9"
},
{
"input": "94\n11 13 0 9 15 8 8 16 3 7 1 3",
"output": "11"
},
{
"input": "96\n8 4 12 15 8 0 4 10 6 6 12 11",
"output": "11"
},
{
"input": "100\n5 5 3 8 6 5 0 3 3 8 1 3",
"output": "-1"
},
{
"input": "100\n1 0 0 1 1 0 1 1 1 1 2 1",
"output": "-1"
},
{
"input": "100\n6 3 2 0 4 1 2 2 2 2 1 1",
"output": "-1"
},
{
"input": "0\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
},
{
"input": "0\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 1 1 1",
"output": "12"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 2",
"output": "12"
},
{
"input": "15\n10 1 1 1 1 1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
}
] | 1,686,990,463 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 39 | 124 | 0 | k = int(input())
cards = list(map(int, input().split()))
cards.sort(reverse=True)
i = 0
while k > 0 and i < 12:
k -= cards[i]
i += 1
if k > 0:
print(-1)
else:
print(i)
| Title: Business trip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
Input Specification:
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
Output Specification:
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
Demo Input:
['5\n1 1 1 1 2 2 3 2 2 1 1 1\n', '0\n0 0 0 0 0 0 0 1 1 2 3 0\n', '11\n1 1 4 1 1 5 1 1 4 1 1 1\n']
Demo Output:
['2\n', '0\n', '3\n']
Note:
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all. | ```python
k = int(input())
cards = list(map(int, input().split()))
cards.sort(reverse=True)
i = 0
while k > 0 and i < 12:
k -= cards[i]
i += 1
if k > 0:
print(-1)
else:
print(i)
``` | 3 |
|
26 | A | Almost Prime | PROGRAMMING | 900 | [
"number theory"
] | A. Almost Prime | 2 | 256 | A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive. | Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000). | Output the amount of almost prime numbers between 1 and *n*, inclusive. | [
"10\n",
"21\n"
] | [
"2\n",
"8\n"
] | none | 500 | [
{
"input": "10",
"output": "2"
},
{
"input": "21",
"output": "8"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "19",
"output": "6"
},
{
"input": "40",
"output": "19"
},
{
"input": "77",
"output": "41"
},
{
"input": "222",
"output": "125"
},
{
"input": "987",
"output": "501"
},
{
"input": "1000",
"output": "508"
},
{
"input": "2000",
"output": "958"
},
{
"input": "3000",
"output": "1375"
},
{
"input": "2999",
"output": "1375"
},
{
"input": "2998",
"output": "1375"
},
{
"input": "2997",
"output": "1374"
},
{
"input": "1429",
"output": "706"
},
{
"input": "1673",
"output": "808"
},
{
"input": "1500",
"output": "732"
},
{
"input": "500",
"output": "266"
},
{
"input": "856",
"output": "439"
}
] | 1,605,899,635 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 154 | 0 | n = int(input())
c = 0
for i in range(1,n+1):
cnt=0
if(n%i==0):
for j in range(2,i):
if(i%j!=0):
cnt=cnt+1
if(cnt==i-1):
c = c+1
print(c) | Title: Almost Prime
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input Specification:
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
Output Specification:
Output the amount of almost prime numbers between 1 and *n*, inclusive.
Demo Input:
['10\n', '21\n']
Demo Output:
['2\n', '8\n']
Note:
none | ```python
n = int(input())
c = 0
for i in range(1,n+1):
cnt=0
if(n%i==0):
for j in range(2,i):
if(i%j!=0):
cnt=cnt+1
if(cnt==i-1):
c = c+1
print(c)
``` | 0 |
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,687,089,077 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 4 | 92 | 0 | args = int(input())
def watermelon(weight: int):
if weight == 2:
print("YES")
if weight == 0:
print("NO")
if weight%2 == 0:
print("YES")
else:
print("NO")
watermelon(args)
| Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
args = int(input())
def watermelon(weight: int):
if weight == 2:
print("YES")
if weight == 0:
print("NO")
if weight%2 == 0:
print("YES")
else:
print("NO")
watermelon(args)
``` | 0 |
78 | B | Easter Eggs | PROGRAMMING | 1,200 | [
"constructive algorithms",
"implementation"
] | B. Easter Eggs | 2 | 256 | The Easter Rabbit laid *n* eggs in a circle and is about to paint them.
Each egg should be painted one color out of 7: red, orange, yellow, green, blue, indigo or violet. Also, the following conditions should be satisfied:
- Each of the seven colors should be used to paint at least one egg. - Any four eggs lying sequentially should be painted different colors.
Help the Easter Rabbit paint the eggs in the required manner. We know that it is always possible. | The only line contains an integer *n* — the amount of eggs (7<=≤<=*n*<=≤<=100). | Print one line consisting of *n* characters. The *i*-th character should describe the color of the *i*-th egg in the order they lie in the circle. The colors should be represented as follows: "R" stands for red, "O" stands for orange, "Y" stands for yellow, "G" stands for green, "B" stands for blue, "I" stands for indigo, "V" stands for violet.
If there are several answers, print any of them. | [
"8\n",
"13\n"
] | [
"ROYGRBIV\n",
"ROYGBIVGBIVYG\n"
] | The way the eggs will be painted in the first sample is shown on the picture: | 1,000 | [
{
"input": "8",
"output": "ROYGBIVG"
},
{
"input": "13",
"output": "ROYGBIVOYGBIV"
},
{
"input": "7",
"output": "ROYGBIV"
},
{
"input": "10",
"output": "ROYGBIVYGB"
},
{
"input": "14",
"output": "ROYGBIVROYGBIV"
},
{
"input": "50",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "9",
"output": "ROYGBIVGB"
},
{
"input": "11",
"output": "ROYGBIVYGBI"
},
{
"input": "12",
"output": "ROYGBIVOYGBI"
},
{
"input": "15",
"output": "ROYGBIVROYGBIVG"
},
{
"input": "16",
"output": "ROYGBIVROYGBIVGB"
},
{
"input": "17",
"output": "ROYGBIVROYGBIVYGB"
},
{
"input": "18",
"output": "ROYGBIVROYGBIVYGBI"
},
{
"input": "19",
"output": "ROYGBIVROYGBIVOYGBI"
},
{
"input": "20",
"output": "ROYGBIVROYGBIVOYGBIV"
},
{
"input": "21",
"output": "ROYGBIVROYGBIVROYGBIV"
},
{
"input": "22",
"output": "ROYGBIVROYGBIVROYGBIVG"
},
{
"input": "23",
"output": "ROYGBIVROYGBIVROYGBIVGB"
},
{
"input": "24",
"output": "ROYGBIVROYGBIVROYGBIVYGB"
},
{
"input": "25",
"output": "ROYGBIVROYGBIVROYGBIVYGBI"
},
{
"input": "28",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIV"
},
{
"input": "29",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "34",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVOYGBIV"
},
{
"input": "43",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "61",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBI"
},
{
"input": "79",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVGB"
},
{
"input": "81",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVYGBI"
},
{
"input": "92",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "95",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVYGBI"
},
{
"input": "96",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBI"
},
{
"input": "97",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBIV"
},
{
"input": "98",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIV"
},
{
"input": "99",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "100",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVGB"
}
] | 1,577,360,529 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 154 | 0 | n = int(input())
x = n//4
if n%4 == 0:
print('ROYG'*x)
elif n%4 == 1:
print('ROYG'*x + 'B')
elif n%4 == 2:
print('ROYG'*x + 'BI')
else:
print('ROYG'*x + 'BIV')
| Title: Easter Eggs
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Easter Rabbit laid *n* eggs in a circle and is about to paint them.
Each egg should be painted one color out of 7: red, orange, yellow, green, blue, indigo or violet. Also, the following conditions should be satisfied:
- Each of the seven colors should be used to paint at least one egg. - Any four eggs lying sequentially should be painted different colors.
Help the Easter Rabbit paint the eggs in the required manner. We know that it is always possible.
Input Specification:
The only line contains an integer *n* — the amount of eggs (7<=≤<=*n*<=≤<=100).
Output Specification:
Print one line consisting of *n* characters. The *i*-th character should describe the color of the *i*-th egg in the order they lie in the circle. The colors should be represented as follows: "R" stands for red, "O" stands for orange, "Y" stands for yellow, "G" stands for green, "B" stands for blue, "I" stands for indigo, "V" stands for violet.
If there are several answers, print any of them.
Demo Input:
['8\n', '13\n']
Demo Output:
['ROYGRBIV\n', 'ROYGBIVGBIVYG\n']
Note:
The way the eggs will be painted in the first sample is shown on the picture: | ```python
n = int(input())
x = n//4
if n%4 == 0:
print('ROYG'*x)
elif n%4 == 1:
print('ROYG'*x + 'B')
elif n%4 == 2:
print('ROYG'*x + 'BI')
else:
print('ROYG'*x + 'BIV')
``` | 0 |
550 | A | Two Substrings | PROGRAMMING | 1,500 | [
"brute force",
"dp",
"greedy",
"implementation",
"strings"
] | null | null | You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order). | The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters. | Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise. | [
"ABA\n",
"BACFAB\n",
"AXBYBXA\n"
] | [
"NO\n",
"YES\n",
"NO\n"
] | In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA". | 1,000 | [
{
"input": "ABA",
"output": "NO"
},
{
"input": "BACFAB",
"output": "YES"
},
{
"input": "AXBYBXA",
"output": "NO"
},
{
"input": "ABABAB",
"output": "YES"
},
{
"input": "BBBBBBBBBB",
"output": "NO"
},
{
"input": "ABBA",
"output": "YES"
},
{
"input": "ABAXXXAB",
"output": "YES"
},
{
"input": "TESTABAXXABTEST",
"output": "YES"
},
{
"input": "A",
"output": "NO"
},
{
"input": "B",
"output": "NO"
},
{
"input": "X",
"output": "NO"
},
{
"input": "BA",
"output": "NO"
},
{
"input": "AB",
"output": "NO"
},
{
"input": "AA",
"output": "NO"
},
{
"input": "BB",
"output": "NO"
},
{
"input": "BAB",
"output": "NO"
},
{
"input": "AAB",
"output": "NO"
},
{
"input": "BAA",
"output": "NO"
},
{
"input": "ABB",
"output": "NO"
},
{
"input": "BBA",
"output": "NO"
},
{
"input": "AAA",
"output": "NO"
},
{
"input": "BBB",
"output": "NO"
},
{
"input": "AXBXBXA",
"output": "NO"
},
{
"input": "SKDSKDJABSDBADKFJDK",
"output": "YES"
},
{
"input": "ABAXXBBXXAA",
"output": "NO"
},
{
"input": "ABAB",
"output": "NO"
},
{
"input": "BABA",
"output": "NO"
},
{
"input": "AAAB",
"output": "NO"
},
{
"input": "AAAA",
"output": "NO"
},
{
"input": "AABA",
"output": "NO"
},
{
"input": "ABAA",
"output": "NO"
},
{
"input": "BAAA",
"output": "NO"
},
{
"input": "AABB",
"output": "NO"
},
{
"input": "BAAB",
"output": "YES"
},
{
"input": "BBAA",
"output": "NO"
},
{
"input": "BBBA",
"output": "NO"
},
{
"input": "BBAB",
"output": "NO"
},
{
"input": "BABB",
"output": "NO"
},
{
"input": "ABBB",
"output": "NO"
},
{
"input": "BBBB",
"output": "NO"
},
{
"input": "BABAB",
"output": "YES"
},
{
"input": "ABABA",
"output": "YES"
},
{
"input": "AAABAAACBBBC",
"output": "NO"
},
{
"input": "AABBBACBBBBBBAACBCCACBBAABBBBBCAACABAACABCACCBCBCCCBCBCABCBBCCBCBBAACBACAABACBBCACCBCCACCABBCBABBAAC",
"output": "YES"
},
{
"input": "CBBABDDBBADAC",
"output": "YES"
},
{
"input": "ABYFAB",
"output": "NO"
},
{
"input": "BABXXAB",
"output": "YES"
},
{
"input": "ABAXAB",
"output": "YES"
},
{
"input": "ABABXAB",
"output": "YES"
},
{
"input": "ABXABXABXABXABXBAXBAXBAXBA",
"output": "YES"
},
{
"input": "QQQQQQQQQABABQQQQQQQQ",
"output": "NO"
}
] | 1,695,956,659 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 46 | 0 | a=input()
if a.find('AB')!=-1:
a=a.replace("AB",'')
if a.find('BA')!=-1:
print('YES')
else: print('NO') | Title: Two Substrings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
Input Specification:
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
Output Specification:
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
Demo Input:
['ABA\n', 'BACFAB\n', 'AXBYBXA\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA". | ```python
a=input()
if a.find('AB')!=-1:
a=a.replace("AB",'')
if a.find('BA')!=-1:
print('YES')
else: print('NO')
``` | 0 |
|
462 | A | Appleman and Easy Task | PROGRAMMING | 1,000 | [
"brute force",
"implementation"
] | null | null | Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces. | Print "YES" or "NO" (without the quotes) depending on the answer to the problem. | [
"3\nxxo\nxox\noxx\n",
"4\nxxxo\nxoxo\noxox\nxxxx\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "3\nxxo\nxox\noxx",
"output": "YES"
},
{
"input": "4\nxxxo\nxoxo\noxox\nxxxx",
"output": "NO"
},
{
"input": "1\no",
"output": "YES"
},
{
"input": "2\nox\nxo",
"output": "YES"
},
{
"input": "2\nxx\nxo",
"output": "NO"
},
{
"input": "3\nooo\noxo\nxoo",
"output": "NO"
},
{
"input": "3\nxxx\nxxo\nxxo",
"output": "NO"
},
{
"input": "4\nxooo\nooxo\noxoo\nooox",
"output": "YES"
},
{
"input": "4\noooo\noxxo\nxoxo\noooo",
"output": "NO"
},
{
"input": "5\noxoxo\nxxxxx\noxoxo\nxxxxx\noxoxo",
"output": "YES"
},
{
"input": "5\nxxxox\nxxxxo\nxoxox\noxoxx\nxoxxx",
"output": "NO"
},
{
"input": "10\nxoxooooooo\noxxoxxxxxo\nxxooxoooxo\noooxxoxoxo\noxxxooooxo\noxooooxxxo\noxoxoxxooo\noxoooxooxx\noxxxxxoxxo\noooooooxox",
"output": "YES"
},
{
"input": "10\nxxxxxxxoox\nxooxxooooo\noxoooxxooo\nxoxxxxxxxx\nxxoxooxxox\nooxoxxooox\nooxxxxxooo\nxxxxoxooox\nxoxxooxxxx\noooooxxoxo",
"output": "NO"
},
{
"input": "19\noxoxoxoxooxoooxxoox\nxxxxxxxxoxxoxoooooo\noxoxoxooxxxooxxxooo\nxxoxxxooxooxxxoxxox\noxoxooxxxooooxxoxox\nxxxoooxoxxoxxoxxxoo\noxooxxxoooooxxoooxo\nxxooxooxoxxoxxoxxoo\noxxxxooooxxxooooxxx\nooxooxoxxoxxoxooxoo\nxxxooooxxxooooxoxox\noooxoxooxxoxooxooxx\nxxoooxxxooooxxoooxo\nooxxxooxoxooxooxxxx\nxoxoxxooxoxxxooxoxo\nxoxxoxoxooxooxxxxxx\noooxxxooxxxooxoxoxo\nxoooooxoxooxxxxxxxo\nxooxxoooxxoxoxoxoxx",
"output": "NO"
},
{
"input": "12\nxxooxxoxxxoo\nxxoooxoxoxoo\nooxoxoxxooxx\nooxxooooxoxo\nxxxxxxxxoxxx\noxooooxxxooo\noxxoxoxoooxx\nxxxxxxxooxox\noxoooooxoxxx\nxxooxxoxxoxx\noxxxxxxxooxx\nooxoxooxxooo",
"output": "NO"
},
{
"input": "2\noo\nxx",
"output": "NO"
}
] | 1,600,361,391 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 108 | 0 |
n=int(input())
mat= [[1] * (n+2)] * (n+2)
flag=1
for i in range(1,n+1):
ll=list(map(str,input()))
for j in range(1,n+1):
mat[i][j]=ll[j-1]
for k in range(1,n+1):
for l in range(1,n+1):
cnt=0
if(mat[k][l-1]=='x'):
cnt+=1
if(mat[k][l+1]=='x'):
cnt+=1
if(mat[k-1][l]=='x'):
cnt+=1
if(mat[k+1][l]=='x'):
cnt+=1
if(cnt%2==1):
flag=0
print("NO")
break;
if(flag==0):
break;
if(flag==1):
print("YES")
| Title: Appleman and Easy Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
Output Specification:
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
Demo Input:
['3\nxxo\nxox\noxx\n', '4\nxxxo\nxoxo\noxox\nxxxx\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
n=int(input())
mat= [[1] * (n+2)] * (n+2)
flag=1
for i in range(1,n+1):
ll=list(map(str,input()))
for j in range(1,n+1):
mat[i][j]=ll[j-1]
for k in range(1,n+1):
for l in range(1,n+1):
cnt=0
if(mat[k][l-1]=='x'):
cnt+=1
if(mat[k][l+1]=='x'):
cnt+=1
if(mat[k-1][l]=='x'):
cnt+=1
if(mat[k+1][l]=='x'):
cnt+=1
if(cnt%2==1):
flag=0
print("NO")
break;
if(flag==0):
break;
if(flag==1):
print("YES")
``` | 0 |
|
946 | C | String Transformation | PROGRAMMING | 1,300 | [
"greedy",
"strings"
] | null | null | You are given a string *s* consisting of |*s*| small english letters.
In one move you can replace any character of this string to the next character in alphabetical order (a will be replaced with b, s will be replaced with t, etc.). You cannot replace letter z with any other letter.
Your target is to make some number of moves (not necessary minimal) to get string abcdefghijklmnopqrstuvwxyz (english alphabet) as a subsequence. Subsequence of the string is the string that is obtained by deleting characters at some positions. You need to print the string that will be obtained from the given string and will be contain english alphabet as a subsequence or say that it is impossible. | The only one line of the input consisting of the string *s* consisting of |*s*| (1<=≤<=|*s*|<=≤<=105) small english letters. | If you can get a string that can be obtained from the given string and will contain english alphabet as a subsequence, print it. Otherwise print «-1» (without quotes). | [
"aacceeggiikkmmooqqssuuwwyy\n",
"thereisnoanswer\n"
] | [
"abcdefghijklmnopqrstuvwxyz\n",
"-1\n"
] | none | 0 | [
{
"input": "aacceeggiikkmmooqqssuuwwyy",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "thereisnoanswer",
"output": "-1"
},
{
"input": "jqcfvsaveaixhioaaeephbmsmfcgdyawscpyioybkgxlcrhaxs",
"output": "-1"
},
{
"input": "rtdacjpsjjmjdhcoprjhaenlwuvpfqzurnrswngmpnkdnunaendlpbfuylqgxtndhmhqgbsknsy",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaa"
},
{
"input": "abcdefghijklmnopqrstuvwxxx",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvwxya",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "cdaaaaaaaaabcdjklmnopqrstuvwxyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "cdabcdefghijklmnopqrstuvwxyzxyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz"
},
{
"input": "zazaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zazbcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abbbefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaa"
},
{
"input": "abcdefghijklmaopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvwxyx",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaz"
},
{
"input": "zaaaazaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zabcdzefghijklmnopqrstuvwxyzaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaa"
},
{
"input": "aaaaaafghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyzz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaz"
},
{
"input": "abcdefghijklmnopqrstuvwaxy",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaa"
},
{
"input": "abcdefghijklmnapqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvnxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaa"
},
{
"input": "abcdefghijklmnopqrstuvwxyzzzz",
"output": "abcdefghijklmnopqrstuvwxyzzzz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aacceeggiikkmmooqqssuuwwya",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aacdefghijklmnopqrstuvwxyyy",
"output": "abcdefghijklmnopqrstuvwxyzy"
},
{
"input": "abcaefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "zaaacaaaaaaaaaaaaaaaaaaaayy",
"output": "zabcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdedccdcdccdcdcdcdcdcddccdcdcdc",
"output": "abcdefghijklmnopqrstuvwxyzcdcdcdc"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "abcdecdcdcddcdcdcdcdcdcdcd",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "a",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaa"
},
{
"input": "aaadefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaa"
},
{
"input": "abbbbbbbbbbbbbbbbbbbbbbbbz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aacceeggiikkmmaacceeggiikkmmooaacceeggiikkmmaacceeggiikkmmooqqssuuwwzy",
"output": "abcdefghijklmnopqrstuvwxyzmmooaacceeggiikkmmaacceeggiikkmmooqqssuuwwzy"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "phqghumeaylnlfdxfircvscxggbwkfnqduxwfnfozvsrtkjprepggxrpnrvystmwcysyycqpevikeffmznimkkasvwsrenzkycxf",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaap",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "zabcdefghijklmnopqrstuvwxyz",
"output": "zabcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyza"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzabcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "rveviaomdienfygifatviahordebxazoxflfgzslhyzowhxbhqzpsgellkoimnwkvhpbijorhpggwfjexivpqbcbmqjyghkbq",
"output": "rveviaomdienfygifbtvichordefxgzoxhlijzslkyzowlxmnqzpsopqrstuvwxyzhpbijorhpggwfjexivpqbcbmqjyghkbq"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "xtlsgypsfadpooefxzbcoejuvpvaboygpoeylfpbnpljvrvipyamyehwqnqrqpmxujjloovaowuxwhmsncbxcoksfzkvatxdknly",
"output": "xtlsgypsfadpooefxzbcoejuvpvdeoygpofylgphnpljvrvipyjmyklwqnqrqpmxunopqrvstwuxwvwxyzbxcoksfzkvatxdknly"
},
{
"input": "jqcfvsaveaixhioaaeephbmsmfcgdyawscpyioybkgxlcrhaxsa",
"output": "jqcfvsavebixhiocdefphgmsmhijkylwsmpynoypqrxstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "wlrbbmqbhcdarzowkkyhiddqscdxrjmowfrxsjybldbefsarcbynecdyggxxpklorellnmpapqfwkhopkmcoqh",
"output": "wlrbbmqbhcdarzowkkyhiddqscdxrjmowfrxsjybldcefsdrefynghiyjkxxplmornopqrstuvwxyzopkmcoqh"
},
{
"input": "abadefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "zazsazcbbbbbbbbbbbbbbbbbbbbbbb",
"output": "zazsbzcdefghijklmnopqrstuvwxyz"
},
{
"input": "zazsazcbbbbbbbbbbbbbbbbbbbbbyb",
"output": "zazsbzcdefghijklmnopqrstuvwxyz"
},
{
"input": "bbcdefghijklmnopqrstuvwxyzzz",
"output": "-1"
},
{
"input": "zaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zabcdefghijklmnopqrstuvwxyz"
},
{
"input": "zzzzzaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zzzzzabcdefghijklmnopqrstuvwxyza"
},
{
"input": "kkimnfjbbgggicykcciwtoazomcvisigagkjwhyrmojmoebnqoadpmockfjxibdtvrbedrsdoundbcpkfdqdidqdmxdltink",
"output": "kkimnfjbbgggicykcciwtoazomcvisigbgkjwhyrmojmoecnqodepmofkgjxihitvrjklrsmounopqrstuvwxyzdmxdltink"
},
{
"input": "cawgathqceccscakbazmhwbefvygjbcfyihcbgga",
"output": "-1"
},
{
"input": "acrsbyszsbfslzbqzzamcmrypictkcheddehvxdipaxaannjodzyfxgtfnwababzjraapqbqbfzhbiewlzz",
"output": "acrsbyszscfslzdqzzemfmrypigtkhijklmnvxopqrxstuvwxyzyfxgtfnwababzjraapqbqbfzhbiewlzz"
},
{
"input": "ggcebbheeblbioxdvtlrtkxeuilonazpebcbqpzz",
"output": "-1"
},
{
"input": "zzzzabcdefghijklmnopqrstuvwxy",
"output": "-1"
},
{
"input": "zabcdefghijklmnopqrstuvwxy",
"output": "-1"
},
{
"input": "babcdefghijklmnopqrstuvwxyz",
"output": "babcdefghijklmnopqrstuvwxyz"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
}
] | 1,584,457,415 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 139 | 0 | s=input()
n=len(s)
q=[0]*n
for i in range(n):
q[i]=ord(s[i])-97
k=0
f=[]
g=0
for i in range(n):
if q[i] in range(k+1):
k+=1
f.append(i)
else:
k=0
f=[]
if k==25:
g=1
break
if g:
k=0
for i in f:
q[i]=k
k+=1
for i in range(n):
print(chr(q[i]+97),end='')
else:
print(-1)
| Title: String Transformation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting of |*s*| small english letters.
In one move you can replace any character of this string to the next character in alphabetical order (a will be replaced with b, s will be replaced with t, etc.). You cannot replace letter z with any other letter.
Your target is to make some number of moves (not necessary minimal) to get string abcdefghijklmnopqrstuvwxyz (english alphabet) as a subsequence. Subsequence of the string is the string that is obtained by deleting characters at some positions. You need to print the string that will be obtained from the given string and will be contain english alphabet as a subsequence or say that it is impossible.
Input Specification:
The only one line of the input consisting of the string *s* consisting of |*s*| (1<=≤<=|*s*|<=≤<=105) small english letters.
Output Specification:
If you can get a string that can be obtained from the given string and will contain english alphabet as a subsequence, print it. Otherwise print «-1» (without quotes).
Demo Input:
['aacceeggiikkmmooqqssuuwwyy\n', 'thereisnoanswer\n']
Demo Output:
['abcdefghijklmnopqrstuvwxyz\n', '-1\n']
Note:
none | ```python
s=input()
n=len(s)
q=[0]*n
for i in range(n):
q[i]=ord(s[i])-97
k=0
f=[]
g=0
for i in range(n):
if q[i] in range(k+1):
k+=1
f.append(i)
else:
k=0
f=[]
if k==25:
g=1
break
if g:
k=0
for i in f:
q[i]=k
k+=1
for i in range(n):
print(chr(q[i]+97),end='')
else:
print(-1)
``` | 0 |
|
761 | A | Dasha and Stairs | PROGRAMMING | 1,000 | [
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null | On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct. | In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly. | In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise. | [
"2 3\n",
"3 1\n"
] | [
"YES\n",
"NO\n"
] | In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5. | 500 | [
{
"input": "2 3",
"output": "YES"
},
{
"input": "3 1",
"output": "NO"
},
{
"input": "5 4",
"output": "YES"
},
{
"input": "9 9",
"output": "YES"
},
{
"input": "85 95",
"output": "NO"
},
{
"input": "0 1",
"output": "YES"
},
{
"input": "89 25",
"output": "NO"
},
{
"input": "74 73",
"output": "YES"
},
{
"input": "62 39",
"output": "NO"
},
{
"input": "57 57",
"output": "YES"
},
{
"input": "100 99",
"output": "YES"
},
{
"input": "0 0",
"output": "NO"
},
{
"input": "98 100",
"output": "NO"
},
{
"input": "99 100",
"output": "YES"
},
{
"input": "1 0",
"output": "YES"
},
{
"input": "100 0",
"output": "NO"
},
{
"input": "0 100",
"output": "NO"
},
{
"input": "100 98",
"output": "NO"
},
{
"input": "100 100",
"output": "YES"
},
{
"input": "0 5",
"output": "NO"
},
{
"input": "2 2",
"output": "YES"
}
] | 1,688,454,578 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 11 | 46 | 0 | l,r=map(int,input().split())
if(abs(l-r)==1 or abs(l-r)==0):
print("YES")
else:
print("NO") | Title: Dasha and Stairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
Input Specification:
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
Output Specification:
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
Demo Input:
['2 3\n', '3 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5. | ```python
l,r=map(int,input().split())
if(abs(l-r)==1 or abs(l-r)==0):
print("YES")
else:
print("NO")
``` | 0 |
|
459 | A | Pashmak and Garden | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | Pashmak has fallen in love with an attractive girl called Parmida since one year ago...
Today, Pashmak set up a meeting with his partner in a romantic garden. Unfortunately, Pashmak has forgotten where the garden is. But he remembers that the garden looks like a square with sides parallel to the coordinate axes. He also remembers that there is exactly one tree on each vertex of the square. Now, Pashmak knows the position of only two of the trees. Help him to find the position of two remaining ones. | The first line contains four space-separated *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=100<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=100) integers, where *x*1 and *y*1 are coordinates of the first tree and *x*2 and *y*2 are coordinates of the second tree. It's guaranteed that the given points are distinct. | If there is no solution to the problem, print -1. Otherwise print four space-separated integers *x*3,<=*y*3,<=*x*4,<=*y*4 that correspond to the coordinates of the two other trees. If there are several solutions you can output any of them.
Note that *x*3,<=*y*3,<=*x*4,<=*y*4 must be in the range (<=-<=1000<=≤<=*x*3,<=*y*3,<=*x*4,<=*y*4<=≤<=1000). | [
"0 0 0 1\n",
"0 0 1 1\n",
"0 0 1 2\n"
] | [
"1 0 1 1\n",
"0 1 1 0\n",
"-1\n"
] | none | 500 | [
{
"input": "0 0 0 1",
"output": "1 0 1 1"
},
{
"input": "0 0 1 1",
"output": "0 1 1 0"
},
{
"input": "0 0 1 2",
"output": "-1"
},
{
"input": "-100 -100 100 100",
"output": "-100 100 100 -100"
},
{
"input": "-100 -100 99 100",
"output": "-1"
},
{
"input": "0 -100 0 100",
"output": "200 -100 200 100"
},
{
"input": "27 -74 27 74",
"output": "175 -74 175 74"
},
{
"input": "0 1 2 3",
"output": "0 3 2 1"
},
{
"input": "-100 100 100 -100",
"output": "-100 -100 100 100"
},
{
"input": "-100 -100 -100 100",
"output": "100 -100 100 100"
},
{
"input": "100 100 100 -100",
"output": "300 100 300 -100"
},
{
"input": "100 -100 -100 -100",
"output": "100 100 -100 100"
},
{
"input": "-100 100 100 100",
"output": "-100 300 100 300"
},
{
"input": "0 1 0 0",
"output": "1 1 1 0"
},
{
"input": "1 1 0 0",
"output": "1 0 0 1"
},
{
"input": "0 0 1 0",
"output": "0 1 1 1"
},
{
"input": "1 0 0 1",
"output": "1 1 0 0"
},
{
"input": "1 0 1 1",
"output": "2 0 2 1"
},
{
"input": "1 1 0 1",
"output": "1 2 0 2"
},
{
"input": "15 -9 80 -9",
"output": "15 56 80 56"
},
{
"input": "51 -36 18 83",
"output": "-1"
},
{
"input": "69 -22 60 16",
"output": "-1"
},
{
"input": "-68 -78 -45 -55",
"output": "-68 -55 -45 -78"
},
{
"input": "68 -92 8 -32",
"output": "68 -32 8 -92"
},
{
"input": "95 -83 -39 -6",
"output": "-1"
},
{
"input": "54 94 53 -65",
"output": "-1"
},
{
"input": "-92 15 84 15",
"output": "-92 191 84 191"
},
{
"input": "67 77 -11 -1",
"output": "67 -1 -11 77"
},
{
"input": "91 -40 30 21",
"output": "91 21 30 -40"
},
{
"input": "66 -64 -25 -64",
"output": "66 27 -25 27"
},
{
"input": "-42 84 -67 59",
"output": "-42 59 -67 84"
},
{
"input": "73 47 -5 -77",
"output": "-1"
},
{
"input": "6 85 -54 -84",
"output": "-1"
},
{
"input": "-58 -55 40 43",
"output": "-58 43 40 -55"
},
{
"input": "56 22 48 70",
"output": "-1"
},
{
"input": "-17 -32 76 -32",
"output": "-17 61 76 61"
},
{
"input": "0 2 2 0",
"output": "0 0 2 2"
},
{
"input": "0 0 -1 1",
"output": "0 1 -1 0"
},
{
"input": "0 2 1 1",
"output": "0 1 1 2"
},
{
"input": "0 0 1 -1",
"output": "0 -1 1 0"
},
{
"input": "-1 2 -2 3",
"output": "-1 3 -2 2"
},
{
"input": "0 1 1 0",
"output": "0 0 1 1"
},
{
"input": "1 2 2 1",
"output": "1 1 2 2"
},
{
"input": "4 1 2 1",
"output": "4 3 2 3"
},
{
"input": "70 0 0 10",
"output": "-1"
},
{
"input": "2 3 4 1",
"output": "2 1 4 3"
},
{
"input": "1 3 3 1",
"output": "1 1 3 3"
},
{
"input": "-3 3 0 0",
"output": "-3 0 0 3"
},
{
"input": "2 8 7 3",
"output": "2 3 7 8"
},
{
"input": "1 2 2 3",
"output": "1 3 2 2"
},
{
"input": "0 3 3 0",
"output": "0 0 3 3"
},
{
"input": "0 0 -3 3",
"output": "0 3 -3 0"
},
{
"input": "0 2 1 2",
"output": "0 3 1 3"
},
{
"input": "1 1 2 0",
"output": "1 0 2 1"
},
{
"input": "0 0 5 0",
"output": "0 5 5 5"
},
{
"input": "3 4 7 8",
"output": "3 8 7 4"
},
{
"input": "0 5 5 0",
"output": "0 0 5 5"
},
{
"input": "5 6 8 3",
"output": "5 3 8 6"
},
{
"input": "2 2 1 1",
"output": "2 1 1 2"
},
{
"input": "0 1 3 1",
"output": "0 4 3 4"
},
{
"input": "2 4 5 4",
"output": "2 7 5 7"
},
{
"input": "0 5 1 5",
"output": "0 6 1 6"
},
{
"input": "4 0 0 4",
"output": "4 4 0 0"
},
{
"input": "0 1 1 8",
"output": "-1"
},
{
"input": "2 3 3 4",
"output": "2 4 3 3"
},
{
"input": "1 0 2 1",
"output": "1 1 2 0"
},
{
"input": "0 0 2 14",
"output": "-1"
},
{
"input": "0 0 4 3",
"output": "-1"
},
{
"input": "3 5 5 3",
"output": "3 3 5 5"
},
{
"input": "-1 1 1 -1",
"output": "-1 -1 1 1"
},
{
"input": "0 0 2 0",
"output": "0 2 2 2"
},
{
"input": "0 0 1 7",
"output": "-1"
},
{
"input": "1 2 3 2",
"output": "1 4 3 4"
},
{
"input": "1 12 3 10",
"output": "1 10 3 12"
}
] | 1,666,677,013 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 7 | 46 | 0 | x1,y1,x2,y2=map(int,input().split())
if x1==x2:
side=abs(y1-y2)
print(side+x1,y1,side+x2,y2)
elif y1==y2:
side=abs(x1-x2)
print(side+y1,x1,side+y2,x2)
elif abs(y2-y1)==abs(x2-x1):
print(y1,x2,y2,x1)
elif x1!=x2 and y1!=y2:
print(-1)
| Title: Pashmak and Garden
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pashmak has fallen in love with an attractive girl called Parmida since one year ago...
Today, Pashmak set up a meeting with his partner in a romantic garden. Unfortunately, Pashmak has forgotten where the garden is. But he remembers that the garden looks like a square with sides parallel to the coordinate axes. He also remembers that there is exactly one tree on each vertex of the square. Now, Pashmak knows the position of only two of the trees. Help him to find the position of two remaining ones.
Input Specification:
The first line contains four space-separated *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=100<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=100) integers, where *x*1 and *y*1 are coordinates of the first tree and *x*2 and *y*2 are coordinates of the second tree. It's guaranteed that the given points are distinct.
Output Specification:
If there is no solution to the problem, print -1. Otherwise print four space-separated integers *x*3,<=*y*3,<=*x*4,<=*y*4 that correspond to the coordinates of the two other trees. If there are several solutions you can output any of them.
Note that *x*3,<=*y*3,<=*x*4,<=*y*4 must be in the range (<=-<=1000<=≤<=*x*3,<=*y*3,<=*x*4,<=*y*4<=≤<=1000).
Demo Input:
['0 0 0 1\n', '0 0 1 1\n', '0 0 1 2\n']
Demo Output:
['1 0 1 1\n', '0 1 1 0\n', '-1\n']
Note:
none | ```python
x1,y1,x2,y2=map(int,input().split())
if x1==x2:
side=abs(y1-y2)
print(side+x1,y1,side+x2,y2)
elif y1==y2:
side=abs(x1-x2)
print(side+y1,x1,side+y2,x2)
elif abs(y2-y1)==abs(x2-x1):
print(y1,x2,y2,x1)
elif x1!=x2 and y1!=y2:
print(-1)
``` | 0 |
|
989 | C | A Mist of Florescence | PROGRAMMING | 1,800 | [
"constructive algorithms",
"graphs"
] | null | null | "I've been here once," Mino exclaims with delight, "it's breathtakingly amazing."
"What is it like?"
"Look, Kanno, you've got your paintbrush, and I've got my words. Have a try, shall we?"
There are four kinds of flowers in the wood, Amaranths, Begonias, Centaureas and Dianthuses.
The wood can be represented by a rectangular grid of $n$ rows and $m$ columns. In each cell of the grid, there is exactly one type of flowers.
According to Mino, the numbers of connected components formed by each kind of flowers are $a$, $b$, $c$ and $d$ respectively. Two cells are considered in the same connected component if and only if a path exists between them that moves between cells sharing common edges and passes only through cells containing the same flowers.
You are to help Kanno depict such a grid of flowers, with $n$ and $m$ arbitrarily chosen under the constraints given below. It can be shown that at least one solution exists under the constraints of this problem.
Note that you can choose arbitrary $n$ and $m$ under the constraints below, they are not given in the input. | The first and only line of input contains four space-separated integers $a$, $b$, $c$ and $d$ ($1 \leq a, b, c, d \leq 100$) — the required number of connected components of Amaranths, Begonias, Centaureas and Dianthuses, respectively. | In the first line, output two space-separated integers $n$ and $m$ ($1 \leq n, m \leq 50$) — the number of rows and the number of columns in the grid respectively.
Then output $n$ lines each consisting of $m$ consecutive English letters, representing one row of the grid. Each letter should be among 'A', 'B', 'C' and 'D', representing Amaranths, Begonias, Centaureas and Dianthuses, respectively.
In case there are multiple solutions, print any. You can output each letter in either case (upper or lower). | [
"5 3 2 1\n",
"50 50 1 1\n",
"1 6 4 5\n"
] | [
"4 7\nDDDDDDD\nDABACAD\nDBABACD\nDDDDDDD",
"4 50\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nABABABABABABABABABABABABABABABABABABABABABABABABAB\nBABABABABABABABABABABABABABABABABABABABABABABABABA\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD",
"7 7\nDDDDDDD\nDDDBDBD\nDDCDCDD\nDBDADBD\nDDCDCDD\nDBDBDDD\nDDDDDDD"
] | In the first example, each cell of Amaranths, Begonias and Centaureas forms a connected component, while all the Dianthuses form one. | 1,500 | [
{
"input": "5 3 2 1",
"output": "5 13\nAABABBBBCDDAD\nABAABBBBCDADD\nAAAABBBBCDDAD\nAAAABCBBCDADD\nAAAABBBBCDDDD"
},
{
"input": "50 50 1 1",
"output": "10 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABABABABABABABABABABABABABABABABAA\nBABABABABABABABABABABABABABABABABABABABABABABABABA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nDADADADADADADADADADADADADADADADADADADADADADADADADD\nADADADADADADADADADADADADADADADADADADADADADADADADAD\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..."
},
{
"input": "1 6 4 5",
"output": "6 13\nAABABBCBCCDCD\nABAABBBBCCCCD\nAABABBCBCCDCD\nABAABCBBCDCCD\nAABABBBBCCDCD\nAAAABBBBCCCCD"
},
{
"input": "1 1 1 1",
"output": "2 4\nABCD\nABCD"
},
{
"input": "4 8 16 32",
"output": "16 32\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABAAAAAAABAAAAAAAAAAAAAAABABAAAA\nBAAAAAAAAAAABAAAAAAAAAAABAAAAAAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBCBBBBBCBCBCBCBCBBBCBCBBBBBBBBBB\nCBCBBBBBBBBBCBBBCBBBCBBBBBCBBBCB\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCC\nDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDC\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nADDDDDDDDDDDDDDDADDDDDDDDDDD..."
},
{
"input": "1 1 1 50",
"output": "7 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCC\nDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDC\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD"
},
{
"input": "19 58 20 18",
"output": "19 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABAAABABABABABAAABABAAAAABABAAABABAAAAABAA\nAAAABABABAAABABABABABAAABAAABAAABAAAAAAABAAAAAAAAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAABAAABABABAAABABABABAAAAAAABABAAABAAABAAABAAABABA\nABABAAABAAABABAAABAAAAABAAABABAAABAAAAABAAABAAAAAB\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBBCBBBBBBBBBCBBBCBCBBBBBBBBBCBBBCBBBBBBBBBBBCBCBB\nBBBBCBCBCBCBBBBBCBBBBBCBCBCBBBCBBBBB..."
},
{
"input": "100 100 100 100",
"output": "40 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAAABAAABAAABAAABABABABABABAAABABABABABABAAAAABABAA\nAABAAAAAAAAAAABAAABAAABABABAAABABAAABABABABABABAAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAAAABABABAAAAAAABABABABABAAABABABABABABAAAAAAABABA\nABABABAAABABABAAABABAAABAAABABABABABAAABABABABABAB\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABAAABAAABABAAAAAAABAAAAAAABABAAABAAABAAAAABAA\nBABABABAAABABABABABAAABABABABAAABABAAABABABAAABABA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA..."
},
{
"input": "1 1 1 2",
"output": "2 7\nABCCDCD\nABCCCCD"
},
{
"input": "1 1 3 1",
"output": "3 7\nABBCBCD\nABCBBCD\nABBBBCD"
},
{
"input": "1 4 1 1",
"output": "4 7\nAABABCD\nABAABCD\nAABABCD\nAAAABCD"
},
{
"input": "5 1 1 1",
"output": "5 7\nABCDDAD\nABCDADD\nABCDDAD\nABCDADD\nABCDDDD"
},
{
"input": "1 4 7 3",
"output": "7 13\nAAAABBCBCCDCD\nABAABCBBCCCCD\nAAAABBCBCCCCD\nABAABCBBCCCCD\nAABABBCBCCCCD\nAAAABCBBCDCCD\nAAAABBBBCCCCD"
},
{
"input": "6 2 5 1",
"output": "6 13\nAAAABBCBCDDAD\nAAAABBBBCDADD\nAAAABBCBCDDAD\nAAAABCBBCDADD\nAABABBCBCDDAD\nAAAABBBBCDDDD"
},
{
"input": "1 5 6 3",
"output": "6 13\nAAAABBCBCCCCD\nABAABCBBCCCCD\nAABABBCBCCCCD\nABAABCBBCDCCD\nAABABBCBCCDCD\nAAAABBBBCCCCD"
},
{
"input": "4 1 4 5",
"output": "5 13\nABBCBCCDCDDAD\nABCBBCDCCDDDD\nABBBBCCDCDDAD\nABCBBCDCCDADD\nABBBBCCCCDDDD"
},
{
"input": "4 5 3 6",
"output": "6 16\nAAAABBCBCCDCDDAD\nABAABBBBCDCCDDDD\nAABABBCBCCDCDDAD\nABAABBBBCDCCDDDD\nAABABBBBCCDCDDAD\nAAAABBBBCCCCDDDD"
},
{
"input": "2 5 1 17",
"output": "13 17\nAAAAAAAAAAAAAAAAA\nABAAAAAAABAAAAAAA\nAABAAAAAAAAABAAAA\nAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCC\nCDCDCDCDCDCDCDCDC\nDCDCDCDCDCDCDCDCC\nCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDD\nDDDDDDDDDDDDDDDDD\nDDADDDDDDDDDDDDDD\nDDDDDDDDDDDDDDDDD"
},
{
"input": "11 4 5 14",
"output": "14 16\nAAAABBBBCCDCDDDD\nABAABBBBCDCCDADD\nAAAABBBBCCDCDDAD\nAAAABBBBCDCCDADD\nAAAABBBBCCDCDDAD\nAAAABBBBCDCCDADD\nAAAABBBBCCDCDDAD\nAAAABCBBCDCCDDDD\nAAAABBCBCCDCDDDD\nABAABCBBCDCCDADD\nAAAABBBBCCDCDDAD\nAAAABCBBCDCCDADD\nAABABBBBCCDCDDAD\nAAAABBBBCCCCDDDD"
},
{
"input": "19 19 8 10",
"output": "16 19\nAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABA\nBABABABABABABABABAA\nAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBB\nBBBCBBBBBBBBBCBBBCB\nBBCBBBCBCBBBBBCBBBB\nBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCC\nCCCDCCCCCDCCCDCCCDC\nCCCCDCDCCCDCCCDCDCC\nCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDD\nDADADADADADADADADAD\nADADADADADADADADADD\nDDDDDDDDDDDDDDDDDDD"
},
{
"input": "49 49 49 49",
"output": "16 49\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABABABABABABABABABABABABABABABABA\nBABABABABABABABABABABABABABABABABABABABABABABABAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCB\nCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBB\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDC..."
},
{
"input": "49 50 50 50",
"output": "16 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABABABABABABABABABABABABABABABABAA\nBABABABABABABABABABABABABABABABABABABABABABABABABA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBB\nCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCB\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCD..."
},
{
"input": "50 50 51 50",
"output": "19 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABABABABABABABABABABABABABABABABAA\nBABABABABABABABABABABABABABABABABABABABABABABABABA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBBCBBBBBCBCBBBBBCBBBCBBBCBBBBBBBCBCBBBCBBBBBCBBBB\nCBCBCBCBCBBBBBBBBBBBBBBBBBBBCBCBBBCBCBCBBBCBCBCBBB\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBCBCBBBBBCBBBCBBBCBCBCBCBCBCBCBCBCBCBBBCBBBBBCBCB\nBBBBBCBBBCBBBBBCBBBBBCBBBCBBBCBBBCBB..."
},
{
"input": "15 63 41 45",
"output": "19 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABAAABABABABABAAABABAAAAABABAAABABAAAAABAA\nAAAABABABAAABABABABABAAABAAABAAABABABABABAAABAAAAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAABAAABABABAAABABABABAAAAAAABABAAABAAABAAABAAABABA\nABABAAABAAABABAAABAAAAABAAABABAAABABAAABAAABAAAAAB\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBBCBCBCBCBCBCBCBCBCBCBBBCBBBCBBBCBCBCBCBCBCBCBCBB\nCBBBCBCBCBCBCBCBCBBBCBCBCBCBCBCBBBBB..."
},
{
"input": "45 36 25 13",
"output": "16 45\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABAAABABABABAAABABABABABAAABABABABABAAAAABAAA\nBABABABABABABAAAAABABABABABABABABABABAAABABAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBCBCBCBCBCBBBCBBBBBBBBBBBBBBBCBCBCBBBCBCBBBCB\nCBBBCBCBCBCBBBBBCBBBBBBBBBCBBBCBBBBBCBCBCBCBB\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nCCCCCCCCCCCCCCCCCCCDCCCCCCCCCDCCCCCDCCCCCDCCC\nCCCCCCCCCCCCDCCCDCCCCCDCDCCCCCDCCC..."
},
{
"input": "31 41 59 26",
"output": "19 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABAAAAABAAABABABABABABABABAAABABABABABAA\nBABABABABABABAAABABAAABAAABAAABABABABAAABABABABABA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBBCBBBBBCBCBCBBBCBBBCBBBCBBBBBBBCBCBBBCBBBBBCBBBB\nCBCBCBCBCBCBBBBBBBBBBBBBCBBBCBCBBBCBCBCBBBCBCBCBBB\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBCBCBBBBBCBBBCBBBCBCBCBCBCBCBCBCBCBCBBBCBBBBBCBCB\nBCBBBCBBBCBBBCBCBBBBBCBBBCBBBCBCBCBC..."
},
{
"input": "18 90 64 16",
"output": "22 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABABABABABABABABABABABABABABAAABAA\nAABABABABAAABABABABABABABAAABABABABABABABABABABAAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAABABABABABABABABABABABABABABABAAABABABABABABABABA\nABABABABABABABAAABABAAABABABABABABABABABABABAAABAB\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBBBBCBCBCBBBCBBBBBCBCBCBBBCBCBCBBBCBBBCBCBCBCBCBB\nCBCBCBBBCBCBBBCBBBCBCBBBCBCBBBCBCBBB..."
},
{
"input": "77 88 99 1",
"output": "22 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABABABABABABABABABABABABABAAAAABAA\nAABABABABAAABABABABABABABAAABABABABABABABABABABAAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAABABABABABABABABABABABABAAABABAAABABABABABABABABA\nABABABABABABABAAABABAAABABABABABABABABABABABAAABAB\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBB\nCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCB..."
},
{
"input": "99 100 1 100",
"output": "28 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAAABAAABAAABAAABABABABABABAAABABABABABABAAAAABABAA\nAABAAAAAAAAAAABAAABAAABABABAAABABAAABABABABABABAAA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nAAAABABABAAAAAAABABABABABAAABABABABABABAAAAAAABABA\nABABABAAABABABAAABABAAABAAABABABABABAAABABABABABAB\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABAAABAAABABAAAAAAABAAAAAAABABAAABAAABAAAAABAA\nBABABABAAABABABABABAAABABABABAAABABAAABABABAAABABA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA..."
},
{
"input": "100 50 100 49",
"output": "28 50\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nABABABABABABABABABABABABABABABABABABABABABABABABAA\nBABABABABABABABABABABABABABABABABABABABABABABABABA\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBCBCBBBBBCBCBCBBBCBBBBBCBCBBBCBCBCBBBCBCBCBCBBBBBB\nBBBBCBCBCBCBBBCBCBCBCBCBBBCBCBCBCBBBCBCBCBCBCBCBBB\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nBBCBCBBBBBCBCBCBCBCBCBCBCBCBCBBBCBCBCBBBBBCBCBCBCB\nBCBBBBBCBCBCBBBCBCBBBCBCBCBBBBBCBCBB..."
}
] | 1,606,302,184 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 77 | 204,800 | a, b, c, d = map(int, input().split())
M = max(a, b, c, d)
fill = ""
if M == a:
fill = "A"
if M == b:
fill = "B"
if M == c:
fill = "C"
if M == d:
fill = "D"
field = [["#"]*M for i in range(4)]
for i in range(a):
field[i % 2][i] = "A"
for i in range(b):
field[(i+1) % 2][i] = "B"
for i in range(c):
field[i % 2 + 2][i] = "C"
for i in range(d):
field[(i+1) % 2 + 2][i] = "D"
for i in range(2):
for j in range(M):
if field[i][j] == "#":
field[i][j] = fill
for i in range(2):
for j in range(M):
if field[i+2][j] == "#":
field[i+2][j] = fill
field.insert(2,["C" for i in range(M)])
field.insert(3,["B" for i in range(M)])
field.insert(4,["D" for i in range(M)])
print(7,M)
for i in range(7):
print("".join(field[i]))
| Title: A Mist of Florescence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"I've been here once," Mino exclaims with delight, "it's breathtakingly amazing."
"What is it like?"
"Look, Kanno, you've got your paintbrush, and I've got my words. Have a try, shall we?"
There are four kinds of flowers in the wood, Amaranths, Begonias, Centaureas and Dianthuses.
The wood can be represented by a rectangular grid of $n$ rows and $m$ columns. In each cell of the grid, there is exactly one type of flowers.
According to Mino, the numbers of connected components formed by each kind of flowers are $a$, $b$, $c$ and $d$ respectively. Two cells are considered in the same connected component if and only if a path exists between them that moves between cells sharing common edges and passes only through cells containing the same flowers.
You are to help Kanno depict such a grid of flowers, with $n$ and $m$ arbitrarily chosen under the constraints given below. It can be shown that at least one solution exists under the constraints of this problem.
Note that you can choose arbitrary $n$ and $m$ under the constraints below, they are not given in the input.
Input Specification:
The first and only line of input contains four space-separated integers $a$, $b$, $c$ and $d$ ($1 \leq a, b, c, d \leq 100$) — the required number of connected components of Amaranths, Begonias, Centaureas and Dianthuses, respectively.
Output Specification:
In the first line, output two space-separated integers $n$ and $m$ ($1 \leq n, m \leq 50$) — the number of rows and the number of columns in the grid respectively.
Then output $n$ lines each consisting of $m$ consecutive English letters, representing one row of the grid. Each letter should be among 'A', 'B', 'C' and 'D', representing Amaranths, Begonias, Centaureas and Dianthuses, respectively.
In case there are multiple solutions, print any. You can output each letter in either case (upper or lower).
Demo Input:
['5 3 2 1\n', '50 50 1 1\n', '1 6 4 5\n']
Demo Output:
['4 7\nDDDDDDD\nDABACAD\nDBABACD\nDDDDDDD', '4 50\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nABABABABABABABABABABABABABABABABABABABABABABABABAB\nBABABABABABABABABABABABABABABABABABABABABABABABABA\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD', '7 7\nDDDDDDD\nDDDBDBD\nDDCDCDD\nDBDADBD\nDDCDCDD\nDBDBDDD\nDDDDDDD']
Note:
In the first example, each cell of Amaranths, Begonias and Centaureas forms a connected component, while all the Dianthuses form one. | ```python
a, b, c, d = map(int, input().split())
M = max(a, b, c, d)
fill = ""
if M == a:
fill = "A"
if M == b:
fill = "B"
if M == c:
fill = "C"
if M == d:
fill = "D"
field = [["#"]*M for i in range(4)]
for i in range(a):
field[i % 2][i] = "A"
for i in range(b):
field[(i+1) % 2][i] = "B"
for i in range(c):
field[i % 2 + 2][i] = "C"
for i in range(d):
field[(i+1) % 2 + 2][i] = "D"
for i in range(2):
for j in range(M):
if field[i][j] == "#":
field[i][j] = fill
for i in range(2):
for j in range(M):
if field[i+2][j] == "#":
field[i+2][j] = fill
field.insert(2,["C" for i in range(M)])
field.insert(3,["B" for i in range(M)])
field.insert(4,["D" for i in range(M)])
print(7,M)
for i in range(7):
print("".join(field[i]))
``` | 0 |
|
808 | A | Lucky Year | PROGRAMMING | 900 | [
"implementation"
] | null | null | Apart from having lots of holidays throughout the year, residents of Berland also have whole lucky years. Year is considered lucky if it has no more than 1 non-zero digit in its number. So years 100, 40000, 5 are lucky and 12, 3001 and 12345 are not.
You are given current year in Berland. Your task is to find how long will residents of Berland wait till the next lucky year. | The first line contains integer number *n* (1<=≤<=*n*<=≤<=109) — current year in Berland. | Output amount of years from the current year to the next lucky one. | [
"4\n",
"201\n",
"4000\n"
] | [
"1\n",
"99\n",
"1000\n"
] | In the first example next lucky year is 5. In the second one — 300. In the third — 5000. | 0 | [
{
"input": "4",
"output": "1"
},
{
"input": "201",
"output": "99"
},
{
"input": "4000",
"output": "1000"
},
{
"input": "9",
"output": "1"
},
{
"input": "10",
"output": "10"
},
{
"input": "1",
"output": "1"
},
{
"input": "100000000",
"output": "100000000"
},
{
"input": "900000000",
"output": "100000000"
},
{
"input": "999999999",
"output": "1"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "9999999",
"output": "1"
},
{
"input": "100000001",
"output": "99999999"
},
{
"input": "3660",
"output": "340"
},
{
"input": "21",
"output": "9"
},
{
"input": "900000001",
"output": "99999999"
},
{
"input": "62911",
"output": "7089"
},
{
"input": "11",
"output": "9"
},
{
"input": "940302010",
"output": "59697990"
},
{
"input": "91",
"output": "9"
},
{
"input": "101",
"output": "99"
},
{
"input": "1090",
"output": "910"
},
{
"input": "987654321",
"output": "12345679"
},
{
"input": "703450474",
"output": "96549526"
},
{
"input": "1091",
"output": "909"
},
{
"input": "89",
"output": "1"
},
{
"input": "109",
"output": "91"
},
{
"input": "190",
"output": "10"
},
{
"input": "19",
"output": "1"
},
{
"input": "8",
"output": "1"
},
{
"input": "482",
"output": "18"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "5",
"output": "1"
},
{
"input": "6",
"output": "1"
},
{
"input": "7",
"output": "1"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "10",
"output": "10"
},
{
"input": "11",
"output": "9"
},
{
"input": "12",
"output": "8"
},
{
"input": "13",
"output": "7"
},
{
"input": "14",
"output": "6"
},
{
"input": "15",
"output": "5"
},
{
"input": "16",
"output": "4"
},
{
"input": "17",
"output": "3"
},
{
"input": "18",
"output": "2"
},
{
"input": "19",
"output": "1"
},
{
"input": "20",
"output": "10"
},
{
"input": "21",
"output": "9"
},
{
"input": "22",
"output": "8"
},
{
"input": "23",
"output": "7"
},
{
"input": "24",
"output": "6"
},
{
"input": "25",
"output": "5"
},
{
"input": "26",
"output": "4"
},
{
"input": "27",
"output": "3"
},
{
"input": "28",
"output": "2"
},
{
"input": "29",
"output": "1"
},
{
"input": "30",
"output": "10"
},
{
"input": "31",
"output": "9"
},
{
"input": "32",
"output": "8"
},
{
"input": "33",
"output": "7"
},
{
"input": "34",
"output": "6"
},
{
"input": "35",
"output": "5"
},
{
"input": "36",
"output": "4"
},
{
"input": "37",
"output": "3"
},
{
"input": "38",
"output": "2"
},
{
"input": "39",
"output": "1"
},
{
"input": "40",
"output": "10"
},
{
"input": "41",
"output": "9"
},
{
"input": "42",
"output": "8"
},
{
"input": "43",
"output": "7"
},
{
"input": "44",
"output": "6"
},
{
"input": "45",
"output": "5"
},
{
"input": "46",
"output": "4"
},
{
"input": "47",
"output": "3"
},
{
"input": "48",
"output": "2"
},
{
"input": "49",
"output": "1"
},
{
"input": "50",
"output": "10"
},
{
"input": "51",
"output": "9"
},
{
"input": "52",
"output": "8"
},
{
"input": "53",
"output": "7"
},
{
"input": "54",
"output": "6"
},
{
"input": "55",
"output": "5"
},
{
"input": "56",
"output": "4"
},
{
"input": "57",
"output": "3"
},
{
"input": "58",
"output": "2"
},
{
"input": "59",
"output": "1"
},
{
"input": "60",
"output": "10"
},
{
"input": "61",
"output": "9"
},
{
"input": "62",
"output": "8"
},
{
"input": "63",
"output": "7"
},
{
"input": "64",
"output": "6"
},
{
"input": "65",
"output": "5"
},
{
"input": "66",
"output": "4"
},
{
"input": "67",
"output": "3"
},
{
"input": "68",
"output": "2"
},
{
"input": "69",
"output": "1"
},
{
"input": "70",
"output": "10"
},
{
"input": "71",
"output": "9"
},
{
"input": "72",
"output": "8"
},
{
"input": "73",
"output": "7"
},
{
"input": "74",
"output": "6"
},
{
"input": "75",
"output": "5"
},
{
"input": "76",
"output": "4"
},
{
"input": "77",
"output": "3"
},
{
"input": "78",
"output": "2"
},
{
"input": "79",
"output": "1"
},
{
"input": "80",
"output": "10"
},
{
"input": "81",
"output": "9"
},
{
"input": "82",
"output": "8"
},
{
"input": "83",
"output": "7"
},
{
"input": "84",
"output": "6"
},
{
"input": "85",
"output": "5"
},
{
"input": "86",
"output": "4"
},
{
"input": "87",
"output": "3"
},
{
"input": "88",
"output": "2"
},
{
"input": "89",
"output": "1"
},
{
"input": "90",
"output": "10"
},
{
"input": "91",
"output": "9"
},
{
"input": "92",
"output": "8"
},
{
"input": "93",
"output": "7"
},
{
"input": "94",
"output": "6"
},
{
"input": "95",
"output": "5"
},
{
"input": "96",
"output": "4"
},
{
"input": "97",
"output": "3"
},
{
"input": "98",
"output": "2"
},
{
"input": "99",
"output": "1"
},
{
"input": "100",
"output": "100"
},
{
"input": "100",
"output": "100"
},
{
"input": "100",
"output": "100"
},
{
"input": "1000",
"output": "1000"
},
{
"input": "1000",
"output": "1000"
},
{
"input": "1000",
"output": "1000"
},
{
"input": "10000",
"output": "10000"
},
{
"input": "10000",
"output": "10000"
},
{
"input": "101",
"output": "99"
},
{
"input": "110",
"output": "90"
},
{
"input": "1001",
"output": "999"
},
{
"input": "1100",
"output": "900"
},
{
"input": "1010",
"output": "990"
},
{
"input": "10010",
"output": "9990"
},
{
"input": "10100",
"output": "9900"
},
{
"input": "102",
"output": "98"
},
{
"input": "120",
"output": "80"
},
{
"input": "1002",
"output": "998"
},
{
"input": "1200",
"output": "800"
},
{
"input": "1020",
"output": "980"
},
{
"input": "10020",
"output": "9980"
},
{
"input": "10200",
"output": "9800"
},
{
"input": "108",
"output": "92"
},
{
"input": "180",
"output": "20"
},
{
"input": "1008",
"output": "992"
},
{
"input": "1800",
"output": "200"
},
{
"input": "1080",
"output": "920"
},
{
"input": "10080",
"output": "9920"
},
{
"input": "10800",
"output": "9200"
},
{
"input": "109",
"output": "91"
},
{
"input": "190",
"output": "10"
},
{
"input": "1009",
"output": "991"
},
{
"input": "1900",
"output": "100"
},
{
"input": "1090",
"output": "910"
},
{
"input": "10090",
"output": "9910"
},
{
"input": "10900",
"output": "9100"
},
{
"input": "200",
"output": "100"
},
{
"input": "200",
"output": "100"
},
{
"input": "2000",
"output": "1000"
},
{
"input": "2000",
"output": "1000"
},
{
"input": "2000",
"output": "1000"
},
{
"input": "20000",
"output": "10000"
},
{
"input": "20000",
"output": "10000"
},
{
"input": "201",
"output": "99"
},
{
"input": "210",
"output": "90"
},
{
"input": "2001",
"output": "999"
},
{
"input": "2100",
"output": "900"
},
{
"input": "2010",
"output": "990"
},
{
"input": "20010",
"output": "9990"
},
{
"input": "20100",
"output": "9900"
},
{
"input": "202",
"output": "98"
},
{
"input": "220",
"output": "80"
},
{
"input": "2002",
"output": "998"
},
{
"input": "2200",
"output": "800"
},
{
"input": "2020",
"output": "980"
},
{
"input": "20020",
"output": "9980"
},
{
"input": "20200",
"output": "9800"
},
{
"input": "208",
"output": "92"
},
{
"input": "280",
"output": "20"
},
{
"input": "2008",
"output": "992"
},
{
"input": "2800",
"output": "200"
},
{
"input": "2080",
"output": "920"
},
{
"input": "20080",
"output": "9920"
},
{
"input": "20800",
"output": "9200"
},
{
"input": "209",
"output": "91"
},
{
"input": "290",
"output": "10"
},
{
"input": "2009",
"output": "991"
},
{
"input": "2900",
"output": "100"
},
{
"input": "2090",
"output": "910"
},
{
"input": "20090",
"output": "9910"
},
{
"input": "20900",
"output": "9100"
},
{
"input": "800",
"output": "100"
},
{
"input": "800",
"output": "100"
},
{
"input": "8000",
"output": "1000"
},
{
"input": "8000",
"output": "1000"
},
{
"input": "8000",
"output": "1000"
},
{
"input": "80000",
"output": "10000"
},
{
"input": "80000",
"output": "10000"
},
{
"input": "801",
"output": "99"
},
{
"input": "810",
"output": "90"
},
{
"input": "8001",
"output": "999"
},
{
"input": "8100",
"output": "900"
},
{
"input": "8010",
"output": "990"
},
{
"input": "80010",
"output": "9990"
},
{
"input": "80100",
"output": "9900"
},
{
"input": "802",
"output": "98"
},
{
"input": "820",
"output": "80"
},
{
"input": "8002",
"output": "998"
},
{
"input": "8200",
"output": "800"
},
{
"input": "8020",
"output": "980"
},
{
"input": "80020",
"output": "9980"
},
{
"input": "80200",
"output": "9800"
},
{
"input": "808",
"output": "92"
},
{
"input": "880",
"output": "20"
},
{
"input": "8008",
"output": "992"
},
{
"input": "8800",
"output": "200"
},
{
"input": "8080",
"output": "920"
},
{
"input": "80080",
"output": "9920"
},
{
"input": "80800",
"output": "9200"
},
{
"input": "809",
"output": "91"
},
{
"input": "890",
"output": "10"
},
{
"input": "8009",
"output": "991"
},
{
"input": "8900",
"output": "100"
},
{
"input": "8090",
"output": "910"
},
{
"input": "80090",
"output": "9910"
},
{
"input": "80900",
"output": "9100"
},
{
"input": "900",
"output": "100"
},
{
"input": "900",
"output": "100"
},
{
"input": "9000",
"output": "1000"
},
{
"input": "9000",
"output": "1000"
},
{
"input": "9000",
"output": "1000"
},
{
"input": "90000",
"output": "10000"
},
{
"input": "90000",
"output": "10000"
},
{
"input": "901",
"output": "99"
},
{
"input": "910",
"output": "90"
},
{
"input": "9001",
"output": "999"
},
{
"input": "9100",
"output": "900"
},
{
"input": "9010",
"output": "990"
},
{
"input": "90010",
"output": "9990"
},
{
"input": "90100",
"output": "9900"
},
{
"input": "902",
"output": "98"
},
{
"input": "920",
"output": "80"
},
{
"input": "9002",
"output": "998"
},
{
"input": "9200",
"output": "800"
},
{
"input": "9020",
"output": "980"
},
{
"input": "90020",
"output": "9980"
},
{
"input": "90200",
"output": "9800"
},
{
"input": "908",
"output": "92"
},
{
"input": "980",
"output": "20"
},
{
"input": "9008",
"output": "992"
},
{
"input": "9800",
"output": "200"
},
{
"input": "9080",
"output": "920"
},
{
"input": "90080",
"output": "9920"
},
{
"input": "90800",
"output": "9200"
},
{
"input": "909",
"output": "91"
},
{
"input": "990",
"output": "10"
},
{
"input": "9009",
"output": "991"
},
{
"input": "9900",
"output": "100"
},
{
"input": "9090",
"output": "910"
},
{
"input": "90090",
"output": "9910"
},
{
"input": "90900",
"output": "9100"
},
{
"input": "92651241",
"output": "7348759"
}
] | 1,691,642,908 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | # LUOGU_RID: 120038312
def next_lucky_year(n):
while True:
n += 1
if sum(int(digit) for digit in str(n)) <= 1:
return n
n = int(input())
years_to_next_lucky = next_lucky_year(n) - n
print(years_to_next_lucky)
| Title: Lucky Year
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Apart from having lots of holidays throughout the year, residents of Berland also have whole lucky years. Year is considered lucky if it has no more than 1 non-zero digit in its number. So years 100, 40000, 5 are lucky and 12, 3001 and 12345 are not.
You are given current year in Berland. Your task is to find how long will residents of Berland wait till the next lucky year.
Input Specification:
The first line contains integer number *n* (1<=≤<=*n*<=≤<=109) — current year in Berland.
Output Specification:
Output amount of years from the current year to the next lucky one.
Demo Input:
['4\n', '201\n', '4000\n']
Demo Output:
['1\n', '99\n', '1000\n']
Note:
In the first example next lucky year is 5. In the second one — 300. In the third — 5000. | ```python
# LUOGU_RID: 120038312
def next_lucky_year(n):
while True:
n += 1
if sum(int(digit) for digit in str(n)) <= 1:
return n
n = int(input())
years_to_next_lucky = next_lucky_year(n) - n
print(years_to_next_lucky)
``` | 0 |
|
780 | C | Andryusha and Colored Balloons | PROGRAMMING | 1,600 | [
"dfs and similar",
"graphs",
"greedy",
"trees"
] | null | null | Andryusha goes through a park each day. The squares and paths between them look boring to Andryusha, so he decided to decorate them.
The park consists of *n* squares connected with (*n*<=-<=1) bidirectional paths in such a way that any square is reachable from any other using these paths. Andryusha decided to hang a colored balloon at each of the squares. The baloons' colors are described by positive integers, starting from 1. In order to make the park varicolored, Andryusha wants to choose the colors in a special way. More precisely, he wants to use such colors that if *a*, *b* and *c* are distinct squares that *a* and *b* have a direct path between them, and *b* and *c* have a direct path between them, then balloon colors on these three squares are distinct.
Andryusha wants to use as little different colors as possible. Help him to choose the colors! | The first line contains single integer *n* (3<=≤<=*n*<=≤<=2·105) — the number of squares in the park.
Each of the next (*n*<=-<=1) lines contains two integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*) — the indices of two squares directly connected by a path.
It is guaranteed that any square is reachable from any other using the paths. | In the first line print single integer *k* — the minimum number of colors Andryusha has to use.
In the second line print *n* integers, the *i*-th of them should be equal to the balloon color on the *i*-th square. Each of these numbers should be within range from 1 to *k*. | [
"3\n2 3\n1 3\n",
"5\n2 3\n5 3\n4 3\n1 3\n",
"5\n2 1\n3 2\n4 3\n5 4\n"
] | [
"3\n1 3 2 ",
"5\n1 3 2 5 4 ",
"3\n1 2 3 1 2 "
] | In the first sample the park consists of three squares: 1 → 3 → 2. Thus, the balloon colors have to be distinct.
In the second example there are following triples of consequently connected squares:
- 1 → 3 → 2 - 1 → 3 → 4 - 1 → 3 → 5 - 2 → 3 → 4 - 2 → 3 → 5 - 4 → 3 → 5
In the third example there are following triples:
- 1 → 2 → 3 - 2 → 3 → 4 - 3 → 4 → 5 | 1,250 | [
{
"input": "3\n2 3\n1 3",
"output": "3\n1 3 2 "
},
{
"input": "5\n2 3\n5 3\n4 3\n1 3",
"output": "5\n1 3 2 5 4 "
},
{
"input": "5\n2 1\n3 2\n4 3\n5 4",
"output": "3\n1 2 3 1 2 "
},
{
"input": "10\n5 3\n9 2\n7 1\n3 8\n4 1\n1 9\n10 1\n8 9\n6 2",
"output": "5\n1 2 1 3 2 1 2 3 4 5 "
},
{
"input": "3\n2 1\n3 2",
"output": "3\n1 2 3 "
},
{
"input": "10\n2 7\n8 2\n9 8\n1 9\n4 1\n3 4\n6 3\n10 6\n5 10",
"output": "3\n1 1 2 3 2 1 2 3 2 3 "
},
{
"input": "5\n4 2\n3 1\n3 4\n3 5",
"output": "4\n1 1 2 3 4 "
},
{
"input": "7\n3 6\n3 1\n3 2\n3 5\n3 4\n3 7",
"output": "7\n1 4 2 6 5 3 7 "
},
{
"input": "10\n8 6\n10 5\n8 4\n2 7\n3 8\n10 3\n3 9\n2 1\n3 2",
"output": "5\n1 2 4 3 1 2 3 1 5 3 "
},
{
"input": "50\n45 2\n4 48\n16 4\n17 29\n29 33\n31 2\n47 41\n41 33\n22 6\n44 40\n32 24\n12 40\n28 16\n18 30\n20 41\n25 45\n35 29\n10 32\n1 48\n15 50\n6 9\n43 2\n33 2\n38 33\n8 2\n36 7\n26 48\n50 8\n34 31\n48 33\n13 45\n37 33\n7 6\n40 32\n3 6\n30 49\n49 33\n11 40\n19 40\n24 2\n14 50\n5 50\n42 16\n23 2\n9 45\n39 6\n46 48\n27 13\n21 2",
"output": "9\n1 4 4 3 4 2 3 6 5 2 5 4 3 3 2 1 2 2 6 2 9 1 8 7 2 4 2 2 1 1 2 1 5 1 3 1 7 6 6 3 3 4 3 2 1 6 1 2 8 1 "
},
{
"input": "50\n8 37\n40 8\n38 40\n10 38\n29 10\n33 29\n17 33\n25 17\n19 25\n3 19\n13 3\n24 13\n12 24\n5 12\n41 5\n11 41\n27 11\n45 27\n6 45\n35 6\n9 35\n50 9\n32 50\n21 32\n22 21\n1 22\n31 1\n28 31\n4 28\n30 4\n7 30\n48 7\n46 48\n16 46\n49 16\n39 49\n18 39\n14 18\n34 14\n23 34\n20 23\n15 20\n44 15\n42 44\n2 42\n36 2\n43 36\n26 43\n47 26",
"output": "3\n1 3 2 1 1 2 2 2 3 2 2 2 1 1 3 2 2 2 3 1 3 2 2 3 1 3 1 2 1 3 3 1 3 3 1 2 3 3 3 1 3 1 1 2 3 3 2 1 1 2 "
},
{
"input": "50\n7 5\n6 40\n49 43\n48 2\n44 11\n10 3\n46 49\n22 18\n17 33\n4 29\n48 4\n47 41\n24 19\n48 8\n1 21\n2 17\n17 34\n16 10\n17 20\n1 22\n44 32\n6 28\n7 1\n47 26\n28 44\n23 50\n21 15\n1 30\n7 27\n28 25\n17 23\n14 42\n6 46\n5 24\n44 9\n25 39\n46 47\n21 35\n7 16\n34 12\n45 14\n35 36\n28 13\n6 48\n46 37\n39 45\n40 7\n2 31\n30 38",
"output": "6\n1 2 2 3 2 1 4 5 5 1 1 2 5 3 3 5 1 2 3 5 2 3 6 1 4 2 3 2 1 5 3 4 3 4 4 1 5 2 1 6 1 1 1 3 2 3 4 4 2 2 "
}
] | 1,680,187,074 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 23 | 1,263 | 19,353,600 | n = int(input())
tree = [[] for i in range(n)]
cols = [0 for i in range(n)]
ans = 0
for i in range(n-1):
x,y = map(int, input().split())
x -= 1
y -= 1
tree[x] += [y]
tree[y] += [x]
ans = max(ans, len(tree[x])+1, len(tree[y])+1)
cols[0] = 1
cur = 1
def f(cur_node, p_col):
col = 1
for i in tree[cur_node]:
if cols[i] == 0:
while col == cols[cur_node] or col == p_col:
col += 1
cols[i] = col
f(i, cols[cur_node])
col += 1
for i in tree[0]:
if cols[i] == 0:
cur += 1
cols[i] = cur
f(i, 1)
print(ans)
print(*cols)
| Title: Andryusha and Colored Balloons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andryusha goes through a park each day. The squares and paths between them look boring to Andryusha, so he decided to decorate them.
The park consists of *n* squares connected with (*n*<=-<=1) bidirectional paths in such a way that any square is reachable from any other using these paths. Andryusha decided to hang a colored balloon at each of the squares. The baloons' colors are described by positive integers, starting from 1. In order to make the park varicolored, Andryusha wants to choose the colors in a special way. More precisely, he wants to use such colors that if *a*, *b* and *c* are distinct squares that *a* and *b* have a direct path between them, and *b* and *c* have a direct path between them, then balloon colors on these three squares are distinct.
Andryusha wants to use as little different colors as possible. Help him to choose the colors!
Input Specification:
The first line contains single integer *n* (3<=≤<=*n*<=≤<=2·105) — the number of squares in the park.
Each of the next (*n*<=-<=1) lines contains two integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*) — the indices of two squares directly connected by a path.
It is guaranteed that any square is reachable from any other using the paths.
Output Specification:
In the first line print single integer *k* — the minimum number of colors Andryusha has to use.
In the second line print *n* integers, the *i*-th of them should be equal to the balloon color on the *i*-th square. Each of these numbers should be within range from 1 to *k*.
Demo Input:
['3\n2 3\n1 3\n', '5\n2 3\n5 3\n4 3\n1 3\n', '5\n2 1\n3 2\n4 3\n5 4\n']
Demo Output:
['3\n1 3 2 ', '5\n1 3 2 5 4 ', '3\n1 2 3 1 2 ']
Note:
In the first sample the park consists of three squares: 1 → 3 → 2. Thus, the balloon colors have to be distinct.
In the second example there are following triples of consequently connected squares:
- 1 → 3 → 2 - 1 → 3 → 4 - 1 → 3 → 5 - 2 → 3 → 4 - 2 → 3 → 5 - 4 → 3 → 5
In the third example there are following triples:
- 1 → 2 → 3 - 2 → 3 → 4 - 3 → 4 → 5 | ```python
n = int(input())
tree = [[] for i in range(n)]
cols = [0 for i in range(n)]
ans = 0
for i in range(n-1):
x,y = map(int, input().split())
x -= 1
y -= 1
tree[x] += [y]
tree[y] += [x]
ans = max(ans, len(tree[x])+1, len(tree[y])+1)
cols[0] = 1
cur = 1
def f(cur_node, p_col):
col = 1
for i in tree[cur_node]:
if cols[i] == 0:
while col == cols[cur_node] or col == p_col:
col += 1
cols[i] = col
f(i, cols[cur_node])
col += 1
for i in tree[0]:
if cols[i] == 0:
cur += 1
cols[i] = cur
f(i, 1)
print(ans)
print(*cols)
``` | -1 |
|
399 | B | Red and Blue Balls | PROGRAMMING | 0 | [] | null | null | User ainta has a stack of *n* red and blue balls. He can apply a certain operation which changes the colors of the balls inside the stack.
- While the top ball inside the stack is red, pop the ball from the top of the stack. - Then replace the blue ball on the top with a red ball. - And finally push some blue balls to the stack until the stack has total of *n* balls inside.
If there are no blue balls inside the stack, ainta can't apply this operation. Given the initial state of the stack, ainta wants to know the maximum number of operations he can repeatedly apply. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=50) — the number of balls inside the stack.
The second line contains a string *s* (|*s*|<==<=*n*) describing the initial state of the stack. The *i*-th character of the string *s* denotes the color of the *i*-th ball (we'll number the balls from top to bottom of the stack). If the character is "R", the color is red. If the character is "B", the color is blue. | Print the maximum number of operations ainta can repeatedly apply.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"3\nRBR\n",
"4\nRBBR\n",
"5\nRBBRR\n"
] | [
"2\n",
"6\n",
"6\n"
] | The first example is depicted below.
The explanation how user ainta applies the first operation. He pops out one red ball, changes the color of the ball in the middle from blue to red, and pushes one blue ball.
The explanation how user ainta applies the second operation. He will not pop out red balls, he simply changes the color of the ball on the top from blue to red.
From now on, ainta can't apply any operation because there are no blue balls inside the stack. ainta applied two operations, so the answer is 2.
The second example is depicted below. The blue arrow denotes a single operation. | 1,000 | [
{
"input": "3\nRBR",
"output": "2"
},
{
"input": "4\nRBBR",
"output": "6"
},
{
"input": "5\nRBBRR",
"output": "6"
},
{
"input": "5\nRBRBR",
"output": "10"
},
{
"input": "10\nRRBRRBBRRR",
"output": "100"
},
{
"input": "10\nBRBRRRRRRR",
"output": "5"
},
{
"input": "10\nBRRRRRRRRR",
"output": "1"
},
{
"input": "20\nBRBRRRRRRRRRRRRRRRRR",
"output": "5"
},
{
"input": "30\nRRBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1073741820"
},
{
"input": "50\nBRRRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1125899906842609"
},
{
"input": "20\nRRRBRBBBBBRRRRRRRRRR",
"output": "1000"
},
{
"input": "20\nRRBRBBBBBRRRRRRRRRRR",
"output": "500"
},
{
"input": "1\nR",
"output": "0"
},
{
"input": "1\nB",
"output": "1"
},
{
"input": "2\nRR",
"output": "0"
},
{
"input": "2\nBR",
"output": "1"
},
{
"input": "50\nRRRRRRRRRRBBBBBBRRBBRRRBRRBBBRRRRRRRRRRRRRRRRRRRRR",
"output": "479001600"
},
{
"input": "50\nRBRRRRRBRBRRBBBBBBRRRBRRRRRBBBRRBRRRRRBBBRRRRRRRRR",
"output": "1929382195842"
},
{
"input": "48\nRBRBRRRRBRBRRBRRRRRRRBBBRRBRBRRRBBRRRRRRRRRRRRRR",
"output": "13235135754"
},
{
"input": "30\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "0"
},
{
"input": "50\nRRBBBBBBBBBBBBBBBBRBRRBBBRBBRBBBRRBRBBBBBRBBRBBRBR",
"output": "402373705727996"
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1125899906842623"
},
{
"input": "19\nRRRRRBRRBRRRRBRBBBB",
"output": "500000"
},
{
"input": "32\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBR",
"output": "2147483647"
},
{
"input": "3\nBBB",
"output": "7"
},
{
"input": "3\nBBR",
"output": "3"
},
{
"input": "3\nBRB",
"output": "5"
},
{
"input": "3\nBRR",
"output": "1"
},
{
"input": "3\nRBB",
"output": "6"
},
{
"input": "3\nRBR",
"output": "2"
},
{
"input": "3\nRRB",
"output": "4"
},
{
"input": "3\nRRR",
"output": "0"
},
{
"input": "2\nRB",
"output": "2"
},
{
"input": "2\nBB",
"output": "3"
}
] | 1,659,044,957 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 13 | 46 | 0 | N = int(input())
S = input()
dp1 = [0 for i in range(N)]
dp2 = [0 for i in range(N)]
dp1[0] = 1
for i in range(N):
dp1[i] = dp1[i - 1] * 2 + 1
dp2[0] = (0 if S[0] == 'R' else dp1[0])
for i in range(1, N):
dp2[i] = (dp2[i - 1] if S[i] == 'R' else dp2[i - 1] + dp1[i - 1] + 1)
print(dp2[N - 1])
| Title: Red and Blue Balls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
User ainta has a stack of *n* red and blue balls. He can apply a certain operation which changes the colors of the balls inside the stack.
- While the top ball inside the stack is red, pop the ball from the top of the stack. - Then replace the blue ball on the top with a red ball. - And finally push some blue balls to the stack until the stack has total of *n* balls inside.
If there are no blue balls inside the stack, ainta can't apply this operation. Given the initial state of the stack, ainta wants to know the maximum number of operations he can repeatedly apply.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=50) — the number of balls inside the stack.
The second line contains a string *s* (|*s*|<==<=*n*) describing the initial state of the stack. The *i*-th character of the string *s* denotes the color of the *i*-th ball (we'll number the balls from top to bottom of the stack). If the character is "R", the color is red. If the character is "B", the color is blue.
Output Specification:
Print the maximum number of operations ainta can repeatedly apply.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['3\nRBR\n', '4\nRBBR\n', '5\nRBBRR\n']
Demo Output:
['2\n', '6\n', '6\n']
Note:
The first example is depicted below.
The explanation how user ainta applies the first operation. He pops out one red ball, changes the color of the ball in the middle from blue to red, and pushes one blue ball.
The explanation how user ainta applies the second operation. He will not pop out red balls, he simply changes the color of the ball on the top from blue to red.
From now on, ainta can't apply any operation because there are no blue balls inside the stack. ainta applied two operations, so the answer is 2.
The second example is depicted below. The blue arrow denotes a single operation. | ```python
N = int(input())
S = input()
dp1 = [0 for i in range(N)]
dp2 = [0 for i in range(N)]
dp1[0] = 1
for i in range(N):
dp1[i] = dp1[i - 1] * 2 + 1
dp2[0] = (0 if S[0] == 'R' else dp1[0])
for i in range(1, N):
dp2[i] = (dp2[i - 1] if S[i] == 'R' else dp2[i - 1] + dp1[i - 1] + 1)
print(dp2[N - 1])
``` | 0 |
|
110 | A | Nearly Lucky Number | PROGRAMMING | 800 | [
"implementation"
] | A. Nearly Lucky Number | 2 | 256 | Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number. | The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator. | Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes). | [
"40047\n",
"7747774\n",
"1000000000000000000\n"
] | [
"NO\n",
"YES\n",
"NO\n"
] | In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO". | 500 | [
{
"input": "40047",
"output": "NO"
},
{
"input": "7747774",
"output": "YES"
},
{
"input": "1000000000000000000",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "4",
"output": "NO"
},
{
"input": "474404774",
"output": "NO"
},
{
"input": "4744000695826",
"output": "YES"
},
{
"input": "10000000004744744",
"output": "YES"
},
{
"input": "446486416781684178",
"output": "YES"
},
{
"input": "999999999",
"output": "NO"
},
{
"input": "7777",
"output": "YES"
},
{
"input": "87414417444",
"output": "NO"
},
{
"input": "111222333444555667",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "4700",
"output": "NO"
},
{
"input": "3794555488744477",
"output": "NO"
},
{
"input": "444444444444444444",
"output": "NO"
},
{
"input": "474447447774444774",
"output": "NO"
},
{
"input": "777777777777777",
"output": "NO"
},
{
"input": "34777745021000000",
"output": "NO"
},
{
"input": "963",
"output": "NO"
},
{
"input": "855474448854788540",
"output": "NO"
},
{
"input": "999999999999994744",
"output": "YES"
},
{
"input": "400000000474",
"output": "YES"
},
{
"input": "123456789123456789",
"output": "YES"
},
{
"input": "740577777584945874",
"output": "NO"
},
{
"input": "7777777",
"output": "YES"
},
{
"input": "4444000111222333",
"output": "YES"
},
{
"input": "9847745885202111",
"output": "YES"
},
{
"input": "123456000000",
"output": "NO"
},
{
"input": "4744447444444",
"output": "NO"
},
{
"input": "7477",
"output": "YES"
},
{
"input": "4747477",
"output": "YES"
},
{
"input": "777777777444444444",
"output": "NO"
}
] | 1,696,930,740 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 62 | 0 | text = input()
near = True
for dt in text:
if int(dt) != 7 and int(dt) != 4:
near = False
if near:
print("YES")
else:
print("NO")
quit()
| Title: Nearly Lucky Number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Output Specification:
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
Demo Input:
['40047\n', '7747774\n', '1000000000000000000\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO". | ```python
text = input()
near = True
for dt in text:
if int(dt) != 7 and int(dt) != 4:
near = False
if near:
print("YES")
else:
print("NO")
quit()
``` | 0 |
814 | A | An abandoned sentiment from past | PROGRAMMING | 900 | [
"constructive algorithms",
"greedy",
"implementation",
"sortings"
] | null | null | A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing. | The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total. | Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise. | [
"4 2\n11 0 0 14\n5 4\n",
"6 1\n2 3 0 8 9 10\n5\n",
"4 1\n8 94 0 4\n89\n",
"7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n"
] | [
"Yes\n",
"No\n",
"Yes\n",
"Yes\n"
] | In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid. | 500 | [
{
"input": "4 2\n11 0 0 14\n5 4",
"output": "Yes"
},
{
"input": "6 1\n2 3 0 8 9 10\n5",
"output": "No"
},
{
"input": "4 1\n8 94 0 4\n89",
"output": "Yes"
},
{
"input": "7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7",
"output": "Yes"
},
{
"input": "40 1\n23 26 27 28 31 35 38 40 43 50 52 53 56 57 59 61 65 73 75 76 79 0 82 84 85 86 88 93 99 101 103 104 105 106 110 111 112 117 119 120\n80",
"output": "No"
},
{
"input": "100 1\n99 95 22 110 47 20 37 34 23 0 16 69 64 49 111 42 112 96 13 40 18 77 44 46 74 55 15 54 56 75 78 100 82 101 31 83 53 80 52 63 30 57 104 36 67 65 103 51 48 26 68 59 35 92 85 38 107 98 73 90 62 43 32 89 19 106 17 88 41 72 113 86 66 102 81 27 29 50 71 79 109 91 70 39 61 76 93 84 108 97 24 25 45 105 94 60 33 87 14 21\n58",
"output": "Yes"
},
{
"input": "4 1\n2 1 0 4\n3",
"output": "Yes"
},
{
"input": "2 1\n199 0\n200",
"output": "No"
},
{
"input": "3 2\n115 0 0\n145 191",
"output": "Yes"
},
{
"input": "5 1\n196 197 198 0 200\n199",
"output": "No"
},
{
"input": "5 1\n92 0 97 99 100\n93",
"output": "No"
},
{
"input": "3 1\n3 87 0\n81",
"output": "Yes"
},
{
"input": "3 1\n0 92 192\n118",
"output": "Yes"
},
{
"input": "10 1\n1 3 0 7 35 46 66 72 83 90\n22",
"output": "Yes"
},
{
"input": "100 1\n14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 0 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113\n67",
"output": "No"
},
{
"input": "100 5\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 0 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 0 53 54 0 56 57 58 59 60 61 62 63 0 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 0 99 100\n98 64 55 52 29",
"output": "Yes"
},
{
"input": "100 5\n175 30 124 0 12 111 6 0 119 108 0 38 127 3 151 114 95 54 4 128 91 11 168 120 80 107 18 21 149 169 0 141 195 20 78 157 33 118 17 69 105 130 197 57 74 110 138 84 71 172 132 93 191 44 152 156 24 101 146 26 2 36 143 122 104 42 103 97 39 116 115 0 155 87 53 85 7 43 65 196 136 154 16 79 45 129 67 150 35 73 55 76 37 147 112 82 162 58 40 75\n121 199 62 193 27",
"output": "Yes"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 0 10 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n11",
"output": "Yes"
},
{
"input": "100 1\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n1",
"output": "No"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 0\n100",
"output": "No"
},
{
"input": "100 1\n9 79 7 98 10 50 28 99 43 74 89 20 32 66 23 45 87 78 81 41 86 71 75 85 5 39 14 53 42 48 40 52 3 51 11 34 35 76 77 61 47 19 55 91 62 56 8 72 88 4 33 0 97 92 31 83 18 49 54 21 17 16 63 44 84 22 2 96 70 36 68 60 80 82 13 73 26 94 27 58 1 30 100 38 12 15 93 90 57 59 67 6 64 46 25 29 37 95 69 24\n65",
"output": "Yes"
},
{
"input": "100 2\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 0 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n48 1",
"output": "Yes"
},
{
"input": "100 1\n2 7 11 17 20 22 23 24 25 27 29 30 31 33 34 35 36 38 39 40 42 44 46 47 50 52 53 58 59 60 61 62 63 66 0 67 71 72 75 79 80 81 86 91 93 94 99 100 101 102 103 104 105 108 109 110 111 113 114 118 119 120 122 123 127 129 130 131 132 133 134 135 136 138 139 140 141 142 147 154 155 156 160 168 170 171 172 176 179 180 181 182 185 186 187 188 189 190 194 198\n69",
"output": "Yes"
},
{
"input": "100 1\n3 5 7 9 11 12 13 18 20 21 22 23 24 27 28 29 31 34 36 38 39 43 46 48 49 50 52 53 55 59 60 61 62 63 66 68 70 72 73 74 75 77 78 79 80 81 83 85 86 88 89 91 92 94 97 98 102 109 110 115 116 117 118 120 122 126 127 128 0 133 134 136 137 141 142 144 145 147 151 152 157 159 160 163 164 171 172 175 176 178 179 180 181 184 186 188 190 192 193 200\n129",
"output": "No"
},
{
"input": "5 2\n0 2 7 0 10\n1 8",
"output": "Yes"
},
{
"input": "3 1\n5 4 0\n1",
"output": "Yes"
},
{
"input": "3 1\n1 0 3\n4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n1",
"output": "No"
},
{
"input": "2 1\n0 5\n7",
"output": "Yes"
},
{
"input": "5 1\n10 11 0 12 13\n1",
"output": "Yes"
},
{
"input": "5 1\n0 2 3 4 5\n6",
"output": "Yes"
},
{
"input": "6 2\n1 0 3 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "7 2\n1 2 3 0 0 6 7\n4 5",
"output": "Yes"
},
{
"input": "4 1\n1 2 3 0\n4",
"output": "No"
},
{
"input": "2 2\n0 0\n1 2",
"output": "Yes"
},
{
"input": "3 2\n1 0 0\n2 3",
"output": "Yes"
},
{
"input": "4 2\n1 0 4 0\n5 2",
"output": "Yes"
},
{
"input": "2 1\n0 1\n2",
"output": "Yes"
},
{
"input": "5 2\n1 0 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 4 5\n1",
"output": "Yes"
},
{
"input": "3 1\n0 2 3\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 5 0\n6",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n5 0 2\n7",
"output": "Yes"
},
{
"input": "4 1\n4 5 0 8\n3",
"output": "Yes"
},
{
"input": "5 1\n10 11 12 0 14\n13",
"output": "No"
},
{
"input": "4 1\n1 2 0 4\n5",
"output": "Yes"
},
{
"input": "3 1\n0 11 14\n12",
"output": "Yes"
},
{
"input": "4 1\n1 3 0 4\n2",
"output": "Yes"
},
{
"input": "2 1\n0 5\n1",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 7\n5",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n1",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 5 4\n6",
"output": "Yes"
},
{
"input": "4 2\n11 0 0 14\n13 12",
"output": "Yes"
},
{
"input": "2 1\n1 0\n2",
"output": "No"
},
{
"input": "3 1\n1 2 0\n3",
"output": "No"
},
{
"input": "4 1\n1 0 3 2\n4",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n5",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n3",
"output": "Yes"
},
{
"input": "4 1\n0 2 3 4\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n1 2 0\n5",
"output": "No"
},
{
"input": "4 2\n1 0 0 4\n3 2",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 5 7\n6",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n4",
"output": "No"
},
{
"input": "3 1\n1 0 11\n5",
"output": "No"
},
{
"input": "4 1\n7 9 5 0\n8",
"output": "Yes"
},
{
"input": "6 2\n1 2 3 0 5 0\n6 4",
"output": "Yes"
},
{
"input": "3 2\n0 1 0\n3 2",
"output": "Yes"
},
{
"input": "4 1\n6 9 5 0\n8",
"output": "Yes"
},
{
"input": "2 1\n0 3\n6",
"output": "Yes"
},
{
"input": "5 2\n1 2 0 0 5\n4 3",
"output": "Yes"
},
{
"input": "4 2\n2 0 0 8\n3 4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n3",
"output": "Yes"
},
{
"input": "3 1\n0 4 5\n6",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 0 5\n6",
"output": "Yes"
},
{
"input": "2 1\n2 0\n3",
"output": "No"
},
{
"input": "4 2\n11 0 0 200\n100 199",
"output": "Yes"
},
{
"input": "2 1\n5 0\n4",
"output": "Yes"
},
{
"input": "3 1\n1 0 5\n10",
"output": "Yes"
},
{
"input": "6 2\n1 2 0 0 5 6\n3 4",
"output": "Yes"
},
{
"input": "5 2\n1 0 3 0 5\n2 4",
"output": "Yes"
},
{
"input": "4 1\n1 4 0 8\n3",
"output": "Yes"
},
{
"input": "4 1\n5 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 7\n3 2",
"output": "Yes"
},
{
"input": "3 3\n0 0 0\n1 4 3",
"output": "Yes"
},
{
"input": "5 5\n0 0 0 0 0\n5 4 3 2 1",
"output": "Yes"
},
{
"input": "4 1\n3 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 4\n2 3",
"output": "Yes"
},
{
"input": "6 1\n2 4 0 8 9 10\n3",
"output": "Yes"
},
{
"input": "4 1\n0 3 5 6\n9",
"output": "Yes"
},
{
"input": "4 2\n1 2 0 0\n3 4",
"output": "Yes"
},
{
"input": "5 1\n2 3 4 5 0\n1",
"output": "Yes"
},
{
"input": "3 1\n2 0 4\n5",
"output": "Yes"
}
] | 1,497,040,725 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 61 | 0 | '''input
7 7
0 0 0 0 0 0 0
1 2 3 4 5 6 7
'''
n, k = map(int, input().split())
a = list(map(int, input().split()))
b = sorted(map(int, input().split()))
ans = "No"
for x in range(n-1):
if a[x] == a[x+1] == 0:
ans = "Yes"
if a[0] == 0 and b[-1] > a[1]:
ans = "Yes"
for y in range(1, n):
if a[y] == 0 and b[0] < a[y-1]:
ans = "Yes"
break
print(ans)
| Title: An abandoned sentiment from past
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing.
Input Specification:
The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total.
Output Specification:
Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise.
Demo Input:
['4 2\n11 0 0 14\n5 4\n', '6 1\n2 3 0 8 9 10\n5\n', '4 1\n8 94 0 4\n89\n', '7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n', 'Yes\n']
Note:
In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid. | ```python
'''input
7 7
0 0 0 0 0 0 0
1 2 3 4 5 6 7
'''
n, k = map(int, input().split())
a = list(map(int, input().split()))
b = sorted(map(int, input().split()))
ans = "No"
for x in range(n-1):
if a[x] == a[x+1] == 0:
ans = "Yes"
if a[0] == 0 and b[-1] > a[1]:
ans = "Yes"
for y in range(1, n):
if a[y] == 0 and b[0] < a[y-1]:
ans = "Yes"
break
print(ans)
``` | 0 |
|
710 | A | King Moves | PROGRAMMING | 800 | [
"implementation"
] | null | null | The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)). | The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'. | Print the only integer *x* — the number of moves permitted for the king. | [
"e4\n"
] | [
"8\n"
] | none | 0 | [
{
"input": "e4",
"output": "8"
},
{
"input": "a1",
"output": "3"
},
{
"input": "h8",
"output": "3"
},
{
"input": "a4",
"output": "5"
},
{
"input": "g7",
"output": "8"
},
{
"input": "e1",
"output": "5"
},
{
"input": "b2",
"output": "8"
},
{
"input": "c7",
"output": "8"
},
{
"input": "h6",
"output": "5"
},
{
"input": "c8",
"output": "5"
},
{
"input": "h2",
"output": "5"
},
{
"input": "h5",
"output": "5"
},
{
"input": "a8",
"output": "3"
},
{
"input": "f8",
"output": "5"
},
{
"input": "h1",
"output": "3"
},
{
"input": "f2",
"output": "8"
},
{
"input": "e8",
"output": "5"
},
{
"input": "h3",
"output": "5"
},
{
"input": "b8",
"output": "5"
},
{
"input": "g8",
"output": "5"
},
{
"input": "d8",
"output": "5"
},
{
"input": "h4",
"output": "5"
},
{
"input": "b1",
"output": "5"
},
{
"input": "a2",
"output": "5"
}
] | 1,652,336,565 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | s=input()
a=s[0]
b=s[1]
c=8
if a=='a' or a=='h':
c-=3
if b=='1' or b=='8':
c-=2
elif b=='1' or b=='8':
c-=3
if a=='a' or a=='h':
c-=2
print(c)
| Title: King Moves
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
Input Specification:
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
Output Specification:
Print the only integer *x* — the number of moves permitted for the king.
Demo Input:
['e4\n']
Demo Output:
['8\n']
Note:
none | ```python
s=input()
a=s[0]
b=s[1]
c=8
if a=='a' or a=='h':
c-=3
if b=='1' or b=='8':
c-=2
elif b=='1' or b=='8':
c-=3
if a=='a' or a=='h':
c-=2
print(c)
``` | 0 |
|
219 | A | k-String | PROGRAMMING | 1,000 | [
"implementation",
"strings"
] | null | null | A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string.
You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string. | The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*. | Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them.
If the solution doesn't exist, print "-1" (without quotes). | [
"2\naazz\n",
"3\nabcabcabz\n"
] | [
"azaz\n",
"-1\n"
] | none | 500 | [
{
"input": "2\naazz",
"output": "azaz"
},
{
"input": "3\nabcabcabz",
"output": "-1"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "2\nabba",
"output": "abab"
},
{
"input": "2\naaab",
"output": "-1"
},
{
"input": "7\nabacaba",
"output": "-1"
},
{
"input": "5\naaaaa",
"output": "aaaaa"
},
{
"input": "3\naabaaaaabb",
"output": "-1"
},
{
"input": "2\naaab",
"output": "-1"
},
{
"input": "2\nbabac",
"output": "-1"
},
{
"input": "3\nbbbccc",
"output": "bcbcbc"
},
{
"input": "2\naa",
"output": "aa"
},
{
"input": "250\ncececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece",
"output": "cececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece"
},
{
"input": "15\nabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaa",
"output": "aaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbc"
},
{
"input": "1\naaa",
"output": "aaa"
},
{
"input": "1\naabaab",
"output": "aaaabb"
},
{
"input": "2\naabbbbccccccdddddddd",
"output": "abbcccddddabbcccdddd"
},
{
"input": "3\naaaaaaaaacccdddddd",
"output": "aaacddaaacddaaacdd"
},
{
"input": "3\naaaaaaaaacccbbbbbb",
"output": "aaabbcaaabbcaaabbc"
},
{
"input": "2\naazzzz",
"output": "azzazz"
},
{
"input": "2\naaaa",
"output": "aaaa"
},
{
"input": "2\naaaazz",
"output": "aazaaz"
},
{
"input": "2\naaaabb",
"output": "aabaab"
},
{
"input": "2\naabbbb",
"output": "abbabb"
},
{
"input": "2\naaaazzzz",
"output": "aazzaazz"
},
{
"input": "2\naaazz",
"output": "-1"
},
{
"input": "2\nbbbbaa",
"output": "abbabb"
},
{
"input": "2\naaaaaabbbb",
"output": "aaabbaaabb"
},
{
"input": "2\naaaaaazz",
"output": "aaazaaaz"
},
{
"input": "2\naaaabbbb",
"output": "aabbaabb"
},
{
"input": "2\naabaab",
"output": "aabaab"
},
{
"input": "1\naaaaa",
"output": "aaaaa"
},
{
"input": "2\nbbaaaa",
"output": "aabaab"
},
{
"input": "2\nacaccc",
"output": "accacc"
}
] | 1,697,023,730 | 2,147,483,647 | Python 3 | OK | TESTS | 42 | 92 | 0 | d = {}
k = int(input())
s = input()
for i in s:
if i not in d:
d[i] =1
else:
d[i] +=1
flag= 1
a = ""
for key,value in d.items():
if value%k != 0:
flag = 0
break
else:
a += key*(value//k)
if flag:
print(a*k)
else:
print(-1)
| Title: k-String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string.
You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
Input Specification:
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
Output Specification:
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them.
If the solution doesn't exist, print "-1" (without quotes).
Demo Input:
['2\naazz\n', '3\nabcabcabz\n']
Demo Output:
['azaz\n', '-1\n']
Note:
none | ```python
d = {}
k = int(input())
s = input()
for i in s:
if i not in d:
d[i] =1
else:
d[i] +=1
flag= 1
a = ""
for key,value in d.items():
if value%k != 0:
flag = 0
break
else:
a += key*(value//k)
if flag:
print(a*k)
else:
print(-1)
``` | 3 |
|
837 | A | Text Volume | PROGRAMMING | 800 | [
"implementation"
] | null | null | You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text. | The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters. | Print one integer number — volume of text. | [
"7\nNonZERO\n",
"24\nthis is zero answer text\n",
"24\nHarbour Space University\n"
] | [
"5\n",
"0\n",
"1\n"
] | In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters. | 0 | [
{
"input": "7\nNonZERO",
"output": "5"
},
{
"input": "24\nthis is zero answer text",
"output": "0"
},
{
"input": "24\nHarbour Space University",
"output": "1"
},
{
"input": "2\nWM",
"output": "2"
},
{
"input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz",
"output": "105"
},
{
"input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g",
"output": "1"
},
{
"input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez",
"output": "50"
},
{
"input": "1\ne",
"output": "0"
},
{
"input": "1\nA",
"output": "1"
},
{
"input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ",
"output": "10"
},
{
"input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "200"
},
{
"input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "24\nHarbour Space UniversitY",
"output": "2"
},
{
"input": "5\naA AA",
"output": "2"
},
{
"input": "10\nas AS ASDA",
"output": "4"
},
{
"input": "10\nas AS ASDZ",
"output": "4"
},
{
"input": "3\na A",
"output": "1"
},
{
"input": "24\nHarbour space UniversitY",
"output": "2"
},
{
"input": "10\nas AS ASAa",
"output": "3"
},
{
"input": "15\naAb ABCDFGRHTJS",
"output": "11"
},
{
"input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR",
"output": "6"
},
{
"input": "10\nABC ABc AB",
"output": "3"
},
{
"input": "10\nA c de CDE",
"output": "3"
},
{
"input": "4\nA AB",
"output": "2"
},
{
"input": "18\nHARbour Space UNIV",
"output": "4"
},
{
"input": "13\na b c d e f A",
"output": "1"
},
{
"input": "6\nA B CA",
"output": "2"
},
{
"input": "4\naa A",
"output": "1"
},
{
"input": "3\nA a",
"output": "1"
}
] | 1,594,299,758 | 2,147,483,647 | Python 3 | OK | TESTS | 29 | 124 | 6,758,400 | size = int(input())
st = str(input())
counter = 0
maximal = 0
for i in range(0, size):
if st[i] < 'a' and st[i] != ' ':
counter += 1
if st[i] == ' ' or i == (size - 1):
if maximal < counter:
maximal = counter
counter = 0
print(maximal) | Title: Text Volume
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Output Specification:
Print one integer number — volume of text.
Demo Input:
['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n']
Demo Output:
['5\n', '0\n', '1\n']
Note:
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters. | ```python
size = int(input())
st = str(input())
counter = 0
maximal = 0
for i in range(0, size):
if st[i] < 'a' and st[i] != ' ':
counter += 1
if st[i] == ' ' or i == (size - 1):
if maximal < counter:
maximal = counter
counter = 0
print(maximal)
``` | 3 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
] | A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] | [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] | none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,679,390,669 | 2,147,483,647 | Python 3 | OK | TESTS | 102 | 61 | 0 | n1=str(input())
n2=str(input())
s=""
for i in range (0,len(n1)):
if n1[i]==n2[i]:
s+="0"
else:
s+="1"
print(s) | Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
n1=str(input())
n2=str(input())
s=""
for i in range (0,len(n1)):
if n1[i]==n2[i]:
s+="0"
else:
s+="1"
print(s)
``` | 3.98475 |
834 | B | The Festive Evening | PROGRAMMING | 1,100 | [
"data structures",
"implementation"
] | null | null | It's the end of July – the time when a festive evening is held at Jelly Castle! Guests from all over the kingdom gather here to discuss new trends in the world of confectionery. Yet some of the things discussed here are not supposed to be disclosed to the general public: the information can cause discord in the kingdom of Sweetland in case it turns out to reach the wrong hands. So it's a necessity to not let any uninvited guests in.
There are 26 entrances in Jelly Castle, enumerated with uppercase English letters from A to Z. Because of security measures, each guest is known to be assigned an entrance he should enter the castle through. The door of each entrance is opened right before the first guest's arrival and closed right after the arrival of the last guest that should enter the castle through this entrance. No two guests can enter the castle simultaneously.
For an entrance to be protected from possible intrusion, a candy guard should be assigned to it. There are *k* such guards in the castle, so if there are more than *k* opened doors, one of them is going to be left unguarded! Notice that a guard can't leave his post until the door he is assigned to is closed.
Slastyona had a suspicion that there could be uninvited guests at the evening. She knows the order in which the invited guests entered the castle, and wants you to help her check whether there was a moment when more than *k* doors were opened. | Two integers are given in the first string: the number of guests *n* and the number of guards *k* (1<=≤<=*n*<=≤<=106, 1<=≤<=*k*<=≤<=26).
In the second string, *n* uppercase English letters *s*1*s*2... *s**n* are given, where *s**i* is the entrance used by the *i*-th guest. | Output «YES» if at least one door was unguarded during some time, and «NO» otherwise.
You can output each letter in arbitrary case (upper or lower). | [
"5 1\nAABBB\n",
"5 1\nABABB\n"
] | [
"NO\n",
"YES\n"
] | In the first sample case, the door A is opened right before the first guest's arrival and closed when the second guest enters the castle. The door B is opened right before the arrival of the third guest, and closed after the fifth one arrives. One guard can handle both doors, as the first one is closed before the second one is opened.
In the second sample case, the door B is opened before the second guest's arrival, but the only guard can't leave the door A unattended, as there is still one more guest that should enter the castle through this door. | 1,000 | [
{
"input": "5 1\nAABBB",
"output": "NO"
},
{
"input": "5 1\nABABB",
"output": "YES"
},
{
"input": "26 1\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "NO"
},
{
"input": "27 1\nABCDEFGHIJKLMNOPQRSTUVWXYZA",
"output": "YES"
},
{
"input": "5 2\nABACA",
"output": "NO"
},
{
"input": "6 2\nABCABC",
"output": "YES"
},
{
"input": "8 3\nABCBCDCA",
"output": "NO"
},
{
"input": "73 2\nDEBECECBBADAADEAABEAEEEAEBEAEBCDDBABBAEBACCBEEBBAEADEECACEDEEDABACDCDBBBD",
"output": "YES"
},
{
"input": "44 15\nHGJIFCGGCDGIJDHBIBGAEABCIABIGBDEADBBBAGDFDHA",
"output": "NO"
},
{
"input": "41 19\nTMEYYIIELFDCMBDKWWKYNRNDUPRONYROXQCLVQALP",
"output": "NO"
},
{
"input": "377 3\nEADADBBBBDEAABBAEBABACDBDBBCACAADBEAEACDEAABACADEEDEACACDADABBBBDDEECBDABACACBAECBADAEBDEEBDBCDAEADBCDDACACDCCEEDBCCBBCEDBECBABCDDBBDEADEDAEACDECECBEBACBCCDCDBDAECDECADBCBEDBBDAAEBCAAECCDCCDBDDEBADEEBDCAEABBDEDBBDDEAECCBDDCDEACDAECCBDDABABEAEDCDEDBAECBDEACEBCECEACDCBABCBAAEAADACADBBBBABEADBCADEBCBECCABBDDDEEBCDEBADEBDAAABBEABADEDEAEABCEEBEEDEAEBEABCEDDBACBCCADEBAAAAAEABABBCE",
"output": "YES"
},
{
"input": "433 3\nFZDDHMJGBZCHFUXBBPIEBBEFDWOMXXEPOMDGSMPIUZOMRZQNSJAVNATGIWPDFISKFQXJNVFXPHOZDAEZFDAHDXXQKZMGNSGKQNWGNGJGJZVVITKNFLVCPMZSDMCHBTVAWYVZLIXXIADXNYILEYNIQHKMOGMVOCWGHCWIYMPEPADSJAAKEGTUSEDWAHMNYJDIHBKHVUHLYGNGZDBULRXLSAJHPCMNWCEAAPYMHDTYWPADOTJTXTXUKLCHWKUSZRHEKQEFPVJEJJHRWCKYOIWALRTIBUMNOCRXLSIKQCJVQXEPGOHRUDJDKMUUUDORURWXJNVRVMNOUNRFKSVMTMZGOIJLXEPAMVGESOADYIGZXRBJDIWKNOWTCSROAQTBECHTOZVSQUOOJRZIBAUHMKAXDCIMDZJFMABGRNTGPUJAUNFPFWCJG",
"output": "YES"
},
{
"input": "5 2\nABCAB",
"output": "YES"
},
{
"input": "5 1\nAZAZA",
"output": "YES"
},
{
"input": "7 2\nABCDBCD",
"output": "YES"
},
{
"input": "3 26\nAAB",
"output": "NO"
}
] | 1,515,105,425 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 1,000 | 8,806,400 | n, k = list(map(int, input().split()))
doors = input()
used = {}
free = k
for i in range(n):
t = doors[i]
if t not in used and free == 0:
print("YES")
exit()
if t not in used:
free -= 1
used[t] = used.get(t, doors.count(t)) - 1
if used[t] == 0:
free += 1
print("NO") | Title: The Festive Evening
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's the end of July – the time when a festive evening is held at Jelly Castle! Guests from all over the kingdom gather here to discuss new trends in the world of confectionery. Yet some of the things discussed here are not supposed to be disclosed to the general public: the information can cause discord in the kingdom of Sweetland in case it turns out to reach the wrong hands. So it's a necessity to not let any uninvited guests in.
There are 26 entrances in Jelly Castle, enumerated with uppercase English letters from A to Z. Because of security measures, each guest is known to be assigned an entrance he should enter the castle through. The door of each entrance is opened right before the first guest's arrival and closed right after the arrival of the last guest that should enter the castle through this entrance. No two guests can enter the castle simultaneously.
For an entrance to be protected from possible intrusion, a candy guard should be assigned to it. There are *k* such guards in the castle, so if there are more than *k* opened doors, one of them is going to be left unguarded! Notice that a guard can't leave his post until the door he is assigned to is closed.
Slastyona had a suspicion that there could be uninvited guests at the evening. She knows the order in which the invited guests entered the castle, and wants you to help her check whether there was a moment when more than *k* doors were opened.
Input Specification:
Two integers are given in the first string: the number of guests *n* and the number of guards *k* (1<=≤<=*n*<=≤<=106, 1<=≤<=*k*<=≤<=26).
In the second string, *n* uppercase English letters *s*1*s*2... *s**n* are given, where *s**i* is the entrance used by the *i*-th guest.
Output Specification:
Output «YES» if at least one door was unguarded during some time, and «NO» otherwise.
You can output each letter in arbitrary case (upper or lower).
Demo Input:
['5 1\nAABBB\n', '5 1\nABABB\n']
Demo Output:
['NO\n', 'YES\n']
Note:
In the first sample case, the door A is opened right before the first guest's arrival and closed when the second guest enters the castle. The door B is opened right before the arrival of the third guest, and closed after the fifth one arrives. One guard can handle both doors, as the first one is closed before the second one is opened.
In the second sample case, the door B is opened before the second guest's arrival, but the only guard can't leave the door A unattended, as there is still one more guest that should enter the castle through this door. | ```python
n, k = list(map(int, input().split()))
doors = input()
used = {}
free = k
for i in range(n):
t = doors[i]
if t not in used and free == 0:
print("YES")
exit()
if t not in used:
free -= 1
used[t] = used.get(t, doors.count(t)) - 1
if used[t] == 0:
free += 1
print("NO")
``` | 0 |
|
887 | B | Cubes for Masha | PROGRAMMING | 1,300 | [
"brute force",
"implementation"
] | null | null | Absent-minded Masha got set of *n* cubes for her birthday.
At each of 6 faces of each cube, there is exactly one digit from 0 to 9. Masha became interested what is the largest natural *x* such she can make using her new cubes all integers from 1 to *x*.
To make a number Masha can rotate her cubes and put them in a row. After that, she looks at upper faces of cubes from left to right and reads the number.
The number can't contain leading zeros. It's not required to use all cubes to build a number.
Pay attention: Masha can't make digit 6 from digit 9 and vice-versa using cube rotations. | In first line integer *n* is given (1<=≤<=*n*<=≤<=3) — the number of cubes, Masha got for her birthday.
Each of next *n* lines contains 6 integers *a**i**j* (0<=≤<=*a**i**j*<=≤<=9) — number on *j*-th face of *i*-th cube. | Print single integer — maximum number *x* such Masha can make any integers from 1 to *x* using her cubes or 0 if Masha can't make even 1. | [
"3\n0 1 2 3 4 5\n6 7 8 9 0 1\n2 3 4 5 6 7\n",
"3\n0 1 3 5 6 8\n1 2 4 5 7 8\n2 3 4 6 7 9\n"
] | [
"87",
"98"
] | In the first test case, Masha can build all numbers from 1 to 87, but she can't make 88 because there are no two cubes with digit 8. | 1,000 | [
{
"input": "3\n0 1 2 3 4 5\n6 7 8 9 0 1\n2 3 4 5 6 7",
"output": "87"
},
{
"input": "3\n0 1 3 5 6 8\n1 2 4 5 7 8\n2 3 4 6 7 9",
"output": "98"
},
{
"input": "3\n0 1 2 3 4 5\n0 1 2 3 4 5\n0 1 2 3 4 5",
"output": "5"
},
{
"input": "3\n1 2 3 7 8 9\n9 8 7 1 2 3\n7 9 2 3 1 8",
"output": "3"
},
{
"input": "1\n5 2 2 5 6 7",
"output": "0"
},
{
"input": "1\n7 6 5 8 9 0",
"output": "0"
},
{
"input": "1\n2 5 9 6 7 9",
"output": "0"
},
{
"input": "1\n6 3 1 9 4 9",
"output": "1"
},
{
"input": "1\n1 9 8 3 7 8",
"output": "1"
},
{
"input": "2\n1 7 2 0 4 3\n5 2 3 6 1 0",
"output": "7"
},
{
"input": "2\n6 0 1 7 2 9\n1 3 4 6 7 0",
"output": "4"
},
{
"input": "2\n8 6 4 1 2 0\n7 8 5 3 2 1",
"output": "8"
},
{
"input": "2\n0 8 6 2 1 3\n5 2 7 1 0 9",
"output": "3"
},
{
"input": "2\n0 9 5 7 6 2\n8 6 2 7 1 4",
"output": "2"
},
{
"input": "3\n5 0 7 6 2 1\n2 7 4 6 1 9\n0 2 6 1 7 5",
"output": "2"
},
{
"input": "3\n0 6 2 9 5 4\n3 8 0 1 6 9\n6 9 0 1 5 2",
"output": "6"
},
{
"input": "3\n5 6 2 9 3 5\n5 4 1 5 9 8\n4 4 2 0 3 5",
"output": "6"
},
{
"input": "3\n0 1 9 1 0 8\n9 9 3 5 6 2\n9 3 9 9 7 3",
"output": "3"
},
{
"input": "3\n2 5 7 4 2 7\n1 5 5 9 0 3\n8 2 0 1 5 1",
"output": "5"
},
{
"input": "1\n4 6 9 8 2 7",
"output": "0"
},
{
"input": "1\n5 3 8 0 2 6",
"output": "0"
},
{
"input": "1\n7 9 5 0 4 6",
"output": "0"
},
{
"input": "1\n4 0 9 6 3 1",
"output": "1"
},
{
"input": "1\n7 9 2 5 0 4",
"output": "0"
},
{
"input": "1\n0 7 6 3 2 4",
"output": "0"
},
{
"input": "1\n9 8 1 6 5 7",
"output": "1"
},
{
"input": "1\n7 3 6 9 8 1",
"output": "1"
},
{
"input": "1\n3 9 1 7 4 5",
"output": "1"
},
{
"input": "1\n8 6 0 9 4 2",
"output": "0"
},
{
"input": "1\n8 2 7 4 1 0",
"output": "2"
},
{
"input": "1\n8 3 5 4 2 9",
"output": "0"
},
{
"input": "1\n0 8 7 1 3 2",
"output": "3"
},
{
"input": "1\n6 2 8 5 1 3",
"output": "3"
},
{
"input": "1\n6 0 7 5 4 8",
"output": "0"
},
{
"input": "1\n6 2 8 4 5 1",
"output": "2"
},
{
"input": "1\n4 3 8 9 2 3",
"output": "0"
},
{
"input": "1\n8 1 9 2 9 7",
"output": "2"
},
{
"input": "1\n3 7 7 6 4 2",
"output": "0"
},
{
"input": "1\n1 4 5 7 0 5",
"output": "1"
},
{
"input": "2\n6 6 4 7 9 0\n2 1 2 8 6 4",
"output": "2"
},
{
"input": "2\n5 3 2 9 8 2\n0 7 4 8 1 8",
"output": "5"
},
{
"input": "2\n5 7 4 2 1 9\n2 2 7 1 1 8",
"output": "2"
},
{
"input": "2\n9 3 3 6 7 2\n6 2 9 1 5 9",
"output": "3"
},
{
"input": "2\n2 0 5 7 0 8\n4 5 1 5 4 9",
"output": "2"
},
{
"input": "2\n2 6 8 1 3 1\n2 1 3 8 6 7",
"output": "3"
},
{
"input": "2\n4 3 8 6 0 1\n4 7 1 8 9 0",
"output": "1"
},
{
"input": "2\n0 2 9 1 8 5\n0 7 4 3 2 5",
"output": "5"
},
{
"input": "2\n1 7 6 9 2 5\n1 6 7 0 9 2",
"output": "2"
},
{
"input": "2\n0 2 9 8 1 7\n6 7 4 3 2 5",
"output": "9"
},
{
"input": "2\n3 6 8 9 5 0\n6 7 0 8 2 3",
"output": "0"
},
{
"input": "2\n5 1 2 3 0 8\n3 6 7 4 9 2",
"output": "9"
},
{
"input": "2\n7 8 6 1 4 5\n8 6 4 3 2 5",
"output": "8"
},
{
"input": "2\n2 3 5 1 9 6\n1 6 8 7 3 9",
"output": "3"
},
{
"input": "2\n1 7 8 6 0 9\n3 2 1 7 4 9",
"output": "4"
},
{
"input": "2\n2 4 0 3 7 6\n3 2 8 7 1 5",
"output": "8"
},
{
"input": "2\n6 5 2 7 1 3\n3 7 8 1 0 9",
"output": "3"
},
{
"input": "2\n5 8 4 7 1 2\n0 8 6 2 4 9",
"output": "2"
},
{
"input": "2\n8 0 6 5 1 4\n7 1 0 8 3 4",
"output": "1"
},
{
"input": "2\n2 3 9 1 6 7\n2 5 4 3 0 6",
"output": "7"
},
{
"input": "3\n9 4 3 0 2 6\n7 0 5 3 3 9\n1 0 7 4 6 7",
"output": "7"
},
{
"input": "3\n3 8 5 1 5 5\n1 5 7 2 6 9\n4 3 4 8 8 9",
"output": "9"
},
{
"input": "3\n7 7 2 5 3 2\n3 0 0 6 4 4\n1 2 1 1 9 1",
"output": "7"
},
{
"input": "3\n8 1 6 8 6 8\n7 0 2 5 8 4\n5 2 0 3 1 9",
"output": "32"
},
{
"input": "3\n2 7 4 0 7 1\n5 5 4 9 1 4\n2 1 7 5 1 7",
"output": "2"
},
{
"input": "3\n4 4 5 0 6 6\n7 1 6 9 5 4\n5 0 4 0 3 9",
"output": "1"
},
{
"input": "3\n9 4 3 3 9 3\n1 0 3 4 5 3\n2 9 6 2 4 1",
"output": "6"
},
{
"input": "3\n3 8 3 5 5 5\n3 0 1 6 6 3\n0 4 3 7 2 4",
"output": "8"
},
{
"input": "3\n4 1 0 8 0 2\n1 5 3 5 0 7\n7 7 2 7 2 2",
"output": "5"
},
{
"input": "3\n8 1 8 2 7 1\n9 1 9 9 4 7\n0 0 9 0 4 0",
"output": "2"
},
{
"input": "3\n4 6 0 3 9 2\n8 6 9 0 7 2\n6 9 3 2 5 7",
"output": "0"
},
{
"input": "3\n5 1 2 9 6 4\n9 0 6 4 2 8\n4 6 2 8 3 7",
"output": "10"
},
{
"input": "3\n9 3 1 8 4 6\n6 9 1 2 0 7\n8 9 1 5 0 3",
"output": "21"
},
{
"input": "3\n7 1 3 0 2 4\n2 4 3 0 9 5\n1 9 8 0 6 5",
"output": "65"
},
{
"input": "3\n9 4 6 2 7 0\n3 7 1 9 6 4\n6 1 0 8 7 2",
"output": "4"
},
{
"input": "3\n2 7 3 6 4 5\n0 2 1 9 4 8\n8 6 9 5 4 0",
"output": "10"
},
{
"input": "3\n2 6 3 7 1 0\n9 1 2 4 7 6\n1 4 8 7 6 2",
"output": "4"
},
{
"input": "3\n5 4 8 1 6 7\n0 9 3 5 8 6\n2 4 7 8 1 3",
"output": "21"
},
{
"input": "3\n7 2 1 3 6 9\n0 3 8 4 7 6\n1 4 5 8 7 0",
"output": "21"
},
{
"input": "3\n8 6 0 5 4 9\n1 8 5 3 9 7\n7 4 5 1 6 8",
"output": "1"
},
{
"input": "1\n0 1 2 3 4 5",
"output": "5"
},
{
"input": "3\n0 1 1 2 2 3\n4 5 6 7 8 9\n3 4 5 6 7 8",
"output": "9"
},
{
"input": "2\n0 1 2 3 4 5\n6 7 8 9 1 2",
"output": "29"
},
{
"input": "3\n0 1 2 3 4 5\n6 7 8 9 1 2\n3 4 5 6 7 8",
"output": "98"
},
{
"input": "3\n0 1 1 2 2 3\n4 5 6 7 8 9\n3 4 5 6 7 1",
"output": "19"
},
{
"input": "2\n0 1 2 3 4 5\n6 7 8 9 6 6",
"output": "9"
},
{
"input": "2\n0 1 2 3 4 5\n4 5 6 7 8 9",
"output": "9"
},
{
"input": "2\n1 8 9 1 1 0\n2 3 4 5 6 7",
"output": "9"
},
{
"input": "2\n0 1 2 3 4 5\n9 8 7 6 5 4",
"output": "9"
},
{
"input": "3\n2 3 4 5 6 7\n3 4 5 6 7 8\n9 1 2 3 4 5",
"output": "9"
},
{
"input": "3\n1 1 2 3 4 5\n6 7 8 9 0 2\n3 4 5 6 7 8",
"output": "10"
},
{
"input": "3\n1 1 1 0 2 3\n4 5 6 7 8 9\n0 0 0 0 0 0",
"output": "10"
},
{
"input": "3\n0 1 2 2 4 5\n6 7 8 9 0 1\n3 3 4 5 6 7",
"output": "21"
},
{
"input": "3\n2 0 1 3 4 5\n6 7 8 9 1 1\n3 4 5 6 6 7",
"output": "19"
},
{
"input": "3\n1 1 1 1 1 1\n0 2 3 4 5 6\n7 8 9 2 3 4",
"output": "10"
},
{
"input": "2\n0 1 2 3 4 5\n6 6 6 7 8 9",
"output": "9"
},
{
"input": "3\n3 4 5 6 8 9\n1 1 1 1 1 1\n1 2 4 5 7 0",
"output": "19"
}
] | 1,510,115,374 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 1 | 46 | 0 | n=int(input())
a=[]
z=[False]*99
for i in range(n):
a.append(list(map(int,input().split())))
for i in range(n):
for x in a[i]:
z[x]=True
for i in range(n):
for j in range(6):
for k in range(n):
if i!=k:
for p in range(6):
z[a[i][j]*10+a[k][p]]=True
x=1
while z[x]:x+=1
print(x-1)
| Title: Cubes for Masha
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Absent-minded Masha got set of *n* cubes for her birthday.
At each of 6 faces of each cube, there is exactly one digit from 0 to 9. Masha became interested what is the largest natural *x* such she can make using her new cubes all integers from 1 to *x*.
To make a number Masha can rotate her cubes and put them in a row. After that, she looks at upper faces of cubes from left to right and reads the number.
The number can't contain leading zeros. It's not required to use all cubes to build a number.
Pay attention: Masha can't make digit 6 from digit 9 and vice-versa using cube rotations.
Input Specification:
In first line integer *n* is given (1<=≤<=*n*<=≤<=3) — the number of cubes, Masha got for her birthday.
Each of next *n* lines contains 6 integers *a**i**j* (0<=≤<=*a**i**j*<=≤<=9) — number on *j*-th face of *i*-th cube.
Output Specification:
Print single integer — maximum number *x* such Masha can make any integers from 1 to *x* using her cubes or 0 if Masha can't make even 1.
Demo Input:
['3\n0 1 2 3 4 5\n6 7 8 9 0 1\n2 3 4 5 6 7\n', '3\n0 1 3 5 6 8\n1 2 4 5 7 8\n2 3 4 6 7 9\n']
Demo Output:
['87', '98']
Note:
In the first test case, Masha can build all numbers from 1 to 87, but she can't make 88 because there are no two cubes with digit 8. | ```python
n=int(input())
a=[]
z=[False]*99
for i in range(n):
a.append(list(map(int,input().split())))
for i in range(n):
for x in a[i]:
z[x]=True
for i in range(n):
for j in range(6):
for k in range(n):
if i!=k:
for p in range(6):
z[a[i][j]*10+a[k][p]]=True
x=1
while z[x]:x+=1
print(x-1)
``` | -1 |
|
386 | A | Second-Price Auction | PROGRAMMING | 800 | [
"implementation"
] | null | null | In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction).
Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different. | The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder. | The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based. | [
"2\n5 7\n",
"3\n10 2 8\n",
"6\n3 8 2 9 4 14\n"
] | [
"2 5\n",
"1 8\n",
"6 9\n"
] | none | 500 | [
{
"input": "2\n5 7",
"output": "2 5"
},
{
"input": "3\n10 2 8",
"output": "1 8"
},
{
"input": "6\n3 8 2 9 4 14",
"output": "6 9"
},
{
"input": "4\n4707 7586 4221 5842",
"output": "2 5842"
},
{
"input": "5\n3304 4227 4869 6937 6002",
"output": "4 6002"
},
{
"input": "6\n5083 3289 7708 5362 9031 7458",
"output": "5 7708"
},
{
"input": "7\n9038 6222 3392 1706 3778 1807 2657",
"output": "1 6222"
},
{
"input": "8\n7062 2194 4481 3864 7470 1814 8091 733",
"output": "7 7470"
},
{
"input": "9\n2678 5659 9199 2628 7906 7496 4524 2663 3408",
"output": "3 7906"
},
{
"input": "2\n3458 1504",
"output": "1 1504"
},
{
"input": "50\n9237 3904 407 9052 6657 9229 9752 3888 7732 2512 4614 1055 2355 7108 6506 6849 2529 8862 159 8630 7906 7941 960 8470 333 8659 54 9475 3163 5625 6393 6814 2656 3388 169 7918 4881 8468 9983 6281 6340 280 5108 2996 101 7617 3313 8172 326 1991",
"output": "39 9752"
},
{
"input": "100\n2515 3324 7975 6171 4240 1217 4829 5203 8603 6900 3031 4699 4732 6070 4221 3228 6497 7359 9130 4346 4619 1109 3945 5442 3271 16 9711 2045 6410 2301 3406 8125 6003 1892 1260 9661 3940 6692 4708 7027 4930 6925 1979 5361 4263 3144 867 8639 6230 5562 9714 3676 4231 3347 4733 4920 4881 3431 1059 7313 8912 3038 9308 72 9583 7009 3034 7425 2398 6141 3245 2495 2933 6710 8289 9806 1226 8393 7349 6462 1618 9613 3546 6012 2964 9995 1578 210 2123 4874 1252 8625 348 8020 803 7244 9080 5088 706 2602",
"output": "86 9806"
},
{
"input": "2\n2 1",
"output": "1 1"
},
{
"input": "2\n1 2",
"output": "2 1"
},
{
"input": "3\n10 20 30",
"output": "3 20"
},
{
"input": "3\n10 30 20",
"output": "2 20"
},
{
"input": "3\n20 10 30",
"output": "3 20"
},
{
"input": "3\n20 30 10",
"output": "2 20"
},
{
"input": "3\n30 10 20",
"output": "1 20"
},
{
"input": "3\n30 20 10",
"output": "1 20"
},
{
"input": "2\n1 10000",
"output": "2 1"
},
{
"input": "2\n10000 999",
"output": "1 999"
},
{
"input": "3\n3 4 1",
"output": "2 3"
},
{
"input": "6\n1 2 24 6 5 7",
"output": "3 7"
}
] | 1,607,732,359 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 1 | 139 | 0 | nb = int(input())
amt_list = input().split(' ')
winner = max(amt_list)
winner_index = amt_list.index(winner)
amt_list.pop(winner_index)
price_pay = max(amt_list)
print(winner_index+1, price_pay, end =' ')
| Title: Second-Price Auction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In this problem we consider a special type of an auction, which is called the second-price auction. As in regular auction *n* bidders place a bid which is price a bidder ready to pay. The auction is closed, that is, each bidder secretly informs the organizer of the auction price he is willing to pay. After that, the auction winner is the participant who offered the highest price. However, he pay not the price he offers, but the highest price among the offers of other participants (hence the name: the second-price auction).
Write a program that reads prices offered by bidders and finds the winner and the price he will pay. Consider that all of the offered prices are different.
Input Specification:
The first line of the input contains *n* (2<=≤<=*n*<=≤<=1000) — number of bidders. The second line contains *n* distinct integer numbers *p*1,<=*p*2,<=... *p**n*, separated by single spaces (1<=≤<=*p**i*<=≤<=10000), where *p**i* stands for the price offered by the *i*-th bidder.
Output Specification:
The single output line should contain two integers: index of the winner and the price he will pay. Indices are 1-based.
Demo Input:
['2\n5 7\n', '3\n10 2 8\n', '6\n3 8 2 9 4 14\n']
Demo Output:
['2 5\n', '1 8\n', '6 9\n']
Note:
none | ```python
nb = int(input())
amt_list = input().split(' ')
winner = max(amt_list)
winner_index = amt_list.index(winner)
amt_list.pop(winner_index)
price_pay = max(amt_list)
print(winner_index+1, price_pay, end =' ')
``` | 0 |
|
451 | A | Game With Sticks | PROGRAMMING | 900 | [
"implementation"
] | null | null | After winning gold and silver in IOI 2014, Akshat and Malvika want to have some fun. Now they are playing a game on a grid made of *n* horizontal and *m* vertical sticks.
An intersection point is any point on the grid which is formed by the intersection of one horizontal stick and one vertical stick.
In the grid shown below, *n*<==<=3 and *m*<==<=3. There are *n*<=+<=*m*<==<=6 sticks in total (horizontal sticks are shown in red and vertical sticks are shown in green). There are *n*·*m*<==<=9 intersection points, numbered from 1 to 9.
The rules of the game are very simple. The players move in turns. Akshat won gold, so he makes the first move. During his/her move, a player must choose any remaining intersection point and remove from the grid all sticks which pass through this point. A player will lose the game if he/she cannot make a move (i.e. there are no intersection points remaining on the grid at his/her move).
Assume that both players play optimally. Who will win the game? | The first line of input contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). | Print a single line containing "Akshat" or "Malvika" (without the quotes), depending on the winner of the game. | [
"2 2\n",
"2 3\n",
"3 3\n"
] | [
"Malvika\n",
"Malvika\n",
"Akshat\n"
] | Explanation of the first sample:
The grid has four intersection points, numbered from 1 to 4.
If Akshat chooses intersection point 1, then he will remove two sticks (1 - 2 and 1 - 3). The resulting grid will look like this.
Now there is only one remaining intersection point (i.e. 4). Malvika must choose it and remove both remaining sticks. After her move the grid will be empty.
In the empty grid, Akshat cannot make any move, hence he will lose.
Since all 4 intersection points of the grid are equivalent, Akshat will lose no matter which one he picks. | 500 | [
{
"input": "2 2",
"output": "Malvika"
},
{
"input": "2 3",
"output": "Malvika"
},
{
"input": "3 3",
"output": "Akshat"
},
{
"input": "20 68",
"output": "Malvika"
},
{
"input": "1 1",
"output": "Akshat"
},
{
"input": "1 2",
"output": "Akshat"
},
{
"input": "1 3",
"output": "Akshat"
},
{
"input": "2 1",
"output": "Akshat"
},
{
"input": "2 2",
"output": "Malvika"
},
{
"input": "3 1",
"output": "Akshat"
},
{
"input": "3 2",
"output": "Malvika"
},
{
"input": "68 42",
"output": "Malvika"
},
{
"input": "1 35",
"output": "Akshat"
},
{
"input": "25 70",
"output": "Akshat"
},
{
"input": "59 79",
"output": "Akshat"
},
{
"input": "65 63",
"output": "Akshat"
},
{
"input": "46 6",
"output": "Malvika"
},
{
"input": "28 82",
"output": "Malvika"
},
{
"input": "98 98",
"output": "Malvika"
},
{
"input": "98 99",
"output": "Malvika"
},
{
"input": "98 100",
"output": "Malvika"
},
{
"input": "99 98",
"output": "Malvika"
},
{
"input": "99 99",
"output": "Akshat"
},
{
"input": "99 100",
"output": "Akshat"
},
{
"input": "100 98",
"output": "Malvika"
},
{
"input": "100 99",
"output": "Akshat"
},
{
"input": "100 100",
"output": "Malvika"
},
{
"input": "3 4",
"output": "Akshat"
}
] | 1,693,543,316 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 7 | 46 | 0 | n,m=list(map(int,input().split()))
j=[]
for i in range(n):
j.append(['.']*m)
count=0
while len(j)>0:
del j[0]
for i in range(len(j)):
del j[i][0]
count+=1
print(('Akshat','Malvika')[count%2==0]) | Title: Game With Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After winning gold and silver in IOI 2014, Akshat and Malvika want to have some fun. Now they are playing a game on a grid made of *n* horizontal and *m* vertical sticks.
An intersection point is any point on the grid which is formed by the intersection of one horizontal stick and one vertical stick.
In the grid shown below, *n*<==<=3 and *m*<==<=3. There are *n*<=+<=*m*<==<=6 sticks in total (horizontal sticks are shown in red and vertical sticks are shown in green). There are *n*·*m*<==<=9 intersection points, numbered from 1 to 9.
The rules of the game are very simple. The players move in turns. Akshat won gold, so he makes the first move. During his/her move, a player must choose any remaining intersection point and remove from the grid all sticks which pass through this point. A player will lose the game if he/she cannot make a move (i.e. there are no intersection points remaining on the grid at his/her move).
Assume that both players play optimally. Who will win the game?
Input Specification:
The first line of input contains two space-separated integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Output Specification:
Print a single line containing "Akshat" or "Malvika" (without the quotes), depending on the winner of the game.
Demo Input:
['2 2\n', '2 3\n', '3 3\n']
Demo Output:
['Malvika\n', 'Malvika\n', 'Akshat\n']
Note:
Explanation of the first sample:
The grid has four intersection points, numbered from 1 to 4.
If Akshat chooses intersection point 1, then he will remove two sticks (1 - 2 and 1 - 3). The resulting grid will look like this.
Now there is only one remaining intersection point (i.e. 4). Malvika must choose it and remove both remaining sticks. After her move the grid will be empty.
In the empty grid, Akshat cannot make any move, hence he will lose.
Since all 4 intersection points of the grid are equivalent, Akshat will lose no matter which one he picks. | ```python
n,m=list(map(int,input().split()))
j=[]
for i in range(n):
j.append(['.']*m)
count=0
while len(j)>0:
del j[0]
for i in range(len(j)):
del j[i][0]
count+=1
print(('Akshat','Malvika')[count%2==0])
``` | 0 |
|
278 | A | Circle Line | PROGRAMMING | 800 | [
"implementation"
] | null | null | The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations:
- *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station.
The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d**i*<=≤<=100) — the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=≤<=*s*,<=*t*<=≤<=*n*) — the numbers of stations, between which you need to find the shortest distance. These numbers can be the same.
The numbers in the lines are separated by single spaces. | Print a single number — the length of the shortest path between stations number *s* and *t*. | [
"4\n2 3 4 9\n1 3\n",
"4\n5 8 2 100\n4 1\n",
"3\n1 1 1\n3 1\n",
"3\n31 41 59\n1 1\n"
] | [
"5\n",
"15\n",
"1\n",
"0\n"
] | In the first sample the length of path 1 → 2 → 3 equals 5, the length of path 1 → 4 → 3 equals 13.
In the second sample the length of path 4 → 1 is 100, the length of path 4 → 3 → 2 → 1 is 15.
In the third sample the length of path 3 → 1 is 1, the length of path 3 → 2 → 1 is 2.
In the fourth sample the numbers of stations are the same, so the shortest distance equals 0. | 500 | [
{
"input": "4\n2 3 4 9\n1 3",
"output": "5"
},
{
"input": "4\n5 8 2 100\n4 1",
"output": "15"
},
{
"input": "3\n1 1 1\n3 1",
"output": "1"
},
{
"input": "3\n31 41 59\n1 1",
"output": "0"
},
{
"input": "5\n16 13 10 30 15\n4 2",
"output": "23"
},
{
"input": "6\n89 82 87 32 67 33\n4 4",
"output": "0"
},
{
"input": "7\n2 3 17 10 2 2 2\n4 2",
"output": "18"
},
{
"input": "3\n4 37 33\n3 3",
"output": "0"
},
{
"input": "8\n87 40 96 7 86 86 72 97\n6 8",
"output": "158"
},
{
"input": "10\n91 94 75 99 100 91 79 86 79 92\n2 8",
"output": "348"
},
{
"input": "19\n1 1 1 1 2 1 1 1 1 1 2 1 3 2 2 1 1 1 2\n7 7",
"output": "0"
},
{
"input": "34\n96 65 24 99 74 76 97 93 99 69 94 82 92 91 98 83 95 97 96 81 90 95 86 87 43 78 88 86 82 62 76 99 83 96\n21 16",
"output": "452"
},
{
"input": "50\n75 98 65 75 99 89 84 65 9 53 62 61 61 53 80 7 6 47 86 1 89 27 67 1 31 39 53 92 19 20 76 41 60 15 29 94 76 82 87 89 93 38 42 6 87 36 100 97 93 71\n2 6",
"output": "337"
},
{
"input": "99\n1 15 72 78 23 22 26 98 7 2 75 58 100 98 45 79 92 69 79 72 33 88 62 9 15 87 17 73 68 54 34 89 51 91 28 44 20 11 74 7 85 61 30 46 95 72 36 18 48 22 42 46 29 46 86 53 96 55 98 34 60 37 75 54 1 81 20 68 84 19 18 18 75 84 86 57 73 34 23 43 81 87 47 96 57 41 69 1 52 44 54 7 85 35 5 1 19 26 7\n4 64",
"output": "1740"
},
{
"input": "100\n33 63 21 27 49 82 86 93 43 55 4 72 89 85 5 34 80 7 23 13 21 49 22 73 89 65 81 25 6 92 82 66 58 88 48 96 1 1 16 48 67 96 84 63 87 76 20 100 36 4 31 41 35 62 55 76 74 70 68 41 4 16 39 81 2 41 34 73 66 57 41 89 78 93 68 96 87 47 92 60 40 58 81 12 19 74 56 83 56 61 83 97 26 92 62 52 39 57 89 95\n71 5",
"output": "2127"
},
{
"input": "100\n95 98 99 81 98 96 100 92 96 90 99 91 98 98 91 78 97 100 96 98 87 93 96 99 91 92 96 92 90 97 85 83 99 95 66 91 87 89 100 95 100 88 99 84 96 79 99 100 94 100 99 99 92 89 99 91 100 94 98 97 91 92 90 87 84 99 97 98 93 100 90 85 75 95 86 71 98 93 91 87 92 95 98 94 95 94 100 98 96 100 97 96 95 95 86 86 94 97 98 96\n67 57",
"output": "932"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 97 100 100 100 100 100 99 100 100 99 99 100 99 100 100 100 100 100 100 100 100 100 97 99 98 98 100 98 98 100 99 100 100 100 100 99 100 98 100 99 98 99 98 98 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 98 100 99 99 100 96 100 96 100 99 100 100 99 100 99 100 100 100 99 100 100 100 100 98 98 97 100 100 99 98\n16 6",
"output": "997"
},
{
"input": "100\n3 6 23 4 23 1 2 14 2 3 3 9 17 8 10 5 1 14 8 5 7 4 13 8 5 6 24 3 12 3 4 9 2 8 2 1 2 1 3 2 1 6 14 23 8 6 3 5 7 8 18 9 2 5 22 6 13 16 2 4 31 20 4 3 3 6 6 1 1 18 5 11 1 14 4 16 6 37 11 1 8 3 7 11 21 14 3 3 12 2 5 1 9 16 3 1 3 4 4 2\n98 24",
"output": "195"
},
{
"input": "100\n1 1 3 1 1 2 1 2 1 1 2 2 2 1 1 1 1 1 1 3 1 1 1 3 1 3 3 1 1 2 1 1 1 1 1 2 1 1 1 4 1 1 3 3 2 1 1 1 1 1 2 2 1 3 1 1 1 2 4 1 1 2 5 2 1 1 2 1 1 1 2 3 1 1 1 1 2 1 1 1 1 2 1 1 1 1 1 2 2 3 1 7 3 1 3 1 2 1 2 1\n49 10",
"output": "60"
},
{
"input": "100\n75 62 31 96 62 76 93 96 72 67 88 35 67 34 60 56 95 86 82 48 64 61 74 100 56 98 76 98 78 55 53 10 12 78 58 45 86 90 93 77 69 73 88 66 92 88 33 50 95 69 89 12 93 57 93 89 59 53 71 86 15 13 61 93 24 100 58 76 46 95 76 82 50 20 79 38 5 72 99 81 55 90 90 65 85 44 63 39 6 34 98 72 88 30 59 73 84 61 25 67\n86 25",
"output": "2523"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n1 51",
"output": "5000"
},
{
"input": "4\n1 1 1 1\n2 4",
"output": "2"
},
{
"input": "4\n1 1 2 1\n2 4",
"output": "2"
}
] | 1,631,850,157 | 2,147,483,647 | Python 3 | OK | TESTS | 23 | 124 | 6,758,400 | n = int(input())
a = list(map(int, input().split()))
s, t = sorted(map(int, input().split()))
d = sum(a[s - 1 : t - 1])
print(min(d, sum(a) - d)) | Title: Circle Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The circle line of the Berland subway has *n* stations. We know the distances between all pairs of neighboring stations:
- *d*1 is the distance between the 1-st and the 2-nd station;- *d*2 is the distance between the 2-nd and the 3-rd station;...- *d**n*<=-<=1 is the distance between the *n*<=-<=1-th and the *n*-th station;- *d**n* is the distance between the *n*-th and the 1-st station.
The trains go along the circle line in both directions. Find the shortest distance between stations with numbers *s* and *t*.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — the number of stations on the circle line. The second line contains *n* integers *d*1,<=*d*2,<=...,<=*d**n* (1<=≤<=*d**i*<=≤<=100) — the distances between pairs of neighboring stations. The third line contains two integers *s* and *t* (1<=≤<=*s*,<=*t*<=≤<=*n*) — the numbers of stations, between which you need to find the shortest distance. These numbers can be the same.
The numbers in the lines are separated by single spaces.
Output Specification:
Print a single number — the length of the shortest path between stations number *s* and *t*.
Demo Input:
['4\n2 3 4 9\n1 3\n', '4\n5 8 2 100\n4 1\n', '3\n1 1 1\n3 1\n', '3\n31 41 59\n1 1\n']
Demo Output:
['5\n', '15\n', '1\n', '0\n']
Note:
In the first sample the length of path 1 → 2 → 3 equals 5, the length of path 1 → 4 → 3 equals 13.
In the second sample the length of path 4 → 1 is 100, the length of path 4 → 3 → 2 → 1 is 15.
In the third sample the length of path 3 → 1 is 1, the length of path 3 → 2 → 1 is 2.
In the fourth sample the numbers of stations are the same, so the shortest distance equals 0. | ```python
n = int(input())
a = list(map(int, input().split()))
s, t = sorted(map(int, input().split()))
d = sum(a[s - 1 : t - 1])
print(min(d, sum(a) - d))
``` | 3 |
|
235 | A | LCM Challenge | PROGRAMMING | 1,600 | [
"number theory"
] | null | null | Some days ago, I learned the concept of LCM (least common multiple). I've played with it for several times and I want to make a big number with it.
But I also don't want to use many numbers, so I'll choose three positive integers (they don't have to be distinct) which are not greater than *n*. Can you help me to find the maximum possible least common multiple of these three integers? | The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the *n* mentioned in the statement. | Print a single integer — the maximum possible LCM of three not necessarily distinct positive integers that are not greater than *n*. | [
"9\n",
"7\n"
] | [
"504\n",
"210\n"
] | The least common multiple of some positive integers is the least positive integer which is multiple for each of them.
The result may become very large, 32-bit integer won't be enough. So using 64-bit integers is recommended.
For the last example, we can chose numbers 7, 6, 5 and the LCM of them is 7·6·5 = 210. It is the maximum value we can get. | 500 | [
{
"input": "9",
"output": "504"
},
{
"input": "7",
"output": "210"
},
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "60"
},
{
"input": "6",
"output": "60"
},
{
"input": "33",
"output": "32736"
},
{
"input": "21",
"output": "7980"
},
{
"input": "2",
"output": "2"
},
{
"input": "41",
"output": "63960"
},
{
"input": "29",
"output": "21924"
},
{
"input": "117",
"output": "1560780"
},
{
"input": "149",
"output": "3241644"
},
{
"input": "733",
"output": "392222436"
},
{
"input": "925",
"output": "788888100"
},
{
"input": "509",
"output": "131096004"
},
{
"input": "829",
"output": "567662724"
},
{
"input": "117",
"output": "1560780"
},
{
"input": "605",
"output": "220348260"
},
{
"input": "245",
"output": "14526540"
},
{
"input": "925",
"output": "788888100"
},
{
"input": "213",
"output": "9527916"
},
{
"input": "53",
"output": "140556"
},
{
"input": "341",
"output": "39303660"
},
{
"input": "21",
"output": "7980"
},
{
"input": "605",
"output": "220348260"
},
{
"input": "149",
"output": "3241644"
},
{
"input": "733",
"output": "392222436"
},
{
"input": "117",
"output": "1560780"
},
{
"input": "53",
"output": "140556"
},
{
"input": "245",
"output": "14526540"
},
{
"input": "829",
"output": "567662724"
},
{
"input": "924",
"output": "783776526"
},
{
"input": "508",
"output": "130065780"
},
{
"input": "700",
"output": "341042100"
},
{
"input": "636",
"output": "254839470"
},
{
"input": "20",
"output": "6460"
},
{
"input": "604",
"output": "218891412"
},
{
"input": "796",
"output": "501826260"
},
{
"input": "732",
"output": "389016270"
},
{
"input": "412",
"output": "69256788"
},
{
"input": "700",
"output": "341042100"
},
{
"input": "244",
"output": "14289372"
},
{
"input": "828",
"output": "563559150"
},
{
"input": "508",
"output": "130065780"
},
{
"input": "796",
"output": "501826260"
},
{
"input": "636",
"output": "254839470"
},
{
"input": "924",
"output": "783776526"
},
{
"input": "245",
"output": "14526540"
},
{
"input": "828",
"output": "563559150"
},
{
"input": "21",
"output": "7980"
},
{
"input": "605",
"output": "220348260"
},
{
"input": "636",
"output": "254839470"
},
{
"input": "924",
"output": "783776526"
},
{
"input": "116",
"output": "1507420"
},
{
"input": "700",
"output": "341042100"
},
{
"input": "732",
"output": "389016270"
},
{
"input": "20",
"output": "6460"
},
{
"input": "508",
"output": "130065780"
},
{
"input": "148",
"output": "3154620"
},
{
"input": "828",
"output": "563559150"
},
{
"input": "763116",
"output": "444394078546562430"
},
{
"input": "756604",
"output": "433115377058855412"
},
{
"input": "447244",
"output": "89460162932862372"
},
{
"input": "372636",
"output": "51742503205363470"
},
{
"input": "546924",
"output": "163597318076822526"
},
{
"input": "540412",
"output": "157823524476316788"
},
{
"input": "714700",
"output": "365063922340784100"
},
{
"input": "520731",
"output": "141201007712496270"
},
{
"input": "695019",
"output": "335728459024850814"
},
{
"input": "688507",
"output": "326379736779169710"
},
{
"input": "862795",
"output": "642275489615199390"
},
{
"input": "668827",
"output": "299184742915995150"
},
{
"input": "810411",
"output": "532248411551110590"
},
{
"input": "836603",
"output": "585540171302562606"
},
{
"input": "978187",
"output": "935975171582120670"
},
{
"input": "816923",
"output": "545182335484592526"
},
{
"input": "958507",
"output": "880611813728059710"
},
{
"input": "984699",
"output": "954792870629291694"
},
{
"input": "642635",
"output": "265393998349453470"
},
{
"input": "296604",
"output": "26092892528622606"
},
{
"input": "1000000",
"output": "999996000003000000"
},
{
"input": "8",
"output": "280"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "12"
},
{
"input": "30",
"output": "21924"
},
{
"input": "18",
"output": "4080"
},
{
"input": "12",
"output": "990"
}
] | 1,588,430,829 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 216 | 0 | def lcm(n):
return n*(n-1)*(n-2)
print(lcm(int(input()))) | Title: LCM Challenge
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some days ago, I learned the concept of LCM (least common multiple). I've played with it for several times and I want to make a big number with it.
But I also don't want to use many numbers, so I'll choose three positive integers (they don't have to be distinct) which are not greater than *n*. Can you help me to find the maximum possible least common multiple of these three integers?
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the *n* mentioned in the statement.
Output Specification:
Print a single integer — the maximum possible LCM of three not necessarily distinct positive integers that are not greater than *n*.
Demo Input:
['9\n', '7\n']
Demo Output:
['504\n', '210\n']
Note:
The least common multiple of some positive integers is the least positive integer which is multiple for each of them.
The result may become very large, 32-bit integer won't be enough. So using 64-bit integers is recommended.
For the last example, we can chose numbers 7, 6, 5 and the LCM of them is 7·6·5 = 210. It is the maximum value we can get. | ```python
def lcm(n):
return n*(n-1)*(n-2)
print(lcm(int(input())))
``` | 0 |
|
989 | A | A Blend of Springtime | PROGRAMMING | 900 | [
"implementation",
"strings"
] | null | null | "What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone."
"But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic.
The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty.
When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible.
You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order. | The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively. | Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise.
You can print each letter in any case (upper or lower). | [
".BAC.\n",
"AA..CB\n"
] | [
"Yes\n",
"No\n"
] | In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it.
In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell. | 500 | [
{
"input": ".BAC.",
"output": "Yes"
},
{
"input": "AA..CB",
"output": "No"
},
{
"input": ".",
"output": "No"
},
{
"input": "ACB.AAAAAA",
"output": "Yes"
},
{
"input": "B.BC.BBBCA",
"output": "Yes"
},
{
"input": "BA..CAB..B",
"output": "Yes"
},
{
"input": "CACCBAA.BC",
"output": "Yes"
},
{
"input": ".CAACCBBA.CBB.AC..BABCCBCCB..B.BC..CBC.CA.CC.C.CC.B.A.CC.BBCCBB..ACAACAC.CBCCB.AABAAC.CBCC.BA..CCBC.",
"output": "Yes"
},
{
"input": "A",
"output": "No"
},
{
"input": "..",
"output": "No"
},
{
"input": "BC",
"output": "No"
},
{
"input": "CAB",
"output": "Yes"
},
{
"input": "A.CB",
"output": "No"
},
{
"input": "B.ACAA.CA..CBCBBAA.B.CCBCB.CAC.ABC...BC.BCCC.BC.CB",
"output": "Yes"
},
{
"input": "B.B...CC.B..CCCB.CB..CBCB..CBCC.CCBC.B.CB..CA.C.C.",
"output": "No"
},
{
"input": "AA.CBAABABCCC..B..B.ABBABAB.B.B.CCA..CB.B...A..CBC",
"output": "Yes"
},
{
"input": "CA.ABB.CC.B.C.BBBABAAB.BBBAACACAAA.C.AACA.AAC.C.BCCB.CCBC.C..CCACA.CBCCB.CCAABAAB.AACAA..A.AAA.",
"output": "No"
},
{
"input": "CBC...AC.BBBB.BBABABA.CAAACC.AAABB..A.BA..BC.CBBBC.BBBBCCCAA.ACCBB.AB.C.BA..CC..AAAC...AB.A.AAABBA.A",
"output": "No"
},
{
"input": "CC.AAAC.BA.BBB.AABABBCCAA.A.CBCCB.B.BC.ABCBCBBAA.CACA.CCCA.CB.CCB.A.BCCCB...C.A.BCCBC..B.ABABB.C.BCB",
"output": "Yes"
},
{
"input": "CCC..A..CACACCA.CA.ABAAB.BBA..C.AAA...ACB.ACA.CA.B.AB.A..C.BC.BC.A.C....ABBCCACCCBCC.BBBAA.ACCACB.BB",
"output": "Yes"
},
{
"input": "BC.ABACAACC..AC.A..CCCAABBCCACAC.AA.CC.BAABABABBCBB.BA..C.C.C.A.BBA.C..BC.ACACCC.AAAACCCCC.AAC.AC.AB",
"output": "Yes"
},
{
"input": "ACAC.BAA.C..CAAC..ABBAACC..BAA...CC...ACCBBCA.BAABABAACCAC.A.BBCACCC..BCB.BABAAAACCBCB.BCAABBC.C.BBB",
"output": "Yes"
},
{
"input": "CCAC.BCBC.A.ABBAB.C.C.BC.CCABBCBCCBC..B.AA.C.BC...B..BAA.ACCCCBBB.AAAACA.CAACCB.CCB.CC.BCCAB.BBBBABB",
"output": "Yes"
},
{
"input": ".AACAA.AAAAC.BBBB.BC...CCACCACAAA.A..CCA..BCC.AB.ABAAB..AABA...B.C.CBAB.BAAB.A.C.AAC.BBBA.ACAAA.BB.C",
"output": "Yes"
},
{
"input": "CC.ACCC.BCCCCAA.BBAACB.ABABAAAA.A.CBAB.CBACBBC..C.CA.AAA..AA..ABBB.A.C..CBBCAAACC.B..CC.AC..CAABACB.",
"output": "Yes"
},
{
"input": ".BAB.",
"output": "No"
},
{
"input": "BBBBBBBBB",
"output": "No"
},
{
"input": "..AAC..",
"output": "No"
},
{
"input": ".AAABBBCCC.",
"output": "No"
},
{
"input": "AAABC",
"output": "Yes"
},
{
"input": "BBB",
"output": "No"
},
{
"input": "AAAAABABAAAAA",
"output": "No"
},
{
"input": "AABBCC",
"output": "No"
},
{
"input": ".BA",
"output": "No"
},
{
"input": "CAAAAB",
"output": "No"
}
] | 1,545,098,148 | 648 | Python 3 | OK | TESTS | 37 | 109 | 0 | x = input()
if 'ABC' in x:
print('Yes')
elif 'ACB' in x:
print('Yes')
elif 'BAC' in x:
print('Yes')
elif 'BCA' in x:
print('Yes')
elif 'CAB' in x:
print('Yes')
elif 'CBA' in x:
print('Yes')
else:
print('No') | Title: A Blend of Springtime
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"What a pity it's already late spring," sighs Mino with regret, "one more drizzling night and they'd be gone."
"But these blends are at their best, aren't they?" Absorbed in the landscape, Kanno remains optimistic.
The landscape can be expressed as a row of consecutive cells, each of which either contains a flower of colour amber or buff or canary yellow, or is empty.
When a flower withers, it disappears from the cell that it originally belonged to, and it spreads petals of its colour in its two neighbouring cells (or outside the field if the cell is on the side of the landscape). In case petals fall outside the given cells, they simply become invisible.
You are to help Kanno determine whether it's possible that after some (possibly none or all) flowers shed their petals, at least one of the cells contains all three colours, considering both petals and flowers. Note that flowers can wither in arbitrary order.
Input Specification:
The first and only line of input contains a non-empty string $s$ consisting of uppercase English letters 'A', 'B', 'C' and characters '.' (dots) only ($\lvert s \rvert \leq 100$) — denoting cells containing an amber flower, a buff one, a canary yellow one, and no flowers, respectively.
Output Specification:
Output "Yes" if it's possible that all three colours appear in some cell, and "No" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['.BAC.\n', 'AA..CB\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first example, the buff and canary yellow flowers can leave their petals in the central cell, blending all three colours in it.
In the second example, it's impossible to satisfy the requirement because there is no way that amber and buff meet in any cell. | ```python
x = input()
if 'ABC' in x:
print('Yes')
elif 'ACB' in x:
print('Yes')
elif 'BAC' in x:
print('Yes')
elif 'BCA' in x:
print('Yes')
elif 'CAB' in x:
print('Yes')
elif 'CBA' in x:
print('Yes')
else:
print('No')
``` | 3 |
|
330 | A | Cakeminator | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat. | The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry. | Output the maximum number of cake cells that the cakeminator can eat. | [
"3 4\nS...\n....\n..S.\n"
] | [
"8\n"
] | For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | 500 | [
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,625,639,837 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 154 | 0 | n, m = [int(x) for x in input().split(' ')]
rows = []
cols = []
matrix = []
for i in range(n):
row = input()
matrix.append([False] * m)
if 'S' in row:
k, j = i, row.index('S')
rows.append(i)
cols.append(row.index('S'))
matrix[k][j] = True
cnt = 0
for i in range(n):
if i not in rows:
for j in range(m):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
for j in range(m):
if j not in cols:
for i in range(n):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
print(cnt) | Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | ```python
n, m = [int(x) for x in input().split(' ')]
rows = []
cols = []
matrix = []
for i in range(n):
row = input()
matrix.append([False] * m)
if 'S' in row:
k, j = i, row.index('S')
rows.append(i)
cols.append(row.index('S'))
matrix[k][j] = True
cnt = 0
for i in range(n):
if i not in rows:
for j in range(m):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
for j in range(m):
if j not in cols:
for i in range(n):
if not matrix[i][j]:
cnt += 1
matrix[i][j] = True
print(cnt)
``` | 0 |
|
887 | A | Div. 64 | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills.
Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system. | In the only line given a non-empty binary string *s* with length up to 100. | Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise. | [
"100010001\n",
"100\n"
] | [
"yes",
"no"
] | In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system.
You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system) | 500 | [
{
"input": "100010001",
"output": "yes"
},
{
"input": "100",
"output": "no"
},
{
"input": "0000001000000",
"output": "yes"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "no"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111111111",
"output": "no"
},
{
"input": "0111111101111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "no"
},
{
"input": "1111011111111111111111111111110111110111111111111111111111011111111111111110111111111111111111111111",
"output": "no"
},
{
"input": "1111111111101111111111111111111111111011111111111111111111111101111011111101111111111101111111111111",
"output": "yes"
},
{
"input": "0110111111111111111111011111111110110111110111111111111111111111111111111111111110111111111111111111",
"output": "yes"
},
{
"input": "1100110001111011001101101000001110111110011110111110010100011000100101000010010111100000010001001101",
"output": "yes"
},
{
"input": "000000",
"output": "no"
},
{
"input": "0001000",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "1000000",
"output": "yes"
},
{
"input": "0",
"output": "no"
},
{
"input": "1",
"output": "no"
},
{
"input": "10000000000",
"output": "yes"
},
{
"input": "0000000000",
"output": "no"
},
{
"input": "0010000",
"output": "no"
},
{
"input": "000000011",
"output": "no"
},
{
"input": "000000000",
"output": "no"
},
{
"input": "00000000",
"output": "no"
},
{
"input": "000000000011",
"output": "no"
},
{
"input": "0000000",
"output": "no"
},
{
"input": "00000000011",
"output": "no"
},
{
"input": "000000001",
"output": "no"
},
{
"input": "000000000000000000000000000",
"output": "no"
},
{
"input": "0000001",
"output": "no"
},
{
"input": "00000001",
"output": "no"
},
{
"input": "00000000100",
"output": "no"
},
{
"input": "00000000000000000000",
"output": "no"
},
{
"input": "0000000000000000000",
"output": "no"
},
{
"input": "00001000",
"output": "no"
},
{
"input": "0000000000010",
"output": "no"
},
{
"input": "000000000010",
"output": "no"
},
{
"input": "000000000000010",
"output": "no"
},
{
"input": "0100000",
"output": "no"
},
{
"input": "00010000",
"output": "no"
},
{
"input": "00000000000000000",
"output": "no"
},
{
"input": "00000000000",
"output": "no"
},
{
"input": "000001000",
"output": "no"
},
{
"input": "000000000000",
"output": "no"
},
{
"input": "100000000000000",
"output": "yes"
},
{
"input": "000010000",
"output": "no"
},
{
"input": "00000100",
"output": "no"
},
{
"input": "0001100000",
"output": "no"
},
{
"input": "000000000000000000000000001",
"output": "no"
},
{
"input": "000000100",
"output": "no"
},
{
"input": "0000000000001111111111",
"output": "no"
},
{
"input": "00000010",
"output": "no"
},
{
"input": "0001110000",
"output": "no"
},
{
"input": "0000000000000000000000",
"output": "no"
},
{
"input": "000000010010",
"output": "no"
},
{
"input": "0000100",
"output": "no"
},
{
"input": "0000000001",
"output": "no"
},
{
"input": "000000111",
"output": "no"
},
{
"input": "0000000000000",
"output": "no"
},
{
"input": "000000000000000000",
"output": "no"
},
{
"input": "0000000000000000000000000",
"output": "no"
},
{
"input": "000000000000000",
"output": "no"
},
{
"input": "0010000000000100",
"output": "yes"
},
{
"input": "0000001000",
"output": "no"
},
{
"input": "00000000000000000001",
"output": "no"
},
{
"input": "100000000",
"output": "yes"
},
{
"input": "000000000001",
"output": "no"
},
{
"input": "0000011001",
"output": "no"
},
{
"input": "000",
"output": "no"
},
{
"input": "000000000000000000000",
"output": "no"
},
{
"input": "0000000000011",
"output": "no"
},
{
"input": "0000000000000000",
"output": "no"
},
{
"input": "00000000000000001",
"output": "no"
},
{
"input": "00000000000000",
"output": "no"
},
{
"input": "0000000000000000010",
"output": "no"
},
{
"input": "00000000000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "000011000",
"output": "no"
},
{
"input": "00000011",
"output": "no"
},
{
"input": "0000000000001100",
"output": "no"
},
{
"input": "00000",
"output": "no"
},
{
"input": "000000000000000000000000000111111111111111",
"output": "no"
},
{
"input": "000000010",
"output": "no"
},
{
"input": "00000000111",
"output": "no"
},
{
"input": "000000000000001",
"output": "no"
},
{
"input": "0000000000000011111111111111111",
"output": "no"
},
{
"input": "0000000010",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "00000000010",
"output": "no"
},
{
"input": "101000000000",
"output": "yes"
},
{
"input": "00100000",
"output": "no"
},
{
"input": "00000000000001",
"output": "no"
},
{
"input": "0000000000100",
"output": "no"
},
{
"input": "0000",
"output": "no"
},
{
"input": "00000000000111",
"output": "no"
},
{
"input": "0000000000000011",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "0000000000000010",
"output": "no"
},
{
"input": "0010101010",
"output": "no"
},
{
"input": "0000000000000001",
"output": "no"
},
{
"input": "1010101",
"output": "no"
}
] | 1,513,475,377 | 2,147,483,647 | Python 3 | OK | TESTS | 98 | 77 | 5,529,600 |
a = input()
sz = len(a)
flg = 0
cnt = 0
for i in range (0,sz):
k = a[i]
if(int(k)==1) :
flg = 1
continue
if(flg==1 and int(k)==0) :
cnt+=1
if(cnt>=6) :
print("yes")
else :
print("no")
| Title: Div. 64
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills.
Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system.
Input Specification:
In the only line given a non-empty binary string *s* with length up to 100.
Output Specification:
Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise.
Demo Input:
['100010001\n', '100\n']
Demo Output:
['yes', 'no']
Note:
In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system.
You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system) | ```python
a = input()
sz = len(a)
flg = 0
cnt = 0
for i in range (0,sz):
k = a[i]
if(int(k)==1) :
flg = 1
continue
if(flg==1 and int(k)==0) :
cnt+=1
if(cnt>=6) :
print("yes")
else :
print("no")
``` | 3 |
|
617 | A | Elephant | PROGRAMMING | 800 | [
"math"
] | null | null | An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house. | The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house. | Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*. | [
"5\n",
"12\n"
] | [
"1\n",
"3\n"
] | In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves. | 500 | [
{
"input": "5",
"output": "1"
},
{
"input": "12",
"output": "3"
},
{
"input": "999999",
"output": "200000"
},
{
"input": "41",
"output": "9"
},
{
"input": "1000000",
"output": "200000"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "534204",
"output": "106841"
},
{
"input": "469569",
"output": "93914"
},
{
"input": "502877",
"output": "100576"
},
{
"input": "942212",
"output": "188443"
},
{
"input": "97",
"output": "20"
},
{
"input": "53",
"output": "11"
},
{
"input": "89",
"output": "18"
},
{
"input": "574",
"output": "115"
},
{
"input": "716",
"output": "144"
},
{
"input": "729",
"output": "146"
},
{
"input": "8901",
"output": "1781"
},
{
"input": "3645",
"output": "729"
},
{
"input": "4426",
"output": "886"
},
{
"input": "46573",
"output": "9315"
},
{
"input": "86380",
"output": "17276"
},
{
"input": "94190",
"output": "18838"
},
{
"input": "999990",
"output": "199998"
},
{
"input": "999991",
"output": "199999"
},
{
"input": "999992",
"output": "199999"
},
{
"input": "999993",
"output": "199999"
},
{
"input": "999994",
"output": "199999"
},
{
"input": "999995",
"output": "199999"
},
{
"input": "999996",
"output": "200000"
},
{
"input": "999997",
"output": "200000"
},
{
"input": "999998",
"output": "200000"
}
] | 1,696,869,527 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 4 | 46 | 0 | a = int(input())
count = 0
if a <= 5:
count += 1
print(count)
elif a > 5:
count2 = (a/5) + 1
print(int(count2)) | Title: Elephant
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
Input Specification:
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
Output Specification:
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
Demo Input:
['5\n', '12\n']
Demo Output:
['1\n', '3\n']
Note:
In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves. | ```python
a = int(input())
count = 0
if a <= 5:
count += 1
print(count)
elif a > 5:
count2 = (a/5) + 1
print(int(count2))
``` | 0 |
|
851 | B | Arpa and an exam about geometry | PROGRAMMING | 1,400 | [
"geometry",
"math"
] | null | null | Arpa is taking a geometry exam. Here is the last problem of the exam.
You are given three points *a*,<=*b*,<=*c*.
Find a point and an angle such that if we rotate the page around the point by the angle, the new position of *a* is the same as the old position of *b*, and the new position of *b* is the same as the old position of *c*.
Arpa is doubting if the problem has a solution or not (i.e. if there exists a point and an angle satisfying the condition). Help Arpa determine if the question has a solution or not. | The only line contains six integers *a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*c**x*,<=*c**y* (|*a**x*|,<=|*a**y*|,<=|*b**x*|,<=|*b**y*|,<=|*c**x*|,<=|*c**y*|<=≤<=109). It's guaranteed that the points are distinct. | Print "Yes" if the problem has a solution, "No" otherwise.
You can print each letter in any case (upper or lower). | [
"0 1 1 1 1 0\n",
"1 1 0 0 1000 1000\n"
] | [
"Yes\n",
"No\n"
] | In the first sample test, rotate the page around (0.5, 0.5) by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9d845923f4d356a48d8ede337db0303821311f0c.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test, you can't find any solution. | 1,000 | [
{
"input": "0 1 1 1 1 0",
"output": "Yes"
},
{
"input": "1 1 0 0 1000 1000",
"output": "No"
},
{
"input": "1 0 2 0 3 0",
"output": "No"
},
{
"input": "3 4 0 0 4 3",
"output": "Yes"
},
{
"input": "-1000000000 1 0 0 1000000000 1",
"output": "Yes"
},
{
"input": "49152 0 0 0 0 81920",
"output": "No"
},
{
"input": "1 -1 4 4 2 -3",
"output": "No"
},
{
"input": "-2 -2 1 4 -2 0",
"output": "No"
},
{
"input": "5 0 4 -2 0 1",
"output": "No"
},
{
"input": "-4 -3 2 -1 -3 4",
"output": "No"
},
{
"input": "-3 -3 5 2 3 -1",
"output": "No"
},
{
"input": "-1000000000 -1000000000 0 0 1000000000 999999999",
"output": "No"
},
{
"input": "-1000000000 -1000000000 0 0 1000000000 1000000000",
"output": "No"
},
{
"input": "-357531221 381512519 -761132895 -224448284 328888775 -237692564",
"output": "No"
},
{
"input": "264193194 -448876521 736684426 -633906160 -328597212 -47935734",
"output": "No"
},
{
"input": "419578772 -125025887 169314071 89851312 961404059 21419450",
"output": "No"
},
{
"input": "-607353321 -620687860 248029390 477864359 728255275 -264646027",
"output": "No"
},
{
"input": "299948862 -648908808 338174789 841279400 -850322448 350263551",
"output": "No"
},
{
"input": "48517753 416240699 7672672 272460100 -917845051 199790781",
"output": "No"
},
{
"input": "-947393823 -495674431 211535284 -877153626 -522763219 -778236665",
"output": "No"
},
{
"input": "-685673792 -488079395 909733355 385950193 -705890324 256550506",
"output": "No"
},
{
"input": "-326038504 547872194 49630307 713863100 303770000 -556852524",
"output": "No"
},
{
"input": "-706921242 -758563024 -588592101 -443440080 858751713 238854303",
"output": "No"
},
{
"input": "-1000000000 -1000000000 0 1000000000 1000000000 -1000000000",
"output": "Yes"
},
{
"input": "1000000000 1000000000 0 -1000000000 -1000000000 1000000000",
"output": "Yes"
},
{
"input": "-999999999 -1000000000 0 0 1000000000 999999999",
"output": "Yes"
},
{
"input": "-1000000000 -999999999 0 0 1000000000 999999999",
"output": "No"
},
{
"input": "-1 -1000000000 0 1000000000 1 -1000000000",
"output": "Yes"
},
{
"input": "0 1000000000 1 0 0 -1000000000",
"output": "Yes"
},
{
"input": "0 1000000000 0 0 0 -1000000000",
"output": "No"
},
{
"input": "0 1 1 2 2 3",
"output": "No"
},
{
"input": "999999999 1000000000 0 0 -1000000000 -999999999",
"output": "Yes"
},
{
"input": "0 0 1 1 2 0",
"output": "Yes"
},
{
"input": "0 0 1 1 2 2",
"output": "No"
},
{
"input": "1 1 2 2 3 3",
"output": "No"
},
{
"input": "0 2 0 3 0 4",
"output": "No"
},
{
"input": "1 1 1 2 1 3",
"output": "No"
},
{
"input": "0 0 3 4 3 9",
"output": "Yes"
},
{
"input": "589824 196608 262144 196608 0 0",
"output": "Yes"
},
{
"input": "0 0 1000000000 1 1000000000 -999999999",
"output": "No"
},
{
"input": "0 0 2 45 0 90",
"output": "Yes"
},
{
"input": "0 0 0 2 0 1",
"output": "No"
},
{
"input": "0 2 4 5 4 0",
"output": "Yes"
},
{
"input": "0 0 2 0 4 0",
"output": "No"
},
{
"input": "1 1 3 3 5 5",
"output": "No"
},
{
"input": "1 1 2 2 3 1",
"output": "Yes"
}
] | 1,572,035,172 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 108 | 0 | x1,y1,x2,y2,x3,y3 = map(int,input().split());
a = [x1,y1];
b = [x2,y2];
c = [x3,y3];
res = False;
alinhado = False;
if a[0]==b[0] and b[0]==c[0] or a[1]==b[1] and b[1]==c[1]:
alinhado = True;
dAB = (a[0]-b[0])**2 + (a[1]-b[1])**2
dAC = (a[0]-c[0])**2 + (a[1]-c[1])**2
dBC = (c[0]-b[0])**2 + (c[1]-b[1])**2
if(dAB==dBC and dAC==dAB+dBC or dAC==dBC and dAB==dAC+dBC or dAC==dAB and dBC==dAC+dAB):
res = True;
if(res and not alinhado):
print("Yes")
else:
print("No") | Title: Arpa and an exam about geometry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arpa is taking a geometry exam. Here is the last problem of the exam.
You are given three points *a*,<=*b*,<=*c*.
Find a point and an angle such that if we rotate the page around the point by the angle, the new position of *a* is the same as the old position of *b*, and the new position of *b* is the same as the old position of *c*.
Arpa is doubting if the problem has a solution or not (i.e. if there exists a point and an angle satisfying the condition). Help Arpa determine if the question has a solution or not.
Input Specification:
The only line contains six integers *a**x*,<=*a**y*,<=*b**x*,<=*b**y*,<=*c**x*,<=*c**y* (|*a**x*|,<=|*a**y*|,<=|*b**x*|,<=|*b**y*|,<=|*c**x*|,<=|*c**y*|<=≤<=109). It's guaranteed that the points are distinct.
Output Specification:
Print "Yes" if the problem has a solution, "No" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['0 1 1 1 1 0\n', '1 1 0 0 1000 1000\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first sample test, rotate the page around (0.5, 0.5) by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9d845923f4d356a48d8ede337db0303821311f0c.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test, you can't find any solution. | ```python
x1,y1,x2,y2,x3,y3 = map(int,input().split());
a = [x1,y1];
b = [x2,y2];
c = [x3,y3];
res = False;
alinhado = False;
if a[0]==b[0] and b[0]==c[0] or a[1]==b[1] and b[1]==c[1]:
alinhado = True;
dAB = (a[0]-b[0])**2 + (a[1]-b[1])**2
dAC = (a[0]-c[0])**2 + (a[1]-c[1])**2
dBC = (c[0]-b[0])**2 + (c[1]-b[1])**2
if(dAB==dBC and dAC==dAB+dBC or dAC==dBC and dAB==dAC+dBC or dAC==dAB and dBC==dAC+dAB):
res = True;
if(res and not alinhado):
print("Yes")
else:
print("No")
``` | 0 |
|
801 | B | Valued Keys | PROGRAMMING | 900 | [
"constructive algorithms",
"greedy",
"strings"
] | null | null | You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists. | The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100. | If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters. | [
"ab\naa\n",
"nzwzl\nniwel\n",
"ab\nba\n"
] | [
"ba\n",
"xiyez\n",
"-1\n"
] | The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba". | 1,000 | [
{
"input": "ab\naa",
"output": "ba"
},
{
"input": "nzwzl\nniwel",
"output": "xiyez"
},
{
"input": "ab\nba",
"output": "-1"
},
{
"input": "r\nl",
"output": "l"
},
{
"input": "d\ny",
"output": "-1"
},
{
"input": "yvowz\ncajav",
"output": "cajav"
},
{
"input": "lwzjp\ninjit",
"output": "-1"
},
{
"input": "epqnlxmiicdidyscjaxqznwur\neodnlemiicdedmkcgavqbnqmm",
"output": "eodnlemiicdedmkcgavqbnqmm"
},
{
"input": "qqdabbsxiibnnjgsgxllfvdqj\nuxmypqtwfdezewdxfgplannrs",
"output": "-1"
},
{
"input": "aanerbaqslfmqmuciqbxyznkevukvznpkmxlcorpmrenwxhzfgbmlfpxtkqpxdrmcqcmbf\naanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf",
"output": "aanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf"
},
{
"input": "mbyrkhjctrcrayisflptgfudwgrtegidhqicsjqafvdloritbjhciyxuwavxknezwwudnk\nvvixsutlbdewqoabqhpuerfkzrddcqptfwmxdlxwbvsaqfjoxztlddvwgflcteqbwaiaen",
"output": "-1"
},
{
"input": "eufycwztywhbjrpqobvknwfqmnboqcfdiahkagykeibbsqpljcghhmsgfmswwsanzyiwtvuirwmppfivtekaywkzskyydfvkjgxb\necfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb",
"output": "ecfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb"
},
{
"input": "qvpltcffyeghtbdhjyhfteojezyzziardduzrbwuxmzzkkoehfnxecafizxglboauhynfbawlfxenmykquyhrxswhjuovvogntok\nchvkcvzxptbcepdjfezcpuvtehewbnvqeoezlcnzhpfwujbmhafoeqmjhtwisnobauinkzyigrvahpuetkgpdjfgbzficsmuqnym",
"output": "-1"
},
{
"input": "nmuwjdihouqrnsuahimssnrbxdpwvxiyqtenahtrlshjkmnfuttnpqhgcagoptinnaptxaccptparldzrhpgbyrzedghudtsswxi\nnilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib",
"output": "nilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib"
},
{
"input": "dyxgwupoauwqtcfoyfjdotzirwztdfrueqiypxoqvkmhiehdppwtdoxrbfvtairdbuvlqohjflznggjpifhwjrshcrfbjtklpykx\ngzqlnoizhxolnditjdhlhptjsbczehicudoybzilwnshmywozwnwuipcgirgzldtvtowdsokfeafggwserzdazkxyddjttiopeew",
"output": "-1"
},
{
"input": "hbgwuqzougqzlxemvyjpeizjfwhgugrfnhbrlxkmkdalikfyunppwgdzmalbwewybnjzqsohwhjkdcyhhzmysflambvhpsjilsyv\nfbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv",
"output": "fbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv"
},
{
"input": "xnjjhjfuhgyxqhpzmvgbaohqarugdoaczcfecofltwemieyxolswkcwhlfagfrgmoiqrgftokbqwtxgxzweozzlikrvafiabivlk\npjfosalbsitcnqiazhmepfifjxvmazvdgffcnozmnqubhonwjldmpdsjagmamniylzjdbklcyrzivjyzgnogahobpkwpwpvraqns",
"output": "-1"
},
{
"input": "zrvzedssbsrfldqvjpgmsefrmsatspzoitwvymahiptphiystjlsauzquzqqbmljobdhijcpdvatorwmyojqgnezvzlgjibxepcf\npesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf",
"output": "pesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf"
},
{
"input": "pdvkuwyzntzfqpblzmbynknyhlnqbxijuqaincviugxohcsrofozrrsategwkbwxcvkyzxhurokefpbdnmcfogfhsojayysqbrow\nbvxruombdrywlcjkrltyayaazwpauuhbtgwfzdrmfwwucgffucwelzvpsdgtapogchblzahsrfymjlaghkbmbssghrpxalkslcvp",
"output": "-1"
},
{
"input": "tgharsjyihroiiahwgbjezlxvlterxivdhtzjcqegzmtigqmrehvhiyjeywegxaseoyoacouijudbiruoghgxvxadwzgdxtnxlds\ntghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp",
"output": "tghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp"
},
{
"input": "jsinejpfwhzloulxndzvzftgogfdagrsscxmatldssqsgaknnbkcvhptebjjpkjhrjegrotzwcdosezkedzxeoyibmyzunkguoqj\nkfmvybobocdpipiripysioruqvloopvbggpjksgmwzyqwyxnesmvhsawnbbmntulspvsysfkjqwpvoelliopbaukyagedextzoej",
"output": "-1"
},
{
"input": "nttdcfceptruiomtmwzestrfchnqpgqeztpcvthzelfyggjgqadylzubpvbrlgndrcsursczpxlnoyoadxezncqalupfzmjeqihe\nkttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe",
"output": "kttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe"
},
{
"input": "diuopwglduasnaxgduwslbzoyayoypzznqspljcyqehweydhlwifcvnjmaowuvyqfwynjghecqvxdvuquuwpvwrjljozocaxnktv\ntrdydprdzmjhgbhzytelrfjpgsebijicsigmwhynmcyjtqrvojcndodchzxfcvyqjxqzwibccdvsjqhsnectdjyrrhzkeamukang",
"output": "-1"
},
{
"input": "ftfr\nftfr",
"output": "ftfr"
},
{
"input": "ftr\nftr",
"output": "ftr"
},
{
"input": "shftr\nshftr",
"output": "shftr"
},
{
"input": "vkvkkv\nvkvkkv",
"output": "vkvkkv"
},
{
"input": "ftrd\nftrd",
"output": "ftrd"
},
{
"input": "fztr\nfztr",
"output": "fztr"
},
{
"input": "frtr\nfrtr",
"output": "frtr"
},
{
"input": "shdftr\nshdftr",
"output": "shdftr"
},
{
"input": "zzz\nzzz",
"output": "zzz"
},
{
"input": "shtr\nshtr",
"output": "shtr"
},
{
"input": "aaaaa\nzzzzz",
"output": "-1"
},
{
"input": "efr\nefr",
"output": "efr"
}
] | 1,660,142,869 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 46 | 0 | a=input()
b=input()
for i in range(len(a)):
if(ord(a[i]) <ord(b[i])):
print('-1')
break
else:
print(b)
| Title: Valued Keys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
Input Specification:
The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
Output Specification:
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
Demo Input:
['ab\naa\n', 'nzwzl\nniwel\n', 'ab\nba\n']
Demo Output:
['ba\n', 'xiyez\n', '-1\n']
Note:
The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba". | ```python
a=input()
b=input()
for i in range(len(a)):
if(ord(a[i]) <ord(b[i])):
print('-1')
break
else:
print(b)
``` | 3 |
|
859 | B | Lazy Security Guard | PROGRAMMING | 1,000 | [
"brute force",
"geometry",
"math"
] | null | null | Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite. | Input will consist of a single integer *N* (1<=≤<=*N*<=≤<=106), the number of city blocks that must be enclosed by the route. | Print the minimum perimeter that can be achieved. | [
"4\n",
"11\n",
"22\n"
] | [
"8\n",
"14\n",
"20\n"
] | Here are some possible shapes for the examples:
<img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 750 | [
{
"input": "4",
"output": "8"
},
{
"input": "11",
"output": "14"
},
{
"input": "22",
"output": "20"
},
{
"input": "3",
"output": "8"
},
{
"input": "1024",
"output": "128"
},
{
"input": "101",
"output": "42"
},
{
"input": "30",
"output": "22"
},
{
"input": "1000000",
"output": "4000"
},
{
"input": "1",
"output": "4"
},
{
"input": "2",
"output": "6"
},
{
"input": "5",
"output": "10"
},
{
"input": "6",
"output": "10"
},
{
"input": "7",
"output": "12"
},
{
"input": "8",
"output": "12"
},
{
"input": "9",
"output": "12"
},
{
"input": "10",
"output": "14"
},
{
"input": "999000",
"output": "3998"
},
{
"input": "999001",
"output": "4000"
},
{
"input": "999999",
"output": "4000"
},
{
"input": "933206",
"output": "3866"
},
{
"input": "718351",
"output": "3392"
},
{
"input": "607443",
"output": "3118"
},
{
"input": "347887",
"output": "2360"
},
{
"input": "246206",
"output": "1986"
},
{
"input": "151375",
"output": "1558"
},
{
"input": "12639",
"output": "450"
},
{
"input": "3751",
"output": "246"
},
{
"input": "3607",
"output": "242"
},
{
"input": "124",
"output": "46"
},
{
"input": "64",
"output": "32"
},
{
"input": "31",
"output": "24"
},
{
"input": "23",
"output": "20"
},
{
"input": "15",
"output": "16"
},
{
"input": "19",
"output": "18"
},
{
"input": "59637",
"output": "978"
}
] | 1,516,134,013 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 62 | 5,632,000 | from math import sqrt
n = int(input())
side_of_s = int(sqrt(n))
are_of_s = side_of_s * side_of_s
rest = n - are_of_s
output = side_of_s * 4
if rest > 0:
output += 2
rest -= side_of_s
if rest > 0:
output += 2
print(output)
| Title: Lazy Security Guard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite.
Input Specification:
Input will consist of a single integer *N* (1<=≤<=*N*<=≤<=106), the number of city blocks that must be enclosed by the route.
Output Specification:
Print the minimum perimeter that can be achieved.
Demo Input:
['4\n', '11\n', '22\n']
Demo Output:
['8\n', '14\n', '20\n']
Note:
Here are some possible shapes for the examples:
<img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
from math import sqrt
n = int(input())
side_of_s = int(sqrt(n))
are_of_s = side_of_s * side_of_s
rest = n - are_of_s
output = side_of_s * 4
if rest > 0:
output += 2
rest -= side_of_s
if rest > 0:
output += 2
print(output)
``` | 3 |
|
514 | A | Chewbaсca and Number | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | null | null | Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero. | The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca. | Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes. | [
"27\n",
"4545\n"
] | [
"22\n",
"4444\n"
] | none | 500 | [
{
"input": "27",
"output": "22"
},
{
"input": "4545",
"output": "4444"
},
{
"input": "1",
"output": "1"
},
{
"input": "9",
"output": "9"
},
{
"input": "8772",
"output": "1222"
},
{
"input": "81",
"output": "11"
},
{
"input": "71723447",
"output": "21223442"
},
{
"input": "91730629",
"output": "91230320"
},
{
"input": "420062703497",
"output": "420032203402"
},
{
"input": "332711047202",
"output": "332211042202"
},
{
"input": "3395184971407775",
"output": "3304114021402224"
},
{
"input": "8464062628894325",
"output": "1434032321104324"
},
{
"input": "164324828731963982",
"output": "134324121231033012"
},
{
"input": "384979173822804784",
"output": "314020123122104214"
},
{
"input": "41312150450968417",
"output": "41312140440031412"
},
{
"input": "2156",
"output": "2143"
},
{
"input": "1932",
"output": "1032"
},
{
"input": "5902",
"output": "4002"
},
{
"input": "5728",
"output": "4221"
},
{
"input": "8537",
"output": "1432"
},
{
"input": "55403857",
"output": "44403142"
},
{
"input": "270739",
"output": "220230"
},
{
"input": "28746918",
"output": "21243011"
},
{
"input": "10279211",
"output": "10220211"
},
{
"input": "40289679",
"output": "40210320"
},
{
"input": "545203238506",
"output": "444203231403"
},
{
"input": "461117063340",
"output": "431112033340"
},
{
"input": "658492686568",
"output": "341402313431"
},
{
"input": "857373361868",
"output": "142323331131"
},
{
"input": "429325660016",
"output": "420324330013"
},
{
"input": "9894448650287940",
"output": "9104441340212040"
},
{
"input": "6354510839296263",
"output": "3344410130203233"
},
{
"input": "6873575462224593",
"output": "3123424432224403"
},
{
"input": "4237951492601449",
"output": "4232041402301440"
},
{
"input": "2680352384836991",
"output": "2310342314133001"
},
{
"input": "606187734191890310",
"output": "303112234101100310"
},
{
"input": "351499943576823355",
"output": "341400043423123344"
},
{
"input": "180593481782177068",
"output": "110403411212122031"
},
{
"input": "999999999999999999",
"output": "900000000000000000"
},
{
"input": "1000000000000000000",
"output": "1000000000000000000"
},
{
"input": "9999",
"output": "9000"
},
{
"input": "99",
"output": "90"
},
{
"input": "9991",
"output": "9001"
}
] | 1,689,253,722 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 93 | 0 | s = input()
x=list()
x1=list()
for i in range(len(s)):
x.append(int(s[i]))
for i in x:
if i>4:
x1.append(9-i)
else:
x1.append(i)
x1 = list(map(str, x1))
print("".join(x1)) | Title: Chewbaсca and Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
Output Specification:
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
Demo Input:
['27\n', '4545\n']
Demo Output:
['22\n', '4444\n']
Note:
none | ```python
s = input()
x=list()
x1=list()
for i in range(len(s)):
x.append(int(s[i]))
for i in x:
if i>4:
x1.append(9-i)
else:
x1.append(i)
x1 = list(map(str, x1))
print("".join(x1))
``` | 0 |
|
610 | A | Pasha and Stick | PROGRAMMING | 1,000 | [
"combinatorics",
"math"
] | null | null | Pasha has a wooden stick of some positive integer length *n*. He wants to perform exactly three cuts to get four parts of the stick. Each part must have some positive integer length and the sum of these lengths will obviously be *n*.
Pasha likes rectangles but hates squares, so he wonders, how many ways are there to split a stick into four parts so that it's possible to form a rectangle using these parts, but is impossible to form a square.
Your task is to help Pasha and count the number of such ways. Two ways to cut the stick are considered distinct if there exists some integer *x*, such that the number of parts of length *x* in the first way differ from the number of parts of length *x* in the second way. | The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=2·109) — the length of Pasha's stick. | The output should contain a single integer — the number of ways to split Pasha's stick into four parts of positive integer length so that it's possible to make a rectangle by connecting the ends of these parts, but is impossible to form a square. | [
"6\n",
"20\n"
] | [
"1\n",
"4\n"
] | There is only one way to divide the stick in the first sample {1, 1, 2, 2}.
Four ways to divide the stick in the second sample are {1, 1, 9, 9}, {2, 2, 8, 8}, {3, 3, 7, 7} and {4, 4, 6, 6}. Note that {5, 5, 5, 5} doesn't work. | 500 | [
{
"input": "6",
"output": "1"
},
{
"input": "20",
"output": "4"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "2000000000",
"output": "499999999"
},
{
"input": "1924704072",
"output": "481176017"
},
{
"input": "73740586",
"output": "18435146"
},
{
"input": "1925088820",
"output": "481272204"
},
{
"input": "593070992",
"output": "148267747"
},
{
"input": "1925473570",
"output": "481368392"
},
{
"input": "629490186",
"output": "157372546"
},
{
"input": "1980649112",
"output": "495162277"
},
{
"input": "36661322",
"output": "9165330"
},
{
"input": "1943590793",
"output": "0"
},
{
"input": "71207034",
"output": "17801758"
},
{
"input": "1757577394",
"output": "439394348"
},
{
"input": "168305294",
"output": "42076323"
},
{
"input": "1934896224",
"output": "483724055"
},
{
"input": "297149088",
"output": "74287271"
},
{
"input": "1898001634",
"output": "474500408"
},
{
"input": "176409698",
"output": "44102424"
},
{
"input": "1873025522",
"output": "468256380"
},
{
"input": "5714762",
"output": "1428690"
},
{
"input": "1829551192",
"output": "457387797"
},
{
"input": "16269438",
"output": "4067359"
},
{
"input": "1663283390",
"output": "415820847"
},
{
"input": "42549941",
"output": "0"
},
{
"input": "1967345604",
"output": "491836400"
},
{
"input": "854000",
"output": "213499"
},
{
"input": "1995886626",
"output": "498971656"
},
{
"input": "10330019",
"output": "0"
},
{
"input": "1996193634",
"output": "499048408"
},
{
"input": "9605180",
"output": "2401294"
},
{
"input": "1996459740",
"output": "499114934"
},
{
"input": "32691948",
"output": "8172986"
},
{
"input": "1975903308",
"output": "493975826"
},
{
"input": "1976637136",
"output": "494159283"
},
{
"input": "29803038",
"output": "7450759"
},
{
"input": "1977979692",
"output": "494494922"
},
{
"input": "1978595336",
"output": "494648833"
},
{
"input": "27379344",
"output": "6844835"
},
{
"input": "1979729912",
"output": "494932477"
},
{
"input": "1980253780",
"output": "495063444"
},
{
"input": "1980751584",
"output": "495187895"
},
{
"input": "53224878",
"output": "13306219"
},
{
"input": "5",
"output": "0"
},
{
"input": "7",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "0"
},
{
"input": "10",
"output": "2"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "2"
},
{
"input": "13",
"output": "0"
},
{
"input": "14",
"output": "3"
},
{
"input": "15",
"output": "0"
},
{
"input": "16",
"output": "3"
},
{
"input": "17",
"output": "0"
},
{
"input": "18",
"output": "4"
},
{
"input": "19",
"output": "0"
},
{
"input": "21",
"output": "0"
},
{
"input": "22",
"output": "5"
},
{
"input": "23",
"output": "0"
},
{
"input": "24",
"output": "5"
},
{
"input": "25",
"output": "0"
},
{
"input": "26",
"output": "6"
},
{
"input": "27",
"output": "0"
},
{
"input": "28",
"output": "6"
},
{
"input": "29",
"output": "0"
},
{
"input": "30",
"output": "7"
},
{
"input": "111",
"output": "0"
},
{
"input": "55",
"output": "0"
},
{
"input": "105",
"output": "0"
},
{
"input": "199",
"output": "0"
},
{
"input": "151",
"output": "0"
}
] | 1,609,605,891 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 124 | 0 | n = int(input())
if n % 2 == 1 or n < 6:
print(-1)
else:
if (n // 2) % 2 == 0:
print((n // 4) - 1)
else:
print(n // 4) | Title: Pasha and Stick
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has a wooden stick of some positive integer length *n*. He wants to perform exactly three cuts to get four parts of the stick. Each part must have some positive integer length and the sum of these lengths will obviously be *n*.
Pasha likes rectangles but hates squares, so he wonders, how many ways are there to split a stick into four parts so that it's possible to form a rectangle using these parts, but is impossible to form a square.
Your task is to help Pasha and count the number of such ways. Two ways to cut the stick are considered distinct if there exists some integer *x*, such that the number of parts of length *x* in the first way differ from the number of parts of length *x* in the second way.
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=2·109) — the length of Pasha's stick.
Output Specification:
The output should contain a single integer — the number of ways to split Pasha's stick into four parts of positive integer length so that it's possible to make a rectangle by connecting the ends of these parts, but is impossible to form a square.
Demo Input:
['6\n', '20\n']
Demo Output:
['1\n', '4\n']
Note:
There is only one way to divide the stick in the first sample {1, 1, 2, 2}.
Four ways to divide the stick in the second sample are {1, 1, 9, 9}, {2, 2, 8, 8}, {3, 3, 7, 7} and {4, 4, 6, 6}. Note that {5, 5, 5, 5} doesn't work. | ```python
n = int(input())
if n % 2 == 1 or n < 6:
print(-1)
else:
if (n // 2) % 2 == 0:
print((n // 4) - 1)
else:
print(n // 4)
``` | 0 |
|
750 | A | New Year and Hurry | PROGRAMMING | 800 | [
"binary search",
"brute force",
"implementation",
"math"
] | null | null | Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party? | The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house. | Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier. | [
"3 222\n",
"4 190\n",
"7 1\n"
] | [
"2\n",
"4\n",
"7\n"
] | In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems. | 500 | [
{
"input": "3 222",
"output": "2"
},
{
"input": "4 190",
"output": "4"
},
{
"input": "7 1",
"output": "7"
},
{
"input": "10 135",
"output": "6"
},
{
"input": "10 136",
"output": "5"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "9 240",
"output": "0"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "9 235",
"output": "1"
},
{
"input": "9 236",
"output": "0"
},
{
"input": "5 225",
"output": "2"
},
{
"input": "5 226",
"output": "1"
},
{
"input": "4 210",
"output": "3"
},
{
"input": "4 211",
"output": "2"
},
{
"input": "4 191",
"output": "3"
},
{
"input": "10 165",
"output": "5"
},
{
"input": "10 166",
"output": "4"
},
{
"input": "8 100",
"output": "7"
},
{
"input": "8 101",
"output": "6"
},
{
"input": "8 60",
"output": "8"
},
{
"input": "8 61",
"output": "7"
},
{
"input": "10 15",
"output": "9"
},
{
"input": "10 16",
"output": "8"
},
{
"input": "4 100",
"output": "4"
},
{
"input": "4 101",
"output": "4"
},
{
"input": "7 167",
"output": "4"
},
{
"input": "10 164",
"output": "5"
},
{
"input": "9 170",
"output": "4"
},
{
"input": "8 160",
"output": "5"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "8 123",
"output": "6"
},
{
"input": "2 99",
"output": "2"
},
{
"input": "10 88",
"output": "7"
},
{
"input": "1 235",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 240",
"output": "0"
},
{
"input": "1 55",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "3 240",
"output": "0"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "2 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "2 236",
"output": "0"
},
{
"input": "10 2",
"output": "9"
},
{
"input": "3 239",
"output": "0"
},
{
"input": "1 237",
"output": "0"
},
{
"input": "7 8",
"output": "7"
},
{
"input": "10 235",
"output": "1"
}
] | 1,694,717,958 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 77 | 0 | a, b = map(int, input().split())
g = 0
s = 1
time = 240 - b
while time > 0 or g != a:
if time - 5 * g >= 0:
s += 1
g += 1
time = time - 5 * g
else:
time = time - 5 * g
break
print(g)
| Title: New Year and Hurry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
Input Specification:
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Output Specification:
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
Demo Input:
['3 222\n', '4 190\n', '7 1\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems. | ```python
a, b = map(int, input().split())
g = 0
s = 1
time = 240 - b
while time > 0 or g != a:
if time - 5 * g >= 0:
s += 1
g += 1
time = time - 5 * g
else:
time = time - 5 * g
break
print(g)
``` | 0 |
|
868 | A | Bark to Unlock | PROGRAMMING | 900 | [
"brute force",
"implementation",
"strings"
] | null | null | As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not. | The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct. | Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower). | [
"ya\n4\nah\noy\nto\nha\n",
"hp\n2\nht\ntp\n",
"ah\n1\nha\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring. | 250 | [
{
"input": "ya\n4\nah\noy\nto\nha",
"output": "YES"
},
{
"input": "hp\n2\nht\ntp",
"output": "NO"
},
{
"input": "ah\n1\nha",
"output": "YES"
},
{
"input": "bb\n4\nba\nab\naa\nbb",
"output": "YES"
},
{
"input": "bc\n4\nca\nba\nbb\ncc",
"output": "YES"
},
{
"input": "ba\n4\ncd\nad\ncc\ncb",
"output": "YES"
},
{
"input": "pg\n4\nzl\nxs\ndi\nxn",
"output": "NO"
},
{
"input": "bn\n100\ndf\nyb\nze\nml\nyr\nof\nnw\nfm\ndw\nlv\nzr\nhu\nzt\nlw\nld\nmo\nxz\ntp\nmr\nou\nme\npx\nvp\nes\nxi\nnr\nbx\nqc\ngm\njs\nkn\ntw\nrq\nkz\nuc\nvc\nqr\nab\nna\nro\nya\nqy\ngu\nvk\nqk\ngs\nyq\nop\nhw\nrj\neo\nlz\nbh\nkr\nkb\nma\nrd\nza\nuf\nhq\nmc\nmn\nti\nwn\nsh\nax\nsi\nnd\ntz\ndu\nfj\nkl\nws\now\nnf\nvr\nye\nzc\niw\nfv\nkv\noo\nsm\nbc\nrs\nau\nuz\nuv\ngh\nsu\njn\ndz\nrl\nwj\nbk\nzl\nas\nms\nit\nwu",
"output": "YES"
},
{
"input": "bb\n1\naa",
"output": "NO"
},
{
"input": "qm\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "NO"
},
{
"input": "mq\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "bb\n1\nbb",
"output": "YES"
},
{
"input": "ba\n1\ncc",
"output": "NO"
},
{
"input": "ha\n1\nha",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "ez\n1\njl",
"output": "NO"
},
{
"input": "aa\n2\nab\nba",
"output": "YES"
},
{
"input": "aa\n2\nca\ncc",
"output": "NO"
},
{
"input": "dd\n2\nac\ndc",
"output": "NO"
},
{
"input": "qc\n2\nyc\nkr",
"output": "NO"
},
{
"input": "aa\n3\nba\nbb\nab",
"output": "YES"
},
{
"input": "ca\n3\naa\nbb\nab",
"output": "NO"
},
{
"input": "ca\n3\nbc\nbd\nca",
"output": "YES"
},
{
"input": "dd\n3\nmt\nrg\nxl",
"output": "NO"
},
{
"input": "be\n20\nad\ncd\ncb\ndb\ndd\naa\nab\nca\nae\ned\ndc\nbb\nba\nda\nee\nea\ncc\nac\nec\neb",
"output": "YES"
},
{
"input": "fc\n20\nca\nbb\nce\nfd\nde\nfa\ncc\nec\nfb\nfc\nff\nbe\ncf\nba\ndb\ned\naf\nae\nda\nef",
"output": "YES"
},
{
"input": "ca\n20\ndc\naf\ndf\neg\naa\nbc\nea\nbd\nab\ndb\ngc\nfb\nba\nbe\nee\ngf\ncf\nag\nga\nca",
"output": "YES"
},
{
"input": "ke\n20\nzk\nra\nbq\nqz\nwt\nzg\nmz\nuk\nge\nuv\nud\nfd\neh\ndm\nsk\nki\nfv\ntp\nat\nfb",
"output": "YES"
},
{
"input": "hh\n50\nag\nhg\ndg\nfh\neg\ngh\ngd\nda\nbh\nab\nhf\ndc\nhb\nfe\nad\nec\nac\nfd\nca\naf\ncg\nhd\neb\nce\nhe\nha\ngb\nea\nae\nfb\nff\nbe\nch\nhh\nee\nde\nge\ngf\naa\ngg\neh\ned\nbf\nfc\nah\nga\nbd\ncb\nbg\nbc",
"output": "YES"
},
{
"input": "id\n50\nhi\ndc\nfg\nee\ngi\nhc\nac\nih\ndg\nfc\nde\ned\nie\neb\nic\ncf\nib\nfa\ngc\nba\nbe\nga\nha\nhg\nia\ndf\nab\nei\neh\nad\nii\nci\ndh\nec\nif\ndi\nbg\nag\nhe\neg\nca\nae\ndb\naa\nid\nfh\nhh\ncc\nfb\ngb",
"output": "YES"
},
{
"input": "fe\n50\nje\nbi\nbg\ngc\nfb\nig\ndf\nji\ndg\nfe\nfc\ncf\ngf\nai\nhe\nac\nch\nja\ngh\njf\nge\ncb\nij\ngb\ncg\naf\neh\nee\nhd\njd\njb\nii\nca\nci\nga\nab\nhi\nag\nfj\nej\nfi\nie\ndj\nfg\nef\njc\njg\njh\nhf\nha",
"output": "YES"
},
{
"input": "rn\n50\nba\nec\nwg\nao\nlk\nmz\njj\ncf\nfa\njk\ndy\nsz\njs\nzr\nqv\ntx\nwv\nrd\nqw\nls\nrr\nvt\nrx\nkc\neh\nnj\niq\nyi\nkh\nue\nnv\nkz\nrn\nes\nua\nzf\nvu\nll\neg\nmj\ncz\nzj\nxz\net\neb\nci\nih\nig\nam\nvd",
"output": "YES"
},
{
"input": "ee\n100\nah\nfb\ncd\nbi\nii\nai\nid\nag\nie\nha\ndi\nec\nae\nce\njb\ndg\njg\ngd\ngf\nda\nih\nbd\nhj\ngg\nhb\ndf\ned\nfh\naf\nja\nci\nfc\nic\nji\nac\nhi\nfj\nch\nbc\njd\naa\nff\nad\ngj\nej\nde\nee\nhe\ncf\nga\nia\ncg\nbb\nhc\nbe\ngi\njf\nbg\naj\njj\nbh\nfe\ndj\nef\ngb\nge\ndb\nig\ncj\ndc\nij\njh\nei\ndd\nib\nhf\neg\nbf\nfg\nab\ngc\nfd\nhd\ngh\neh\njc\neb\nhh\nca\nje\nbj\nif\nea\nhg\nfa\ncc\nba\ndh\ncb\nfi",
"output": "YES"
},
{
"input": "if\n100\njd\nbc\nje\nhi\nga\nde\nkb\nfc\ncd\ngd\naj\ncb\nei\nbf\ncf\ndk\ndb\ncg\nki\ngg\nkg\nfa\nkj\nii\njf\njg\ngb\nbh\nbg\neh\nhj\nhb\ndg\ndj\njc\njb\nce\ndi\nig\nci\ndf\nji\nhc\nfk\naf\nac\ngk\nhd\nae\nkd\nec\nkc\neb\nfh\nij\nie\nca\nhh\nkf\nha\ndd\nif\nef\nih\nhg\nej\nfe\njk\nea\nib\nck\nhf\nak\ngi\nch\ndc\nba\nke\nad\nka\neg\njh\nja\ngc\nfd\ncc\nab\ngj\nik\nfg\nbj\nhe\nfj\nge\ngh\nhk\nbk\ned\nid\nfi",
"output": "YES"
},
{
"input": "kd\n100\nek\nea\nha\nkf\nkj\ngh\ndl\nfj\nal\nga\nlj\nik\ngd\nid\ncb\nfh\ndk\nif\nbh\nkb\nhc\nej\nhk\ngc\ngb\nef\nkk\nll\nlf\nkh\ncl\nlh\njj\nil\nhh\nci\ndb\ndf\ngk\njg\nch\nbd\ncg\nfg\nda\neb\nlg\ndg\nbk\nje\nbg\nbl\njl\ncj\nhb\nei\naa\ngl\nka\nfa\nfi\naf\nkc\nla\ngi\nij\nib\nle\ndi\nck\nag\nlc\nca\nge\nie\nlb\nke\nii\nae\nig\nic\nhe\ncf\nhd\nak\nfb\nhi\ngf\nad\nba\nhg\nbi\nkl\nac\ngg\ngj\nbe\nlk\nld\naj",
"output": "YES"
},
{
"input": "ab\n1\nab",
"output": "YES"
},
{
"input": "ya\n1\nya",
"output": "YES"
},
{
"input": "ay\n1\nyb",
"output": "NO"
},
{
"input": "ax\n2\nii\nxa",
"output": "YES"
},
{
"input": "hi\n1\nhi",
"output": "YES"
},
{
"input": "ag\n1\nag",
"output": "YES"
},
{
"input": "th\n1\nth",
"output": "YES"
},
{
"input": "sb\n1\nsb",
"output": "YES"
},
{
"input": "hp\n1\nhp",
"output": "YES"
},
{
"input": "ah\n1\nah",
"output": "YES"
},
{
"input": "ta\n1\nta",
"output": "YES"
},
{
"input": "tb\n1\ntb",
"output": "YES"
},
{
"input": "ab\n5\nca\nda\nea\nfa\nka",
"output": "NO"
},
{
"input": "ac\n1\nac",
"output": "YES"
},
{
"input": "ha\n2\nha\nzz",
"output": "YES"
},
{
"input": "ok\n1\nok",
"output": "YES"
},
{
"input": "bc\n1\nbc",
"output": "YES"
},
{
"input": "az\n1\nzz",
"output": "NO"
},
{
"input": "ab\n2\nba\ntt",
"output": "YES"
},
{
"input": "ah\n2\nap\nhp",
"output": "NO"
},
{
"input": "sh\n1\nsh",
"output": "YES"
},
{
"input": "az\n1\nby",
"output": "NO"
},
{
"input": "as\n1\nas",
"output": "YES"
},
{
"input": "ab\n2\nab\ncd",
"output": "YES"
},
{
"input": "ab\n2\nxa\nza",
"output": "NO"
},
{
"input": "ab\n2\net\nab",
"output": "YES"
},
{
"input": "ab\n1\naa",
"output": "NO"
},
{
"input": "ab\n2\nab\nde",
"output": "YES"
},
{
"input": "ah\n2\nba\nha",
"output": "YES"
},
{
"input": "ha\n3\ndd\ncc\nha",
"output": "YES"
},
{
"input": "oo\n1\nox",
"output": "NO"
},
{
"input": "ab\n2\nax\nbx",
"output": "NO"
},
{
"input": "ww\n4\nuw\now\npo\nko",
"output": "NO"
},
{
"input": "ay\n1\nay",
"output": "YES"
},
{
"input": "yo\n1\nyo",
"output": "YES"
},
{
"input": "ba\n1\nba",
"output": "YES"
},
{
"input": "qw\n1\nqw",
"output": "YES"
},
{
"input": "la\n1\nla",
"output": "YES"
},
{
"input": "ab\n2\nbb\nbc",
"output": "NO"
},
{
"input": "aa\n2\nab\nac",
"output": "NO"
},
{
"input": "ah\n2\nbb\nha",
"output": "YES"
},
{
"input": "ya\n42\nab\nac\nad\nae\naf\nag\nah\nai\nak\naj\nba\nbc\nbd\nbe\nbf\nbg\nbh\nbi\nbk\nbj\ncb\nca\ncd\nce\ncf\ncg\nch\nci\nck\ncj\ndb\ndc\nda\nde\ndf\ndg\ndh\ndi\ndk\ndj\nef\nek",
"output": "NO"
},
{
"input": "ab\n3\nab\nxx\nyy",
"output": "YES"
},
{
"input": "ab\n2\nab\ncc",
"output": "YES"
},
{
"input": "sa\n2\nxx\nas",
"output": "YES"
},
{
"input": "ma\n1\nma",
"output": "YES"
},
{
"input": "ba\n1\nbb",
"output": "NO"
},
{
"input": "bc\n1\nab",
"output": "NO"
},
{
"input": "fa\n1\nfa",
"output": "YES"
},
{
"input": "ap\n1\nap",
"output": "YES"
},
{
"input": "ab\n1\nbb",
"output": "NO"
},
{
"input": "bk\n1\nbk",
"output": "YES"
},
{
"input": "xy\n2\nxy\naa",
"output": "YES"
},
{
"input": "ab\n2\nza\nbz",
"output": "YES"
}
] | 1,596,555,501 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 6 | 108 | 6,656,000 | s=input()
t=''
for i in range(int(input())):
t+=input()
if s in t:
print('YES')
else:
if t.index(s[0])%2==1 and t.index(s[1])%2==0:
print('YES')
else:
print('NO') | Title: Bark to Unlock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
Input Specification:
The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
Output Specification:
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['ya\n4\nah\noy\nto\nha\n', 'hp\n2\nht\ntp\n', 'ah\n1\nha\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring. | ```python
s=input()
t=''
for i in range(int(input())):
t+=input()
if s in t:
print('YES')
else:
if t.index(s[0])%2==1 and t.index(s[1])%2==0:
print('YES')
else:
print('NO')
``` | -1 |
|
340 | A | The Wall | PROGRAMMING | 1,200 | [
"math"
] | null | null | Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on.
Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink.
After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question. | The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*). | Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink. | [
"2 3 6 18\n"
] | [
"3"
] | Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18. | 500 | [
{
"input": "2 3 6 18",
"output": "3"
},
{
"input": "4 6 20 201",
"output": "15"
},
{
"input": "15 27 100 10000",
"output": "74"
},
{
"input": "105 60 3456 78910",
"output": "179"
},
{
"input": "1 1 1000 100000",
"output": "99001"
},
{
"input": "3 2 5 5",
"output": "0"
},
{
"input": "555 777 1 1000000",
"output": "257"
},
{
"input": "1000 1000 1 32323",
"output": "32"
},
{
"input": "45 125 93451125 100000000",
"output": "5821"
},
{
"input": "101 171 1 1000000000",
"output": "57900"
},
{
"input": "165 255 69696 1000000000",
"output": "356482"
},
{
"input": "555 777 666013 1000000000",
"output": "257229"
},
{
"input": "23 46 123321 900000000",
"output": "19562537"
},
{
"input": "321 123 15 1000000",
"output": "75"
},
{
"input": "819 1000 9532 152901000",
"output": "186"
},
{
"input": "819 1000 10000 1000000",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "1 2 2 1000003",
"output": "500001"
},
{
"input": "1 1 1 1000000000",
"output": "1000000000"
},
{
"input": "10 15 69 195610342",
"output": "6520342"
},
{
"input": "2 1 1 1000000000",
"output": "500000000"
},
{
"input": "1000 1000 1 20",
"output": "0"
},
{
"input": "1 1 1 2000000000",
"output": "2000000000"
},
{
"input": "1 2 1 2000000000",
"output": "1000000000"
},
{
"input": "2 1 1 2000000000",
"output": "1000000000"
},
{
"input": "2 3 1 1000000000",
"output": "166666666"
},
{
"input": "2 3 1 2000000000",
"output": "333333333"
},
{
"input": "3 7 1 1000000000",
"output": "47619047"
},
{
"input": "1 1 1000000000 2000000000",
"output": "1000000001"
},
{
"input": "2 2 1 2000000000",
"output": "1000000000"
},
{
"input": "1 1 2 2000000000",
"output": "1999999999"
},
{
"input": "3 2 1 2000000000",
"output": "333333333"
},
{
"input": "1 1 2000000000 2000000000",
"output": "1"
},
{
"input": "2 3 7 7",
"output": "0"
},
{
"input": "3 3 3 7",
"output": "2"
}
] | 1,378,350,449 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 124 | 0 | import sys
_gcd = lambda s, m, n : m if n==0 else _gcd(s, n, m % n)
gcd = lambda m, n : _gcd(_gcd, m, n)
lcm = lambda m, n : m // gcd(m, n) * n
(x, y, a, b) = list(map(int, input().split()))
z = lcm(x, y)
print(b//z-(a-1)//z)
| Title: The Wall
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on.
Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink.
After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
Input Specification:
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
Output Specification:
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
Demo Input:
['2 3 6 18\n']
Demo Output:
['3']
Note:
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18. | ```python
import sys
_gcd = lambda s, m, n : m if n==0 else _gcd(s, n, m % n)
gcd = lambda m, n : _gcd(_gcd, m, n)
lcm = lambda m, n : m // gcd(m, n) * n
(x, y, a, b) = list(map(int, input().split()))
z = lcm(x, y)
print(b//z-(a-1)//z)
``` | 3 |
|
703 | A | Mishka and Game | PROGRAMMING | 800 | [
"implementation"
] | null | null | Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game.
Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner.
In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw.
Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her! | The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds.
The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively. | If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line.
If Chris is the winner of the game, print "Chris" (without quotes) in the only line.
If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line. | [
"3\n3 5\n2 1\n4 2\n",
"2\n6 1\n1 6\n",
"3\n1 5\n3 3\n2 2\n"
] | [
"Mishka",
"Friendship is magic!^^",
"Chris"
] | In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game.
In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1.
In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris. | 500 | [
{
"input": "3\n3 5\n2 1\n4 2",
"output": "Mishka"
},
{
"input": "2\n6 1\n1 6",
"output": "Friendship is magic!^^"
},
{
"input": "3\n1 5\n3 3\n2 2",
"output": "Chris"
},
{
"input": "6\n4 1\n4 2\n5 3\n5 1\n5 3\n4 1",
"output": "Mishka"
},
{
"input": "8\n2 4\n1 4\n1 5\n2 6\n2 5\n2 5\n2 4\n2 5",
"output": "Chris"
},
{
"input": "8\n4 1\n2 6\n4 2\n2 5\n5 2\n3 5\n5 2\n1 5",
"output": "Friendship is magic!^^"
},
{
"input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3",
"output": "Mishka"
},
{
"input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "9\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4",
"output": "Mishka"
},
{
"input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "10\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "100\n2 4\n6 6\n3 2\n1 5\n5 2\n1 5\n1 5\n3 1\n6 5\n4 3\n1 1\n5 1\n3 3\n2 4\n1 5\n3 4\n5 1\n5 5\n2 5\n2 1\n4 3\n6 5\n1 1\n2 1\n1 3\n1 1\n6 4\n4 6\n6 4\n2 1\n2 5\n6 2\n3 4\n5 5\n1 4\n4 6\n3 4\n1 6\n5 1\n4 3\n3 4\n2 2\n1 2\n2 3\n1 3\n4 4\n5 5\n4 5\n4 4\n3 1\n4 5\n2 3\n2 6\n6 5\n6 1\n6 6\n2 3\n6 4\n3 3\n2 5\n4 4\n3 1\n2 4\n6 1\n3 2\n1 3\n5 4\n6 6\n2 5\n5 1\n1 1\n2 5\n6 5\n3 6\n5 6\n4 3\n3 4\n3 4\n6 5\n5 2\n4 2\n1 1\n3 1\n2 6\n1 6\n1 2\n6 1\n3 4\n1 6\n3 1\n5 3\n1 3\n5 6\n2 1\n6 4\n3 1\n1 6\n6 3\n3 3\n4 3",
"output": "Chris"
},
{
"input": "100\n4 1\n3 4\n4 6\n4 5\n6 5\n5 3\n6 2\n6 3\n5 2\n4 5\n1 5\n5 4\n1 4\n4 5\n4 6\n1 6\n4 4\n5 1\n6 4\n6 4\n4 6\n2 3\n6 2\n4 6\n1 4\n2 3\n4 3\n1 3\n6 2\n3 1\n3 4\n2 6\n4 5\n5 4\n2 2\n2 5\n4 1\n2 2\n3 3\n1 4\n5 6\n6 4\n4 2\n6 1\n5 5\n4 1\n2 1\n6 4\n4 4\n4 3\n5 3\n4 5\n5 3\n3 5\n6 3\n1 1\n3 4\n6 3\n6 1\n5 1\n2 4\n4 3\n2 2\n5 5\n1 5\n5 3\n4 6\n1 4\n6 3\n4 3\n2 4\n3 2\n2 4\n3 4\n6 2\n5 6\n1 2\n1 5\n5 5\n2 6\n5 1\n1 6\n5 3\n3 5\n2 6\n4 6\n6 2\n3 1\n5 5\n6 1\n3 6\n4 4\n1 1\n4 6\n5 3\n4 2\n5 1\n3 3\n2 1\n1 4",
"output": "Mishka"
},
{
"input": "100\n6 3\n4 5\n4 3\n5 4\n5 1\n6 3\n4 2\n4 6\n3 1\n2 4\n2 2\n4 6\n5 3\n5 5\n4 2\n6 2\n2 3\n4 4\n6 4\n3 5\n2 4\n2 2\n5 2\n3 5\n2 4\n4 4\n3 5\n6 5\n1 3\n1 6\n2 2\n2 4\n3 2\n5 4\n1 6\n3 4\n4 1\n1 5\n1 4\n5 3\n2 2\n4 5\n6 3\n4 4\n1 1\n4 1\n2 4\n4 1\n4 5\n5 3\n1 1\n1 6\n5 6\n6 6\n4 2\n4 3\n3 4\n3 6\n3 4\n6 5\n3 4\n5 4\n5 1\n5 3\n5 1\n1 2\n2 6\n3 4\n6 5\n4 3\n1 1\n5 5\n5 1\n3 3\n5 2\n1 3\n6 6\n5 6\n1 4\n4 4\n1 4\n3 6\n6 5\n3 3\n3 6\n1 5\n1 2\n3 6\n3 6\n4 1\n5 2\n1 2\n5 2\n3 3\n4 4\n4 2\n6 2\n5 4\n6 1\n6 3",
"output": "Mishka"
},
{
"input": "8\n4 1\n6 2\n4 1\n5 3\n4 1\n5 3\n6 2\n5 3",
"output": "Mishka"
},
{
"input": "5\n3 6\n3 5\n3 5\n1 6\n3 5",
"output": "Chris"
},
{
"input": "4\n4 1\n2 4\n5 3\n3 6",
"output": "Friendship is magic!^^"
},
{
"input": "6\n6 3\n5 1\n6 3\n4 3\n4 3\n5 2",
"output": "Mishka"
},
{
"input": "7\n3 4\n1 4\n2 5\n1 6\n1 6\n1 5\n3 4",
"output": "Chris"
},
{
"input": "6\n6 2\n2 5\n5 2\n3 6\n4 3\n1 6",
"output": "Friendship is magic!^^"
},
{
"input": "8\n6 1\n5 3\n4 3\n4 1\n5 1\n4 2\n4 2\n4 1",
"output": "Mishka"
},
{
"input": "9\n2 5\n2 5\n1 4\n2 6\n2 4\n2 5\n2 6\n1 5\n2 5",
"output": "Chris"
},
{
"input": "4\n6 2\n2 4\n4 2\n3 6",
"output": "Friendship is magic!^^"
},
{
"input": "9\n5 2\n4 1\n4 1\n5 1\n6 2\n6 1\n5 3\n6 1\n6 2",
"output": "Mishka"
},
{
"input": "8\n2 4\n3 6\n1 6\n1 6\n2 4\n3 4\n3 6\n3 4",
"output": "Chris"
},
{
"input": "6\n5 3\n3 6\n6 2\n1 6\n5 1\n3 5",
"output": "Friendship is magic!^^"
},
{
"input": "6\n5 2\n5 1\n6 1\n5 2\n4 2\n5 1",
"output": "Mishka"
},
{
"input": "5\n1 4\n2 5\n3 4\n2 6\n3 4",
"output": "Chris"
},
{
"input": "4\n6 2\n3 4\n5 1\n1 6",
"output": "Friendship is magic!^^"
},
{
"input": "93\n4 3\n4 1\n4 2\n5 2\n5 3\n6 3\n4 3\n6 2\n6 3\n5 1\n4 2\n4 2\n5 1\n6 2\n6 3\n6 1\n4 1\n6 2\n5 3\n4 3\n4 1\n4 2\n5 2\n6 3\n5 2\n5 2\n6 3\n5 1\n6 2\n5 2\n4 1\n5 2\n5 1\n4 1\n6 1\n5 2\n4 3\n5 3\n5 3\n5 1\n4 3\n4 3\n4 2\n4 1\n6 2\n6 1\n4 1\n5 2\n5 2\n6 2\n5 3\n5 1\n6 2\n5 1\n6 3\n5 2\n6 2\n6 2\n4 2\n5 2\n6 1\n6 3\n6 3\n5 1\n5 1\n4 1\n5 1\n4 3\n5 3\n6 3\n4 1\n4 3\n6 1\n6 1\n4 2\n6 2\n4 2\n5 2\n4 1\n5 2\n4 1\n5 1\n5 2\n5 1\n4 1\n6 3\n6 2\n4 3\n4 1\n5 2\n4 3\n5 2\n5 1",
"output": "Mishka"
},
{
"input": "11\n1 6\n1 6\n2 4\n2 5\n3 4\n1 5\n1 6\n1 5\n1 6\n2 6\n3 4",
"output": "Chris"
},
{
"input": "70\n6 1\n3 6\n4 3\n2 5\n5 2\n1 4\n6 2\n1 6\n4 3\n1 4\n5 3\n2 4\n5 3\n1 6\n5 1\n3 5\n4 2\n2 4\n5 1\n3 5\n6 2\n1 5\n4 2\n2 5\n5 3\n1 5\n4 2\n1 4\n5 2\n2 6\n4 3\n1 5\n6 2\n3 4\n4 2\n3 5\n6 3\n3 4\n5 1\n1 4\n4 2\n1 4\n6 3\n2 6\n5 2\n1 6\n6 1\n2 6\n5 3\n1 5\n5 1\n1 6\n4 1\n1 5\n4 2\n2 4\n5 1\n2 5\n6 3\n1 4\n6 3\n3 6\n5 1\n1 4\n5 3\n3 5\n4 2\n3 4\n6 2\n1 4",
"output": "Friendship is magic!^^"
},
{
"input": "59\n4 1\n5 3\n6 1\n4 2\n5 1\n4 3\n6 1\n5 1\n4 3\n4 3\n5 2\n5 3\n4 1\n6 2\n5 1\n6 3\n6 3\n5 2\n5 2\n6 1\n4 1\n6 1\n4 3\n5 3\n5 3\n4 3\n4 2\n4 2\n6 3\n6 3\n6 1\n4 3\n5 1\n6 2\n6 1\n4 1\n6 1\n5 3\n4 2\n5 1\n6 2\n6 2\n4 3\n5 3\n4 3\n6 3\n5 2\n5 2\n4 3\n5 1\n5 3\n6 1\n6 3\n6 3\n4 3\n5 2\n5 2\n5 2\n4 3",
"output": "Mishka"
},
{
"input": "42\n1 5\n1 6\n1 6\n1 4\n2 5\n3 6\n1 6\n3 4\n2 5\n2 5\n2 4\n1 4\n3 4\n2 4\n2 6\n1 5\n3 6\n2 6\n2 6\n3 5\n1 4\n1 5\n2 6\n3 6\n1 4\n3 4\n2 4\n1 6\n3 4\n2 4\n2 6\n1 6\n1 4\n1 6\n1 6\n2 4\n1 5\n1 6\n2 5\n3 6\n3 5\n3 4",
"output": "Chris"
},
{
"input": "78\n4 3\n3 5\n4 3\n1 5\n5 1\n1 5\n4 3\n1 4\n6 3\n1 5\n4 1\n2 4\n4 3\n2 4\n5 1\n3 6\n4 2\n3 6\n6 3\n3 4\n4 3\n3 6\n5 3\n1 5\n4 1\n2 6\n4 2\n2 4\n4 1\n3 5\n5 2\n3 6\n4 3\n2 4\n6 3\n1 6\n4 3\n3 5\n6 3\n2 6\n4 1\n2 4\n6 2\n1 6\n4 2\n1 4\n4 3\n1 4\n4 3\n2 4\n6 2\n3 5\n6 1\n3 6\n5 3\n1 6\n6 1\n2 6\n4 2\n1 5\n6 2\n2 6\n6 3\n2 4\n4 2\n3 5\n6 1\n2 5\n5 3\n2 6\n5 1\n3 6\n4 3\n3 6\n6 3\n2 5\n6 1\n2 6",
"output": "Friendship is magic!^^"
},
{
"input": "76\n4 1\n5 2\n4 3\n5 2\n5 3\n5 2\n6 1\n4 2\n6 2\n5 3\n4 2\n6 2\n4 1\n4 2\n5 1\n5 1\n6 2\n5 2\n5 3\n6 3\n5 2\n4 3\n6 3\n6 1\n4 3\n6 2\n6 1\n4 1\n6 1\n5 3\n4 1\n5 3\n4 2\n5 2\n4 3\n6 1\n6 2\n5 2\n6 1\n5 3\n4 3\n5 1\n5 3\n4 3\n5 1\n5 1\n4 1\n4 1\n4 1\n4 3\n5 3\n6 3\n6 3\n5 2\n6 2\n6 3\n5 1\n6 3\n5 3\n6 1\n5 3\n4 1\n5 3\n6 1\n4 2\n6 2\n4 3\n4 1\n6 2\n4 3\n5 3\n5 2\n5 3\n5 1\n6 3\n5 2",
"output": "Mishka"
},
{
"input": "84\n3 6\n3 4\n2 5\n2 4\n1 6\n3 4\n1 5\n1 6\n3 5\n1 6\n2 4\n2 6\n2 6\n2 4\n3 5\n1 5\n3 6\n3 6\n3 4\n3 4\n2 6\n1 6\n1 6\n3 5\n3 4\n1 6\n3 4\n3 5\n2 4\n2 5\n2 5\n3 5\n1 6\n3 4\n2 6\n2 6\n3 4\n3 4\n2 5\n2 5\n2 4\n3 4\n2 5\n3 4\n3 4\n2 6\n2 6\n1 6\n2 4\n1 5\n3 4\n2 5\n2 5\n3 4\n2 4\n2 6\n2 6\n1 4\n3 5\n3 5\n2 4\n2 5\n3 4\n1 5\n1 5\n2 6\n1 5\n3 5\n2 4\n2 5\n3 4\n2 6\n1 6\n2 5\n3 5\n3 5\n3 4\n2 5\n2 6\n3 4\n1 6\n2 5\n2 6\n1 4",
"output": "Chris"
},
{
"input": "44\n6 1\n1 6\n5 2\n1 4\n6 2\n2 5\n5 3\n3 6\n5 2\n1 6\n4 1\n2 4\n6 1\n3 4\n6 3\n3 6\n4 3\n2 4\n6 1\n3 4\n6 1\n1 6\n4 1\n3 5\n6 1\n3 6\n4 1\n1 4\n4 2\n2 6\n6 1\n2 4\n6 2\n1 4\n6 2\n2 4\n5 2\n3 6\n6 3\n2 6\n5 3\n3 4\n5 3\n2 4",
"output": "Friendship is magic!^^"
},
{
"input": "42\n5 3\n5 1\n5 2\n4 1\n6 3\n6 1\n6 2\n4 1\n4 3\n4 1\n5 1\n5 3\n5 1\n4 1\n4 2\n6 1\n6 3\n5 1\n4 1\n4 1\n6 3\n4 3\n6 3\n5 2\n6 1\n4 1\n5 3\n4 3\n5 2\n6 3\n6 1\n5 1\n4 2\n4 3\n5 2\n5 3\n6 3\n5 2\n5 1\n5 3\n6 2\n6 1",
"output": "Mishka"
},
{
"input": "50\n3 6\n2 6\n1 4\n1 4\n1 4\n2 5\n3 4\n3 5\n2 6\n1 6\n3 5\n1 5\n2 6\n2 4\n2 4\n3 5\n1 6\n1 5\n1 5\n1 4\n3 5\n1 6\n3 5\n1 4\n1 5\n1 4\n3 6\n1 6\n1 4\n1 4\n1 4\n1 5\n3 6\n1 6\n1 6\n2 4\n1 5\n2 6\n2 5\n3 5\n3 6\n3 4\n2 4\n2 6\n3 4\n2 5\n3 6\n3 5\n2 4\n2 4",
"output": "Chris"
},
{
"input": "86\n6 3\n2 4\n6 3\n3 5\n6 3\n1 5\n5 2\n2 4\n4 3\n2 6\n4 1\n2 6\n5 2\n1 4\n5 1\n2 4\n4 1\n1 4\n6 2\n3 5\n4 2\n2 4\n6 2\n1 5\n5 3\n2 5\n5 1\n1 6\n6 1\n1 4\n4 3\n3 4\n5 2\n2 4\n5 3\n2 5\n4 3\n3 4\n4 1\n1 5\n6 3\n3 4\n4 3\n3 4\n4 1\n3 4\n5 1\n1 6\n4 2\n1 6\n5 1\n2 4\n5 1\n3 6\n4 1\n1 5\n5 2\n1 4\n4 3\n2 5\n5 1\n1 5\n6 2\n2 6\n4 2\n2 4\n4 1\n2 5\n5 3\n3 4\n5 1\n3 4\n6 3\n3 4\n4 3\n2 6\n6 2\n2 5\n5 2\n3 5\n4 2\n3 6\n6 2\n3 4\n4 2\n2 4",
"output": "Friendship is magic!^^"
},
{
"input": "84\n6 1\n6 3\n6 3\n4 1\n4 3\n4 2\n6 3\n5 3\n6 1\n6 3\n4 3\n5 2\n5 3\n5 1\n6 2\n6 2\n6 1\n4 1\n6 3\n5 2\n4 1\n5 3\n6 3\n4 2\n6 2\n6 3\n4 3\n4 1\n4 3\n5 1\n5 1\n5 1\n4 1\n6 1\n4 3\n6 2\n5 1\n5 1\n6 2\n5 2\n4 1\n6 1\n6 1\n6 3\n6 2\n4 3\n6 3\n6 2\n5 2\n5 1\n4 3\n6 2\n4 1\n6 2\n6 1\n5 2\n5 1\n6 2\n6 1\n5 3\n5 2\n6 1\n6 3\n5 2\n6 1\n6 3\n4 3\n5 1\n6 3\n6 1\n5 3\n4 3\n5 2\n5 1\n6 2\n5 3\n6 1\n5 1\n4 1\n5 1\n5 1\n5 2\n5 2\n5 1",
"output": "Mishka"
},
{
"input": "92\n1 5\n2 4\n3 5\n1 6\n2 5\n1 6\n3 6\n1 6\n2 4\n3 4\n3 4\n3 6\n1 5\n2 5\n1 5\n1 5\n2 6\n2 4\n3 6\n1 4\n1 6\n2 6\n3 4\n2 6\n2 6\n1 4\n3 5\n2 5\n2 6\n1 5\n1 4\n1 5\n3 6\n3 5\n2 5\n1 5\n3 5\n3 6\n2 6\n2 6\n1 5\n3 4\n2 4\n3 6\n2 5\n1 5\n2 4\n1 4\n2 6\n2 6\n2 6\n1 5\n3 6\n3 6\n2 5\n1 4\n2 4\n3 4\n1 5\n2 5\n2 4\n2 5\n3 5\n3 4\n3 6\n2 6\n3 5\n1 4\n3 4\n1 6\n3 6\n2 6\n1 4\n3 6\n3 6\n2 5\n2 6\n1 6\n2 6\n3 5\n2 5\n3 6\n2 5\n2 6\n1 5\n2 4\n1 4\n2 4\n1 5\n2 5\n2 5\n2 6",
"output": "Chris"
},
{
"input": "20\n5 1\n1 4\n4 3\n1 5\n4 2\n3 6\n6 2\n1 6\n4 1\n1 4\n5 2\n3 4\n5 1\n1 6\n5 1\n2 6\n6 3\n2 5\n6 2\n2 4",
"output": "Friendship is magic!^^"
},
{
"input": "100\n4 3\n4 3\n4 2\n4 3\n4 1\n4 3\n5 2\n5 2\n6 2\n4 2\n5 1\n4 2\n5 2\n6 1\n4 1\n6 3\n5 3\n5 1\n5 1\n5 1\n5 3\n6 1\n6 1\n4 1\n5 2\n5 2\n6 1\n6 3\n4 2\n4 1\n5 3\n4 1\n5 3\n5 1\n6 3\n6 3\n6 1\n5 2\n5 3\n5 3\n6 1\n4 1\n6 2\n6 1\n6 2\n6 3\n4 3\n4 3\n6 3\n4 2\n4 2\n5 3\n5 2\n5 2\n4 3\n5 3\n5 2\n4 2\n5 1\n4 2\n5 1\n5 3\n6 3\n5 3\n5 3\n4 2\n4 1\n4 2\n4 3\n6 3\n4 3\n6 2\n6 1\n5 3\n5 2\n4 1\n6 1\n5 2\n6 2\n4 2\n6 3\n4 3\n5 1\n6 3\n5 2\n4 3\n5 3\n5 3\n4 3\n6 3\n4 3\n4 1\n5 1\n6 2\n6 3\n5 3\n6 1\n6 3\n5 3\n6 1",
"output": "Mishka"
},
{
"input": "100\n1 5\n1 4\n1 5\n2 4\n2 6\n3 6\n3 5\n1 5\n2 5\n3 6\n3 5\n1 6\n1 4\n1 5\n1 6\n2 6\n1 5\n3 5\n3 4\n2 6\n2 6\n2 5\n3 4\n1 6\n1 4\n2 4\n1 5\n1 6\n3 5\n1 6\n2 6\n3 5\n1 6\n3 4\n3 5\n1 6\n3 6\n2 4\n2 4\n3 5\n2 6\n1 5\n3 5\n3 6\n2 4\n2 4\n2 6\n3 4\n3 4\n1 5\n1 4\n2 5\n3 4\n1 4\n2 6\n2 5\n2 4\n2 4\n2 5\n1 5\n1 6\n1 5\n1 5\n1 5\n1 6\n3 4\n2 4\n3 5\n3 5\n1 6\n3 5\n1 5\n1 6\n3 6\n3 4\n1 5\n3 5\n3 6\n1 4\n3 6\n1 5\n3 5\n3 6\n3 5\n1 4\n3 4\n2 4\n2 4\n2 5\n3 6\n3 5\n1 5\n2 4\n1 4\n3 4\n1 5\n3 4\n3 6\n3 5\n3 4",
"output": "Chris"
},
{
"input": "100\n4 3\n3 4\n5 1\n2 5\n5 3\n1 5\n6 3\n2 4\n5 2\n2 6\n5 2\n1 5\n6 3\n1 5\n6 3\n3 4\n5 2\n1 5\n6 1\n1 5\n4 2\n3 5\n6 3\n2 6\n6 3\n1 4\n6 2\n3 4\n4 1\n3 6\n5 1\n2 4\n5 1\n3 4\n6 2\n3 5\n4 1\n2 6\n4 3\n2 6\n5 2\n3 6\n6 2\n3 5\n4 3\n1 5\n5 3\n3 6\n4 2\n3 4\n6 1\n3 4\n5 2\n2 6\n5 2\n2 4\n6 2\n3 6\n4 3\n2 4\n4 3\n2 6\n4 2\n3 4\n6 3\n2 4\n6 3\n3 5\n5 2\n1 5\n6 3\n3 6\n4 3\n1 4\n5 2\n1 6\n4 1\n2 5\n4 1\n2 4\n4 2\n2 5\n6 1\n2 4\n6 3\n1 5\n4 3\n2 6\n6 3\n2 6\n5 3\n1 5\n4 1\n1 5\n6 2\n2 5\n5 1\n3 6\n4 3\n3 4",
"output": "Friendship is magic!^^"
},
{
"input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3",
"output": "Mishka"
},
{
"input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "99\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4",
"output": "Mishka"
},
{
"input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "100\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "84\n6 2\n1 5\n6 2\n2 3\n5 5\n1 2\n3 4\n3 4\n6 5\n6 4\n2 5\n4 1\n1 2\n1 1\n1 4\n2 5\n5 6\n6 3\n2 4\n5 5\n2 6\n3 4\n5 1\n3 3\n5 5\n4 6\n4 6\n2 4\n4 1\n5 2\n2 2\n3 6\n3 3\n4 6\n1 1\n2 4\n6 5\n5 2\n6 5\n5 5\n2 5\n6 4\n1 1\n6 2\n3 6\n6 5\n4 4\n1 5\n5 6\n4 4\n3 5\n6 1\n3 4\n1 5\n4 6\n4 6\n4 1\n3 6\n6 2\n1 1\n4 5\n5 4\n5 3\n3 4\n6 4\n1 1\n5 2\n6 5\n6 1\n2 2\n2 4\n3 3\n4 6\n1 3\n6 6\n5 2\n1 6\n6 2\n6 6\n4 1\n3 6\n6 4\n2 3\n3 4",
"output": "Chris"
},
{
"input": "70\n3 4\n2 3\n2 3\n6 5\n6 6\n4 3\n2 3\n3 1\n3 5\n5 6\n1 6\n2 5\n5 3\n2 5\n4 6\n5 1\n6 1\n3 1\n3 3\n5 3\n2 1\n3 3\n6 4\n6 3\n4 3\n4 5\n3 5\n5 5\n5 2\n1 6\n3 4\n5 2\n2 4\n1 6\n4 3\n4 3\n6 2\n1 3\n1 5\n6 1\n3 1\n1 1\n1 3\n2 2\n3 2\n6 4\n1 1\n4 4\n3 1\n4 5\n4 2\n6 3\n4 4\n3 2\n1 2\n2 6\n3 3\n1 5\n1 1\n6 5\n2 2\n3 1\n5 4\n5 2\n6 4\n6 3\n6 6\n6 3\n3 3\n5 4",
"output": "Mishka"
},
{
"input": "56\n6 4\n3 4\n6 1\n3 3\n1 4\n2 3\n1 5\n2 5\n1 5\n5 5\n2 3\n1 1\n3 2\n3 5\n4 6\n4 4\n5 2\n4 3\n3 1\n3 6\n2 3\n3 4\n5 6\n5 2\n5 6\n1 5\n1 5\n4 1\n6 3\n2 2\n2 1\n5 5\n2 1\n4 1\n5 4\n2 5\n4 1\n6 2\n3 4\n4 2\n6 4\n5 4\n4 2\n4 3\n6 2\n6 2\n3 1\n1 4\n3 6\n5 1\n5 5\n3 6\n6 4\n2 3\n6 5\n3 3",
"output": "Mishka"
},
{
"input": "94\n2 4\n6 4\n1 6\n1 4\n5 1\n3 3\n4 3\n6 1\n6 5\n3 2\n2 3\n5 1\n5 3\n1 2\n4 3\n3 2\n2 3\n4 6\n1 3\n6 3\n1 1\n3 2\n4 3\n1 5\n4 6\n3 2\n6 3\n1 6\n1 1\n1 2\n3 5\n1 3\n3 5\n4 4\n4 2\n1 4\n4 5\n1 3\n1 2\n1 1\n5 4\n5 5\n6 1\n2 1\n2 6\n6 6\n4 2\n3 6\n1 6\n6 6\n1 5\n3 2\n1 2\n4 4\n6 4\n4 1\n1 5\n3 3\n1 3\n3 4\n4 4\n1 1\n2 5\n4 5\n3 1\n3 1\n3 6\n3 2\n1 4\n1 6\n6 3\n2 4\n1 1\n2 2\n2 2\n2 1\n5 4\n1 2\n6 6\n2 2\n3 3\n6 3\n6 3\n1 6\n2 3\n2 4\n2 3\n6 6\n2 6\n6 3\n3 5\n1 4\n1 1\n3 5",
"output": "Chris"
},
{
"input": "81\n4 2\n1 2\n2 3\n4 5\n6 2\n1 6\n3 6\n3 4\n4 6\n4 4\n3 5\n4 6\n3 6\n3 5\n3 1\n1 3\n5 3\n3 4\n1 1\n4 1\n1 2\n6 1\n1 3\n6 5\n4 5\n4 2\n4 5\n6 2\n1 2\n2 6\n5 2\n1 5\n2 4\n4 3\n5 4\n1 2\n5 3\n2 6\n6 4\n1 1\n1 3\n3 1\n3 1\n6 5\n5 5\n6 1\n6 6\n5 2\n1 3\n1 4\n2 3\n5 5\n3 1\n3 1\n4 4\n1 6\n6 4\n2 2\n4 6\n4 4\n2 6\n2 4\n2 4\n4 1\n1 6\n1 4\n1 3\n6 5\n5 1\n1 3\n5 1\n1 4\n3 5\n2 6\n1 3\n5 6\n3 5\n4 4\n5 5\n5 6\n4 3",
"output": "Chris"
},
{
"input": "67\n6 5\n3 6\n1 6\n5 3\n5 4\n5 1\n1 6\n1 1\n3 2\n4 4\n3 1\n4 1\n1 5\n5 3\n3 3\n6 4\n2 4\n2 2\n4 3\n1 4\n1 4\n6 1\n1 2\n2 2\n5 1\n6 2\n3 5\n5 5\n2 2\n6 5\n6 2\n4 4\n3 1\n4 2\n6 6\n6 4\n5 1\n2 2\n4 5\n5 5\n4 6\n1 5\n6 3\n4 4\n1 5\n6 4\n3 6\n3 4\n1 6\n2 4\n2 1\n2 5\n6 5\n6 4\n4 1\n3 2\n1 2\n5 1\n5 6\n1 5\n3 5\n3 1\n5 3\n3 2\n5 1\n4 6\n6 6",
"output": "Mishka"
},
{
"input": "55\n6 6\n6 5\n2 2\n2 2\n6 4\n5 5\n6 5\n5 3\n1 3\n2 2\n5 6\n3 3\n3 3\n6 5\n3 5\n5 5\n1 2\n1 1\n4 6\n1 2\n5 5\n6 2\n6 3\n1 2\n5 1\n1 3\n3 3\n4 4\n2 5\n1 1\n5 3\n4 3\n2 2\n4 5\n5 6\n4 5\n6 3\n1 6\n6 4\n3 6\n1 6\n5 2\n6 3\n2 3\n5 5\n4 3\n3 1\n4 2\n1 1\n2 5\n5 3\n2 2\n6 3\n4 5\n2 2",
"output": "Mishka"
},
{
"input": "92\n2 3\n1 3\n2 6\n5 1\n5 5\n3 2\n5 6\n2 5\n3 1\n3 6\n4 5\n2 5\n1 2\n2 3\n6 5\n3 6\n4 4\n6 2\n4 5\n4 4\n5 1\n6 1\n3 4\n3 5\n6 6\n3 2\n6 4\n2 2\n3 5\n6 4\n6 3\n6 6\n3 4\n3 3\n6 1\n5 4\n6 2\n2 6\n5 6\n1 4\n4 6\n6 3\n3 1\n4 1\n6 6\n3 5\n6 3\n6 1\n1 6\n3 2\n6 6\n4 3\n3 4\n1 3\n3 5\n5 3\n6 5\n4 3\n5 5\n4 1\n1 5\n6 4\n2 3\n2 3\n1 5\n1 2\n5 2\n4 3\n3 6\n5 5\n5 4\n1 4\n3 3\n1 6\n5 6\n5 4\n5 3\n1 1\n6 2\n5 5\n2 5\n4 3\n6 6\n5 1\n1 1\n4 6\n4 6\n3 1\n6 4\n2 4\n2 2\n2 1",
"output": "Chris"
},
{
"input": "79\n5 3\n4 6\n3 6\n2 1\n5 2\n2 3\n4 4\n6 2\n2 5\n1 6\n6 6\n2 6\n3 3\n4 5\n6 2\n2 1\n1 5\n5 1\n2 1\n2 6\n5 3\n6 2\n2 6\n2 3\n1 5\n4 4\n6 3\n5 2\n3 2\n1 3\n1 3\n6 3\n2 6\n3 6\n5 3\n4 5\n6 1\n3 5\n3 5\n6 5\n1 5\n4 2\n6 2\n2 3\n4 6\n3 6\n2 5\n4 4\n1 1\n4 6\n2 6\n6 4\n3 2\n4 1\n1 2\n6 4\n5 6\n1 4\n2 2\n5 4\n3 2\n1 2\n2 4\n2 5\n2 1\n3 6\n3 3\n1 1\n2 2\n4 4\n4 5\n3 3\n5 3\n6 2\n4 5\n6 5\n2 5\n5 6\n2 2",
"output": "Chris"
},
{
"input": "65\n1 1\n5 1\n2 2\n5 4\n4 5\n2 5\n3 2\n5 6\n6 3\n1 1\n6 1\n1 5\n1 1\n5 2\n6 4\n1 6\n1 1\n4 3\n2 3\n5 6\n4 4\n6 2\n1 3\n4 3\n1 3\n6 3\n3 5\n4 2\n4 1\n6 1\n3 2\n2 6\n3 2\n3 5\n6 3\n4 3\n1 5\n2 6\n1 3\n4 1\n4 1\n2 5\n2 5\n6 2\n5 3\n3 1\n3 3\n5 1\n2 4\n5 3\n3 3\n1 1\n6 3\n3 3\n5 1\n1 6\n4 5\n6 6\n5 5\n2 5\n4 1\n2 2\n1 4\n1 6\n6 5",
"output": "Mishka"
},
{
"input": "1\n1 1",
"output": "Friendship is magic!^^"
}
] | 1,687,787,769 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | n=int(input())
for i in range(n):
m,n=map(int,input().split())
m1=0
c1=0
if(m>n):
m1=m1+1
else:
c1=c1+1
if(m1>c1):
print('Mishka')
elif(c1>m1):
print('Chris')
else:
print('Friendship is magic!^^')
| Title: Mishka and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game.
Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner.
In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw.
Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her!
Input Specification:
The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds.
The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively.
Output Specification:
If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line.
If Chris is the winner of the game, print "Chris" (without quotes) in the only line.
If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line.
Demo Input:
['3\n3 5\n2 1\n4 2\n', '2\n6 1\n1 6\n', '3\n1 5\n3 3\n2 2\n']
Demo Output:
['Mishka', 'Friendship is magic!^^', 'Chris']
Note:
In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game.
In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1.
In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris. | ```python
n=int(input())
for i in range(n):
m,n=map(int,input().split())
m1=0
c1=0
if(m>n):
m1=m1+1
else:
c1=c1+1
if(m1>c1):
print('Mishka')
elif(c1>m1):
print('Chris')
else:
print('Friendship is magic!^^')
``` | 0 |
|
41 | A | Translation | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Translation | 2 | 256 | The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. | The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. | If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. | [
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,615,193,193 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 0 | 184 | 2,150,400 | # Translation
st1=input()
st2=input()
count=0
for i in range(len(st1)):
if st1[i]!=st2[n-i-1]:
count=0
break
else:
count=1
if count==1:
print("YES")
else:
print("NO") | Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
# Translation
st1=input()
st2=input()
count=0
for i in range(len(st1)):
if st1[i]!=st2[n-i-1]:
count=0
break
else:
count=1
if count==1:
print("YES")
else:
print("NO")
``` | -1 |
519 | A | A and B and Chess | PROGRAMMING | 900 | [
"implementation"
] | null | null | A and B are preparing themselves for programming contests.
To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger.
For each chess piece we know its weight:
- the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position.
The player's weight equals to the sum of weights of all his pieces on the board.
As A doesn't like counting, he asked you to help him determine which player has the larger position weight. | The input contains eight lines, eight characters each — the board's description.
The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters.
The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'.
The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively.
An empty square of the board is marked as '.' (a dot).
It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on. | Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal. | [
"...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n",
"rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n",
"rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n"
] | [
"White\n",
"Draw\n",
"Black\n"
] | In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5.
In the second test sample the weights of the positions of the black and the white pieces are equal to 39.
In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16. | 500 | [
{
"input": "rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR",
"output": "Draw"
},
{
"input": "....bQ.K\n.B......\n.....P..\n........\n........\n........\n...N.P..\n.....R..",
"output": "White"
},
{
"input": "b....p..\nR.......\n.pP...b.\npp......\nq.PPNpPR\n..K..rNn\nP.....p.\n...Q..B.",
"output": "White"
},
{
"input": "...Nn...\n........\n........\n........\n.R....b.\n........\n........\n......p.",
"output": "White"
},
{
"input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq",
"output": "Black"
},
{
"input": "QQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ",
"output": "White"
},
{
"input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ",
"output": "Draw"
},
{
"input": "QQQQQQQQ\nQQQQQQQQ\n........\n........\n........\n........\nrrrrrr..\nrrrrrrrr",
"output": "White"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n.......n",
"output": "Black"
},
{
"input": "........\n...b....\n........\n........\n........\n........\n........\n.......K",
"output": "Black"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n......Kp",
"output": "Black"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n.......Q",
"output": "White"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n......Bp",
"output": "White"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\nkkkkkB..",
"output": "White"
},
{
"input": "QqPQNN.Q\n.qBbr.qB\np.RKBpNK\nPknBr.nq\nKqKRNKKk\n.BqPqkb.\nPBNPr.rk\nBpBKrPRR",
"output": "Black"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n.......K",
"output": "Draw"
}
] | 1,646,975,898 | 2,147,483,647 | Python 3 | OK | TESTS | 65 | 46 | 0 | white={"Q","R","B","N","P"}
black={"q","r","b","n","p"}
wval={"Q":9,"R":5,"B":3,"N":3,"P":1}
bval={"q":9,"r":5,"b":3,"n":3,"p":1}
s_black=0
s_white=0
for inhg in range(0,8):
s=input()
for i in range(0,8):
j=s[i]
if s[i]in white:
s_white+=wval[j]
if s[i] in black:
s_black+=bval[j]
if s_black > s_white:
print("Black")
elif s_black == s_white:
print("Draw")
else:
print("White") | Title: A and B and Chess
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A and B are preparing themselves for programming contests.
To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger.
For each chess piece we know its weight:
- the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position.
The player's weight equals to the sum of weights of all his pieces on the board.
As A doesn't like counting, he asked you to help him determine which player has the larger position weight.
Input Specification:
The input contains eight lines, eight characters each — the board's description.
The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters.
The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'.
The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively.
An empty square of the board is marked as '.' (a dot).
It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on.
Output Specification:
Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal.
Demo Input:
['...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n', 'rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n', 'rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n']
Demo Output:
['White\n', 'Draw\n', 'Black\n']
Note:
In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5.
In the second test sample the weights of the positions of the black and the white pieces are equal to 39.
In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16. | ```python
white={"Q","R","B","N","P"}
black={"q","r","b","n","p"}
wval={"Q":9,"R":5,"B":3,"N":3,"P":1}
bval={"q":9,"r":5,"b":3,"n":3,"p":1}
s_black=0
s_white=0
for inhg in range(0,8):
s=input()
for i in range(0,8):
j=s[i]
if s[i]in white:
s_white+=wval[j]
if s[i] in black:
s_black+=bval[j]
if s_black > s_white:
print("Black")
elif s_black == s_white:
print("Draw")
else:
print("White")
``` | 3 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,669,614,851 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 62 | 0 | m = int(input())
n = int(input())
print(int(m * n / 2)) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
m = int(input())
n = int(input())
print(int(m * n / 2))
``` | -1 |
353 | A | Domino | PROGRAMMING | 1,200 | [
"implementation",
"math"
] | null | null | Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even.
To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true. | The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half. | Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1. | [
"2\n4 2\n6 4\n",
"1\n2 3\n",
"3\n1 4\n2 3\n4 4\n"
] | [
"0\n",
"-1\n",
"1\n"
] | In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything.
In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd.
In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8. | 500 | [
{
"input": "2\n4 2\n6 4",
"output": "0"
},
{
"input": "1\n2 3",
"output": "-1"
},
{
"input": "3\n1 4\n2 3\n4 4",
"output": "1"
},
{
"input": "5\n5 4\n5 4\n1 5\n5 5\n3 3",
"output": "1"
},
{
"input": "20\n1 3\n5 2\n5 2\n2 6\n2 4\n1 1\n1 3\n1 4\n2 6\n4 2\n5 6\n2 2\n6 2\n4 3\n2 1\n6 2\n6 5\n4 5\n2 4\n1 4",
"output": "-1"
},
{
"input": "100\n2 3\n2 4\n3 3\n1 4\n5 2\n5 4\n6 6\n3 4\n1 1\n4 2\n5 1\n5 5\n5 3\n3 6\n4 1\n1 6\n1 1\n3 2\n4 5\n6 1\n6 4\n1 1\n3 4\n3 3\n2 2\n1 1\n4 4\n6 4\n3 2\n5 2\n6 4\n3 2\n3 5\n4 4\n1 4\n5 2\n3 4\n1 4\n2 2\n5 6\n3 5\n6 1\n5 5\n1 6\n6 3\n1 4\n1 5\n5 5\n4 1\n3 2\n4 1\n5 5\n5 5\n1 5\n1 2\n6 4\n1 3\n3 6\n4 3\n3 5\n6 4\n2 6\n5 5\n1 4\n2 2\n2 3\n5 1\n2 5\n1 2\n2 6\n5 5\n4 6\n1 4\n3 6\n2 3\n6 1\n6 5\n3 2\n6 4\n4 5\n4 5\n2 6\n1 3\n6 2\n1 2\n2 3\n4 3\n5 4\n3 4\n1 6\n6 6\n2 4\n4 1\n3 1\n2 6\n5 4\n1 2\n6 5\n3 6\n2 4",
"output": "-1"
},
{
"input": "1\n2 4",
"output": "0"
},
{
"input": "1\n1 1",
"output": "-1"
},
{
"input": "1\n1 2",
"output": "-1"
},
{
"input": "2\n1 1\n3 3",
"output": "0"
},
{
"input": "2\n1 1\n2 2",
"output": "-1"
},
{
"input": "2\n1 1\n1 2",
"output": "-1"
},
{
"input": "5\n1 2\n6 6\n1 1\n3 3\n6 1",
"output": "1"
},
{
"input": "5\n5 4\n2 6\n6 2\n1 4\n6 2",
"output": "0"
},
{
"input": "10\n4 1\n3 2\n1 2\n2 6\n3 5\n2 1\n5 2\n4 6\n5 6\n3 1",
"output": "0"
},
{
"input": "10\n6 1\n4 4\n2 6\n6 5\n3 6\n6 3\n2 4\n5 1\n1 6\n1 5",
"output": "-1"
},
{
"input": "15\n1 2\n5 1\n6 4\n5 1\n1 6\n2 6\n3 1\n6 4\n3 1\n2 1\n6 4\n3 5\n6 2\n1 6\n1 1",
"output": "1"
},
{
"input": "15\n3 3\n2 1\n5 4\n3 3\n5 3\n5 4\n2 5\n1 3\n3 2\n3 3\n3 5\n2 5\n4 1\n2 3\n5 4",
"output": "-1"
},
{
"input": "20\n1 5\n6 4\n4 3\n6 2\n1 1\n1 5\n6 3\n2 3\n3 6\n3 6\n3 6\n2 5\n4 3\n4 6\n5 5\n4 6\n3 4\n4 2\n3 3\n5 2",
"output": "0"
},
{
"input": "20\n2 1\n6 5\n3 1\n2 5\n3 5\n4 1\n1 1\n5 4\n5 1\n2 4\n1 5\n3 2\n1 2\n3 5\n5 2\n1 2\n1 3\n4 2\n2 3\n4 5",
"output": "-1"
},
{
"input": "25\n4 1\n6 3\n1 3\n2 3\n2 4\n6 6\n4 2\n4 2\n1 5\n5 4\n1 2\n2 5\n3 6\n4 1\n3 4\n2 6\n6 1\n5 6\n6 6\n4 2\n1 5\n3 3\n3 3\n6 5\n1 4",
"output": "-1"
},
{
"input": "25\n5 5\n4 3\n2 5\n4 3\n4 6\n4 2\n5 6\n2 1\n5 4\n6 6\n1 3\n1 4\n2 3\n5 6\n5 4\n5 6\n5 4\n6 3\n3 5\n1 3\n2 5\n2 2\n4 4\n2 1\n4 4",
"output": "-1"
},
{
"input": "30\n3 5\n2 5\n1 6\n1 6\n2 4\n5 5\n5 4\n5 6\n5 4\n2 1\n2 4\n1 6\n3 5\n1 1\n3 6\n5 5\n1 6\n3 4\n1 4\n4 6\n2 1\n3 3\n1 3\n4 5\n1 4\n1 6\n2 1\n4 6\n3 5\n5 6",
"output": "1"
},
{
"input": "30\n2 3\n3 1\n6 6\n1 3\n5 5\n3 6\n4 5\n2 1\n1 3\n2 3\n4 4\n2 4\n6 4\n2 4\n5 4\n2 1\n2 5\n2 5\n4 2\n1 4\n2 6\n3 2\n3 2\n6 6\n4 2\n3 4\n6 3\n6 6\n6 6\n5 5",
"output": "1"
},
{
"input": "35\n6 1\n4 3\n1 2\n4 3\n6 4\n4 6\n3 1\n5 5\n3 4\n5 4\n4 6\n1 6\n2 4\n6 6\n5 4\n5 2\n1 3\n1 4\n3 5\n1 4\n2 3\n4 5\n4 3\n6 1\n5 3\n3 2\n5 6\n3 5\n6 5\n4 1\n1 3\n5 5\n4 6\n6 1\n1 3",
"output": "1"
},
{
"input": "35\n4 3\n5 6\n4 5\n2 5\n6 6\n4 1\n2 2\n4 2\n3 4\n4 1\n6 6\n6 3\n1 5\n1 5\n5 6\n4 2\n4 6\n5 5\n2 2\n5 2\n1 2\n4 6\n6 6\n6 5\n2 1\n3 5\n2 5\n3 1\n5 3\n6 4\n4 6\n5 6\n5 1\n3 4\n3 5",
"output": "1"
},
{
"input": "40\n5 6\n1 1\n3 3\n2 6\n6 6\n5 4\n6 4\n3 5\n1 3\n4 4\n4 4\n2 5\n1 3\n3 6\n5 2\n4 3\n4 4\n5 6\n2 3\n1 1\n3 1\n1 1\n1 5\n4 3\n5 5\n3 4\n6 6\n5 6\n2 2\n6 6\n2 1\n2 4\n5 2\n2 2\n1 1\n1 4\n4 2\n3 5\n5 5\n4 5",
"output": "-1"
},
{
"input": "40\n3 2\n5 3\n4 6\n3 5\n6 1\n5 2\n1 2\n6 2\n5 3\n3 2\n4 4\n3 3\n5 2\n4 5\n1 4\n5 1\n3 3\n1 3\n1 3\n2 1\n3 6\n4 2\n4 6\n6 2\n2 5\n2 2\n2 5\n3 3\n5 3\n2 1\n3 2\n2 3\n6 3\n6 3\n3 4\n3 2\n4 3\n5 4\n2 4\n4 6",
"output": "-1"
},
{
"input": "45\n2 4\n3 4\n6 1\n5 5\n1 1\n3 5\n4 3\n5 2\n3 6\n6 1\n4 4\n6 1\n2 1\n6 1\n3 6\n3 3\n6 1\n1 2\n1 5\n6 5\n1 3\n5 6\n6 1\n4 5\n3 6\n2 2\n1 2\n4 5\n5 6\n1 5\n6 2\n2 4\n3 3\n3 1\n6 5\n6 5\n2 1\n5 2\n2 1\n3 3\n2 2\n1 4\n2 2\n3 3\n2 1",
"output": "-1"
},
{
"input": "45\n6 6\n1 6\n1 2\n3 5\n4 4\n2 1\n5 3\n2 1\n5 2\n5 3\n1 4\n5 2\n4 2\n3 6\n5 2\n1 5\n4 4\n5 5\n6 5\n2 1\n2 6\n5 5\n2 1\n6 1\n1 6\n6 5\n2 4\n4 3\n2 6\n2 4\n6 5\n6 4\n6 3\n6 6\n2 1\n6 4\n5 6\n5 4\n1 5\n5 1\n3 3\n5 6\n2 5\n4 5\n3 6",
"output": "-1"
},
{
"input": "50\n4 4\n5 1\n6 4\n6 2\n6 2\n1 4\n5 5\n4 2\n5 5\n5 4\n1 3\n3 5\n6 1\n6 1\n1 4\n4 3\n5 1\n3 6\n2 2\n6 2\n4 4\n2 3\n4 2\n6 5\n5 6\n2 2\n2 4\n3 5\n1 5\n3 2\n3 4\n5 6\n4 6\n1 6\n4 5\n2 6\n2 2\n3 5\n6 4\n5 1\n4 3\n3 4\n3 5\n3 3\n2 3\n3 2\n2 2\n1 4\n3 1\n4 4",
"output": "1"
},
{
"input": "50\n1 2\n1 4\n1 1\n4 5\n4 4\n3 2\n4 5\n3 5\n1 1\n3 4\n3 2\n2 4\n2 6\n2 6\n3 2\n4 6\n1 6\n3 1\n1 6\n2 1\n4 1\n1 6\n4 3\n6 6\n5 2\n6 4\n2 1\n4 3\n6 4\n5 1\n5 5\n3 1\n1 1\n5 5\n2 2\n2 3\n2 3\n3 5\n5 5\n1 6\n1 5\n3 6\n3 6\n1 1\n3 3\n2 6\n5 5\n1 3\n6 3\n6 6",
"output": "-1"
},
{
"input": "55\n3 2\n5 6\n5 1\n3 5\n5 5\n1 5\n5 4\n6 3\n5 6\n4 2\n3 1\n1 2\n5 5\n1 1\n5 2\n6 3\n5 4\n3 6\n4 6\n2 6\n6 4\n1 4\n1 6\n4 1\n2 5\n4 3\n2 1\n2 1\n6 2\n3 1\n2 5\n4 4\n6 3\n2 2\n3 5\n5 1\n3 6\n5 4\n4 6\n6 5\n5 6\n2 2\n3 2\n5 2\n6 5\n2 2\n5 3\n3 1\n4 5\n6 4\n2 4\n1 2\n5 6\n2 6\n5 2",
"output": "0"
},
{
"input": "55\n4 6\n3 3\n6 5\n5 3\n5 6\n2 3\n2 2\n3 4\n3 1\n5 4\n5 4\n2 4\n3 4\n4 5\n1 5\n6 3\n1 1\n5 1\n3 4\n1 5\n3 1\n2 5\n3 3\n4 3\n3 3\n3 1\n6 6\n3 3\n3 3\n5 6\n5 3\n3 5\n1 4\n5 5\n1 3\n1 4\n3 5\n3 6\n2 4\n2 4\n5 1\n6 4\n5 1\n5 5\n1 1\n3 2\n4 3\n5 4\n5 1\n2 4\n4 3\n6 1\n3 4\n1 5\n6 3",
"output": "-1"
},
{
"input": "60\n2 6\n1 4\n3 2\n1 2\n3 2\n2 4\n6 4\n4 6\n1 3\n3 1\n6 5\n2 4\n5 4\n4 2\n1 6\n3 4\n4 5\n5 2\n1 5\n5 4\n3 4\n3 4\n4 4\n4 1\n6 6\n3 6\n2 4\n2 1\n4 4\n6 5\n3 1\n4 3\n1 3\n6 3\n5 5\n1 4\n3 1\n3 6\n1 5\n3 1\n1 5\n4 4\n1 3\n2 4\n6 2\n4 1\n5 3\n3 4\n5 6\n1 2\n1 6\n6 3\n1 6\n3 6\n3 4\n6 2\n4 6\n2 3\n3 3\n3 3",
"output": "-1"
},
{
"input": "60\n2 3\n4 6\n2 4\n1 3\n5 6\n1 5\n1 2\n1 3\n5 6\n4 3\n4 2\n3 1\n1 3\n3 5\n1 5\n3 4\n2 4\n3 5\n4 5\n1 2\n3 1\n1 5\n2 5\n6 2\n1 6\n3 3\n6 2\n5 3\n1 3\n1 4\n6 4\n6 3\n4 2\n4 2\n1 4\n1 3\n3 2\n3 1\n2 1\n1 2\n3 1\n2 6\n1 4\n3 6\n3 3\n1 5\n2 4\n5 5\n6 2\n5 2\n3 3\n5 3\n3 4\n4 5\n5 6\n2 4\n5 3\n3 1\n2 4\n5 4",
"output": "-1"
},
{
"input": "65\n5 4\n3 3\n1 2\n4 3\n3 5\n1 5\n4 5\n2 6\n1 2\n1 5\n6 3\n2 6\n4 3\n3 6\n1 5\n3 5\n4 6\n2 5\n6 5\n1 4\n3 4\n4 3\n1 4\n2 5\n6 5\n3 1\n4 3\n1 2\n1 1\n6 1\n5 2\n3 2\n1 6\n2 6\n3 3\n6 6\n4 6\n1 5\n5 1\n4 5\n1 4\n3 2\n5 4\n4 2\n6 2\n1 3\n4 2\n5 3\n6 4\n3 6\n1 2\n6 1\n6 6\n3 3\n4 2\n3 5\n4 6\n4 1\n5 4\n6 1\n5 1\n5 6\n6 1\n4 6\n5 5",
"output": "1"
},
{
"input": "65\n5 4\n6 3\n5 4\n4 5\n5 3\n3 6\n1 3\n3 1\n1 3\n6 1\n6 4\n1 3\n2 2\n4 6\n4 1\n5 6\n6 5\n1 1\n1 3\n6 6\n4 1\n2 4\n5 4\n4 1\n5 5\n5 3\n6 2\n2 6\n4 2\n2 2\n6 2\n3 3\n4 5\n4 3\n3 1\n1 4\n4 5\n3 2\n5 5\n4 6\n5 1\n3 4\n5 4\n5 2\n1 6\n4 2\n3 4\n3 4\n1 3\n1 2\n3 3\n3 6\n6 4\n4 6\n6 2\n6 5\n3 2\n2 1\n6 4\n2 1\n1 5\n5 2\n6 5\n3 6\n5 1",
"output": "1"
},
{
"input": "70\n4 1\n2 6\n1 1\n5 6\n5 1\n2 3\n3 5\n1 1\n1 1\n4 6\n4 3\n1 5\n2 2\n2 3\n3 1\n6 4\n3 1\n4 2\n5 4\n1 3\n3 5\n5 2\n5 6\n4 4\n4 5\n2 2\n4 5\n3 2\n3 5\n2 5\n2 6\n5 5\n2 6\n5 1\n1 1\n2 5\n3 1\n1 2\n6 4\n6 5\n5 5\n5 1\n1 5\n2 2\n6 3\n4 3\n6 2\n5 5\n1 1\n6 2\n6 6\n3 4\n2 2\n3 5\n1 5\n2 5\n4 5\n2 4\n6 3\n5 1\n2 6\n4 2\n1 4\n1 6\n6 2\n5 2\n5 6\n2 5\n5 6\n5 5",
"output": "-1"
},
{
"input": "70\n4 3\n6 4\n5 5\n3 1\n1 2\n2 5\n4 6\n4 2\n3 2\n4 2\n1 5\n2 2\n4 3\n1 2\n6 1\n6 6\n1 6\n5 1\n2 2\n6 3\n4 2\n4 3\n1 2\n6 6\n3 3\n6 5\n6 2\n3 6\n6 6\n4 6\n5 2\n5 4\n3 3\n1 6\n5 6\n2 3\n4 6\n1 1\n1 2\n6 6\n1 1\n3 4\n1 6\n2 6\n3 4\n6 3\n5 3\n1 2\n2 3\n4 6\n2 1\n6 4\n4 6\n4 6\n4 2\n5 5\n3 5\n3 2\n4 3\n3 6\n1 4\n3 6\n1 4\n1 6\n1 5\n5 6\n4 4\n3 3\n3 5\n2 2",
"output": "0"
},
{
"input": "75\n1 3\n4 5\n4 1\n6 5\n2 1\n1 4\n5 4\n1 5\n5 3\n1 2\n4 1\n1 1\n5 1\n5 3\n1 5\n4 2\n2 2\n6 3\n1 2\n4 3\n2 5\n5 3\n5 5\n4 1\n4 6\n2 5\n6 1\n2 4\n6 4\n5 2\n6 2\n2 4\n1 3\n5 4\n6 5\n5 4\n6 4\n1 5\n4 6\n1 5\n1 1\n4 4\n3 5\n6 3\n6 5\n1 5\n2 1\n1 5\n6 6\n2 2\n2 2\n4 4\n6 6\n5 4\n4 5\n3 2\n2 4\n1 1\n4 3\n3 2\n5 4\n1 6\n1 2\n2 2\n3 5\n2 6\n1 1\n2 2\n2 3\n6 2\n3 6\n4 4\n5 1\n4 1\n4 1",
"output": "0"
},
{
"input": "75\n1 1\n2 1\n5 5\n6 5\n6 3\n1 6\n6 1\n4 4\n2 1\n6 2\n3 1\n6 4\n1 6\n2 2\n4 3\n4 2\n1 2\n6 2\n4 2\n5 1\n1 2\n3 2\n6 6\n6 3\n2 4\n4 1\n4 1\n2 4\n5 5\n2 3\n5 5\n4 5\n3 1\n1 5\n4 3\n2 3\n3 5\n4 6\n5 6\n1 6\n2 3\n2 2\n1 2\n5 6\n1 4\n1 5\n1 3\n6 2\n1 2\n4 2\n2 1\n1 3\n6 4\n4 1\n5 2\n6 2\n3 5\n2 3\n4 2\n5 1\n5 6\n3 2\n2 1\n6 6\n2 1\n6 2\n1 1\n3 2\n1 2\n3 5\n4 6\n1 3\n3 4\n5 5\n6 2",
"output": "1"
},
{
"input": "80\n3 1\n6 3\n2 2\n2 2\n6 3\n6 1\n6 5\n1 4\n3 6\n6 5\n1 3\n2 4\n1 4\n3 1\n5 3\n5 3\n1 4\n2 5\n4 3\n4 4\n4 5\n6 1\n3 1\n2 6\n4 2\n3 1\n6 5\n2 6\n2 2\n5 1\n1 3\n5 1\n2 1\n4 3\n6 3\n3 5\n4 3\n5 6\n3 3\n4 1\n5 1\n6 5\n5 1\n2 5\n6 1\n3 2\n4 3\n3 3\n5 6\n1 6\n5 2\n1 5\n5 6\n6 4\n2 2\n4 2\n4 6\n4 2\n4 4\n6 5\n5 2\n6 2\n4 6\n6 4\n4 3\n5 1\n4 1\n3 5\n3 2\n3 2\n5 3\n5 4\n3 4\n1 3\n1 2\n6 6\n6 3\n6 1\n5 6\n3 2",
"output": "0"
},
{
"input": "80\n4 5\n3 3\n3 6\n4 5\n3 4\n6 5\n1 5\n2 5\n5 6\n5 1\n5 1\n1 2\n5 5\n5 1\n2 3\n1 1\n4 5\n4 1\n1 1\n5 5\n5 6\n5 2\n5 4\n4 2\n6 2\n5 3\n3 2\n4 2\n1 3\n1 6\n2 1\n6 6\n4 5\n6 4\n2 2\n1 6\n6 2\n4 3\n2 3\n4 6\n4 6\n6 2\n3 4\n4 3\n5 5\n1 6\n3 2\n4 6\n2 3\n1 6\n5 4\n4 2\n5 4\n1 1\n4 3\n5 1\n3 6\n6 2\n3 1\n4 1\n5 3\n2 2\n3 4\n3 6\n3 5\n5 5\n5 1\n3 5\n2 6\n6 3\n6 5\n3 3\n5 6\n1 2\n3 1\n6 3\n3 4\n6 6\n6 6\n1 2",
"output": "-1"
},
{
"input": "85\n6 3\n4 1\n1 2\n3 5\n6 4\n6 2\n2 6\n1 2\n1 5\n6 2\n1 4\n6 6\n2 4\n4 6\n4 5\n1 6\n3 1\n2 5\n5 1\n5 2\n3 5\n1 1\n4 1\n2 3\n1 1\n3 3\n6 4\n1 4\n1 1\n3 6\n1 5\n1 6\n2 5\n2 2\n5 1\n6 6\n1 3\n1 5\n5 6\n4 5\n4 3\n5 5\n1 3\n6 3\n4 6\n2 4\n5 6\n6 2\n4 5\n1 4\n1 4\n6 5\n1 6\n6 1\n1 6\n5 5\n2 1\n5 2\n2 3\n1 6\n1 6\n1 6\n5 6\n2 4\n6 5\n6 5\n4 2\n5 4\n3 4\n4 3\n6 6\n3 3\n3 2\n3 6\n2 5\n2 1\n2 5\n3 4\n1 2\n5 4\n6 2\n5 1\n1 4\n3 4\n4 5",
"output": "0"
},
{
"input": "85\n3 1\n3 2\n6 3\n1 3\n2 1\n3 6\n1 4\n2 5\n6 5\n1 6\n1 5\n1 1\n4 3\n3 5\n4 6\n3 2\n6 6\n4 4\n4 1\n5 5\n4 2\n6 2\n2 2\n4 5\n6 1\n3 4\n4 5\n3 5\n4 2\n3 5\n4 4\n3 1\n4 4\n6 4\n1 4\n5 5\n1 5\n2 2\n6 5\n5 6\n6 5\n3 2\n3 2\n6 1\n6 5\n2 1\n4 6\n2 1\n3 1\n5 6\n1 3\n5 4\n1 4\n1 4\n5 3\n2 3\n1 3\n2 2\n5 3\n2 3\n2 3\n1 3\n3 6\n4 4\n6 6\n6 2\n5 1\n5 5\n5 5\n1 2\n1 4\n2 4\n3 6\n4 6\n6 3\n6 4\n5 5\n3 2\n5 4\n5 4\n4 5\n6 4\n2 1\n5 2\n5 1",
"output": "-1"
},
{
"input": "90\n5 2\n5 5\n5 1\n4 6\n4 3\n5 3\n5 6\n5 1\n3 4\n1 3\n4 2\n1 6\n6 4\n1 2\n6 1\n4 1\n6 2\n6 5\n6 2\n5 4\n3 6\n1 1\n5 5\n2 2\n1 6\n3 5\n6 5\n1 6\n1 5\n2 3\n2 6\n2 3\n3 3\n1 3\n5 1\n2 5\n3 6\n1 2\n4 4\n1 6\n2 3\n1 5\n2 5\n1 3\n2 2\n4 6\n3 6\n6 3\n1 2\n4 3\n4 5\n4 6\n3 2\n6 5\n6 2\n2 5\n2 4\n1 3\n1 6\n4 3\n1 3\n6 4\n4 6\n4 1\n1 1\n4 1\n4 4\n6 2\n6 5\n1 1\n2 2\n3 1\n1 4\n6 2\n5 2\n1 4\n1 3\n6 5\n3 2\n6 4\n3 4\n2 6\n2 2\n6 3\n4 6\n1 2\n4 2\n3 4\n2 3\n1 5",
"output": "-1"
},
{
"input": "90\n1 4\n3 5\n4 2\n2 5\n4 3\n2 6\n2 6\n3 2\n4 4\n6 1\n4 3\n2 3\n5 3\n6 6\n2 2\n6 3\n4 1\n4 4\n5 6\n6 4\n4 2\n5 6\n4 6\n4 4\n6 4\n4 1\n5 3\n3 2\n4 4\n5 2\n5 4\n6 4\n1 2\n3 3\n3 4\n6 4\n1 6\n4 2\n3 2\n1 1\n2 2\n5 1\n6 6\n4 1\n5 2\n3 6\n2 1\n2 2\n4 6\n6 5\n4 4\n5 5\n5 6\n1 6\n1 4\n5 6\n3 6\n6 3\n5 6\n6 5\n5 1\n6 1\n6 6\n6 3\n1 5\n4 5\n3 1\n6 6\n3 4\n6 2\n1 4\n2 2\n3 2\n5 6\n2 4\n1 4\n6 3\n4 6\n1 4\n5 2\n1 2\n6 5\n1 5\n1 4\n4 2\n2 5\n3 2\n5 1\n5 4\n5 3",
"output": "-1"
},
{
"input": "95\n4 3\n3 2\n5 5\n5 3\n1 6\n4 4\n5 5\n6 5\n3 5\n1 5\n4 2\n5 1\n1 2\n2 3\n6 4\n2 3\n6 3\n6 5\n5 6\n1 4\n2 6\n2 6\n2 5\n2 1\n3 1\n3 5\n2 2\n6 1\n2 4\n4 6\n6 6\n6 4\n3 2\n5 1\n4 3\n6 5\n2 3\n4 1\n2 5\n6 5\n6 5\n6 5\n5 1\n5 4\n4 6\n3 2\n2 5\n2 6\n4 6\n6 3\n6 4\n5 6\n4 6\n2 4\n3 4\n1 4\n2 4\n2 3\n5 6\n6 4\n3 1\n5 1\n3 6\n3 5\n2 6\n6 3\n4 3\n3 1\n6 1\n2 2\n6 3\n2 2\n2 2\n6 4\n6 1\n2 1\n5 6\n5 4\n5 2\n3 4\n3 6\n2 1\n1 6\n5 5\n2 6\n2 3\n3 6\n1 3\n1 5\n5 1\n1 2\n2 2\n5 3\n6 4\n4 5",
"output": "0"
},
{
"input": "95\n4 5\n5 6\n3 2\n5 1\n4 3\n4 1\n6 1\n5 2\n2 4\n5 3\n2 3\n6 4\n4 1\n1 6\n2 6\n2 3\n4 6\n2 4\n3 4\n4 2\n5 5\n1 1\n1 5\n4 3\n4 5\n6 2\n6 1\n6 3\n5 5\n4 1\n5 1\n2 3\n5 1\n3 6\n6 6\n4 5\n4 4\n4 3\n1 6\n6 6\n4 6\n6 4\n1 2\n6 2\n4 6\n6 6\n5 5\n6 1\n5 2\n4 5\n6 6\n6 5\n4 4\n1 5\n4 6\n4 1\n3 6\n5 1\n3 1\n4 6\n4 5\n1 3\n5 4\n4 5\n2 2\n6 1\n5 2\n6 5\n2 2\n1 1\n6 3\n6 1\n2 6\n3 3\n2 1\n4 6\n2 4\n5 5\n5 2\n3 2\n1 2\n6 6\n6 2\n5 1\n2 6\n5 2\n2 2\n5 5\n3 5\n3 3\n2 6\n5 3\n4 3\n1 6\n5 4",
"output": "-1"
},
{
"input": "100\n1 1\n3 5\n2 1\n1 2\n3 4\n5 6\n5 6\n6 1\n5 5\n2 4\n5 5\n5 6\n6 2\n6 6\n2 6\n1 4\n2 2\n3 2\n1 3\n5 5\n6 3\n5 6\n1 1\n1 2\n1 2\n2 1\n2 3\n1 6\n4 3\n1 1\n2 5\n2 4\n4 4\n1 5\n3 3\n6 1\n3 5\n1 1\n3 6\n3 1\n4 2\n4 3\n3 6\n6 6\n1 6\n6 2\n2 5\n5 4\n6 3\n1 4\n2 6\n6 2\n3 4\n6 1\n6 5\n4 6\n6 5\n4 4\n3 1\n6 3\n5 1\n2 4\n5 1\n1 2\n2 4\n2 1\n6 6\n5 3\n4 6\n6 3\n5 5\n3 3\n1 1\n6 5\n4 3\n2 6\n1 5\n3 5\n2 4\n4 5\n1 6\n2 3\n6 3\n5 5\n2 6\n2 6\n3 4\n3 2\n6 1\n3 4\n6 4\n3 3\n2 3\n5 1\n3 1\n6 2\n2 3\n6 4\n1 4\n1 2",
"output": "-1"
},
{
"input": "100\n1 1\n5 5\n1 2\n5 3\n5 5\n2 2\n1 5\n3 4\n3 2\n1 3\n5 6\n4 5\n2 1\n5 5\n2 2\n1 6\n6 1\n5 1\n4 1\n4 6\n3 5\n6 1\n2 3\n5 6\n3 6\n2 3\n5 6\n1 6\n3 2\n2 2\n3 3\n6 5\n5 5\n1 4\n5 6\n6 4\n1 4\n1 2\n2 6\n3 2\n6 4\n5 3\n3 3\n6 4\n4 6\n2 2\n5 6\n5 1\n1 2\n3 4\n4 5\n1 1\n3 4\n5 2\n4 5\n3 3\n1 1\n3 4\n1 6\n2 4\n1 3\n3 2\n6 5\n1 6\n3 6\n2 3\n2 6\n5 1\n5 5\n5 6\n4 1\n6 2\n3 6\n5 3\n2 2\n2 4\n6 6\n3 6\n4 6\n2 5\n5 3\n1 2\n3 4\n3 4\n6 2\n2 4\n2 2\n4 6\n3 5\n4 2\n5 6\n4 2\n2 3\n6 2\n5 6\n2 1\n3 3\n6 6\n4 3\n4 2",
"output": "1"
},
{
"input": "1\n2 2",
"output": "0"
},
{
"input": "3\n2 4\n6 6\n3 3",
"output": "-1"
},
{
"input": "2\n3 6\n4 1",
"output": "1"
},
{
"input": "3\n1 1\n1 1\n3 3",
"output": "-1"
},
{
"input": "3\n2 3\n1 1\n2 3",
"output": "1"
},
{
"input": "3\n2 2\n2 1\n1 2",
"output": "1"
},
{
"input": "3\n1 1\n1 1\n1 1",
"output": "-1"
}
] | 1,611,325,543 | 2,147,483,647 | PyPy 3 | OK | TESTS | 59 | 248 | 409,600 | from math import *
from collections import *
from sys import *
t=stdin.readline
p=stdout.write
def GI(): return map(int, t().strip().split())
def GS(): return map(str, t().strip().split())
def GL(): return list(map(int, t().strip().split()))
def SL(): return list(map(str, t().strip().split()))
c1,c2,o=0,0,0
o1,o2=0,0
n=int(t())
for _ in range(n):
x,y=GI()
if (x%2==0 and y%2==1) or (x%2==1 and y%2==0): o+=1
c1+=x;c2+=y
if c1%2==0 and c2%2==0: p('0')
elif (c1%2==0 and c2%2==1) or (c1%2==1 and c2%2==0): p('-1')
else:
if o>0: p('1')
else: p('-1') | Title: Domino
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even.
To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
Output Specification:
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
Demo Input:
['2\n4 2\n6 4\n', '1\n2 3\n', '3\n1 4\n2 3\n4 4\n']
Demo Output:
['0\n', '-1\n', '1\n']
Note:
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything.
In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd.
In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8. | ```python
from math import *
from collections import *
from sys import *
t=stdin.readline
p=stdout.write
def GI(): return map(int, t().strip().split())
def GS(): return map(str, t().strip().split())
def GL(): return list(map(int, t().strip().split()))
def SL(): return list(map(str, t().strip().split()))
c1,c2,o=0,0,0
o1,o2=0,0
n=int(t())
for _ in range(n):
x,y=GI()
if (x%2==0 and y%2==1) or (x%2==1 and y%2==0): o+=1
c1+=x;c2+=y
if c1%2==0 and c2%2==0: p('0')
elif (c1%2==0 and c2%2==1) or (c1%2==1 and c2%2==0): p('-1')
else:
if o>0: p('1')
else: p('-1')
``` | 3 |
|
268 | A | Games | PROGRAMMING | 800 | [
"brute force"
] | null | null | Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question. | The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively. | In a single line print the number of games where the host team is going to play in the guest uniform. | [
"3\n1 2\n2 4\n3 4\n",
"4\n100 42\n42 100\n5 42\n100 5\n",
"2\n1 2\n1 2\n"
] | [
"1\n",
"5\n",
"0\n"
] | In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first). | 500 | [
{
"input": "3\n1 2\n2 4\n3 4",
"output": "1"
},
{
"input": "4\n100 42\n42 100\n5 42\n100 5",
"output": "5"
},
{
"input": "2\n1 2\n1 2",
"output": "0"
},
{
"input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52",
"output": "6"
},
{
"input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28",
"output": "1"
},
{
"input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77",
"output": "6"
},
{
"input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35",
"output": "4"
},
{
"input": "2\n46 6\n6 46",
"output": "2"
},
{
"input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11",
"output": "10"
},
{
"input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33",
"output": "6"
},
{
"input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73",
"output": "0"
},
{
"input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2",
"output": "1"
},
{
"input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100",
"output": "8"
},
{
"input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "450"
},
{
"input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3",
"output": "0"
},
{
"input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5",
"output": "20"
},
{
"input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2",
"output": "108"
},
{
"input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2",
"output": "312"
},
{
"input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6",
"output": "96"
},
{
"input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97",
"output": "210"
},
{
"input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78",
"output": "73"
},
{
"input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80",
"output": "277"
},
{
"input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21",
"output": "154"
},
{
"input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17",
"output": "418"
},
{
"input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80",
"output": "74"
},
{
"input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9",
"output": "59"
},
{
"input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67",
"output": "100"
},
{
"input": "4\n8 7\n8 7\n7 8\n7 8",
"output": "8"
},
{
"input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1",
"output": "10"
},
{
"input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "72"
},
{
"input": "4\n1 2\n1 2\n2 1\n2 1",
"output": "8"
}
] | 1,674,096,830 | 2,147,483,647 | Python 3 | OK | TESTS | 31 | 92 | 0 | n=int(input())
q=[]
for _ in range (n):
q.append(list(map(int,input().split())))
k=0
a=q
for i in q:
for j in a:
if j!=i:
if i[0]==j[1]:
k+=1
print(k)
| Title: Games
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
Output Specification:
In a single line print the number of games where the host team is going to play in the guest uniform.
Demo Input:
['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n']
Demo Output:
['1\n', '5\n', '0\n']
Note:
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first). | ```python
n=int(input())
q=[]
for _ in range (n):
q.append(list(map(int,input().split())))
k=0
a=q
for i in q:
for j in a:
if j!=i:
if i[0]==j[1]:
k+=1
print(k)
``` | 3 |
|
884 | B | Japanese Crosswords Strike Back | PROGRAMMING | 1,100 | [
"implementation"
] | null | null | A one-dimensional Japanese crossword can be represented as a binary string of length *x*. An encoding of this crossword is an array *a* of size *n*, where *n* is the number of segments formed completely of 1's, and *a**i* is the length of *i*-th segment. No two segments touch or intersect.
For example:
- If *x*<==<=6 and the crossword is 111011, then its encoding is an array {3,<=2}; - If *x*<==<=8 and the crossword is 01101010, then its encoding is an array {2,<=1,<=1}; - If *x*<==<=5 and the crossword is 11111, then its encoding is an array {5}; - If *x*<==<=5 and the crossword is 00000, then its encoding is an empty array.
Mishka wants to create a new one-dimensional Japanese crossword. He has already picked the length and the encoding for this crossword. And now he needs to check if there is exactly one crossword such that its length and encoding are equal to the length and encoding he picked. Help him to check it! | The first line contains two integer numbers *n* and *x* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*x*<=≤<=109) — the number of elements in the encoding and the length of the crossword Mishka picked.
The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10000) — the encoding. | Print YES if there exists exaclty one crossword with chosen length and encoding. Otherwise, print NO. | [
"2 4\n1 3\n",
"3 10\n3 3 2\n",
"2 10\n1 3\n"
] | [
"NO\n",
"YES\n",
"NO\n"
] | none | 0 | [
{
"input": "2 4\n1 3",
"output": "NO"
},
{
"input": "3 10\n3 3 2",
"output": "YES"
},
{
"input": "2 10\n1 3",
"output": "NO"
},
{
"input": "1 1\n1",
"output": "YES"
},
{
"input": "1 10\n10",
"output": "YES"
},
{
"input": "1 10000\n10000",
"output": "YES"
},
{
"input": "10 1\n5 78 3 87 4 9 5 8 9 1235",
"output": "NO"
},
{
"input": "3 12\n3 3 3",
"output": "NO"
},
{
"input": "3 9\n2 2 2",
"output": "NO"
},
{
"input": "2 5\n1 1",
"output": "NO"
},
{
"input": "1 2\n1",
"output": "NO"
},
{
"input": "3 13\n3 3 3",
"output": "NO"
},
{
"input": "3 6\n1 1 1",
"output": "NO"
},
{
"input": "1 6\n5",
"output": "NO"
},
{
"input": "3 11\n3 3 2",
"output": "NO"
},
{
"input": "2 6\n1 3",
"output": "NO"
},
{
"input": "3 10\n2 2 2",
"output": "NO"
},
{
"input": "3 8\n2 1 1",
"output": "NO"
},
{
"input": "1 5\n2",
"output": "NO"
},
{
"input": "1 3\n1",
"output": "NO"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "NO"
},
{
"input": "2 10\n4 4",
"output": "NO"
},
{
"input": "2 8\n2 3",
"output": "NO"
},
{
"input": "2 4\n1 1",
"output": "NO"
},
{
"input": "3 10\n1 2 4",
"output": "NO"
},
{
"input": "3 10\n2 1 3",
"output": "NO"
},
{
"input": "2 6\n1 2",
"output": "NO"
},
{
"input": "3 4\n1 1 1",
"output": "NO"
},
{
"input": "3 11\n1 2 4",
"output": "NO"
},
{
"input": "3 12\n3 3 2",
"output": "NO"
},
{
"input": "4 9\n1 1 1 1",
"output": "NO"
},
{
"input": "1 10\n9",
"output": "NO"
},
{
"input": "1 7\n5",
"output": "NO"
},
{
"input": "2 5\n1 2",
"output": "NO"
},
{
"input": "3 8\n1 1 2",
"output": "NO"
},
{
"input": "3 7\n1 1 1",
"output": "NO"
},
{
"input": "1 10\n1",
"output": "NO"
},
{
"input": "3 10\n2 3 4",
"output": "NO"
},
{
"input": "3 9\n1 2 3",
"output": "NO"
},
{
"input": "3 9\n3 3 2",
"output": "NO"
},
{
"input": "3 6\n3 3 2",
"output": "NO"
},
{
"input": "1 1\n3",
"output": "NO"
},
{
"input": "1 3\n2",
"output": "NO"
},
{
"input": "3 10\n3 3 3",
"output": "NO"
},
{
"input": "3 5\n1 1 1",
"output": "YES"
},
{
"input": "2 1\n100 100",
"output": "NO"
},
{
"input": "3 3\n3 3 3",
"output": "NO"
},
{
"input": "4 17\n3 3 9 1",
"output": "NO"
},
{
"input": "4 1660\n1505 13 37 100",
"output": "NO"
},
{
"input": "3 5\n3 3 2",
"output": "NO"
},
{
"input": "4 10\n3 3 2 5",
"output": "NO"
},
{
"input": "5 5\n5 5 5 5 5",
"output": "NO"
},
{
"input": "1 1\n2",
"output": "NO"
},
{
"input": "5 10\n1 2 2 4 5",
"output": "NO"
},
{
"input": "2 1\n1 1",
"output": "NO"
}
] | 1,593,062,201 | 341 | PyPy 3 | OK | TESTS | 66 | 187 | 28,979,200 | import sys
import math
#import random
#sys.setrecursionlimit(1000000)
input = sys.stdin.readline
############ ---- USER DEFINED INPUT FUNCTIONS ---- ############
def inp():
return(int(input()))
def inara():
return(list(map(int,input().split())))
def insr():
s = input()
return(list(s[:len(s) - 1]))
def invr():
return(map(int,input().split()))
################################################################
############ ---- THE ACTUAL CODE STARTS BELOW ---- ############
n,x=invr()
ara=inara()
tot=n-1
for num in ara:
tot+=num
if tot==x:
print("YES")
else:
print("NO")
| Title: Japanese Crosswords Strike Back
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A one-dimensional Japanese crossword can be represented as a binary string of length *x*. An encoding of this crossword is an array *a* of size *n*, where *n* is the number of segments formed completely of 1's, and *a**i* is the length of *i*-th segment. No two segments touch or intersect.
For example:
- If *x*<==<=6 and the crossword is 111011, then its encoding is an array {3,<=2}; - If *x*<==<=8 and the crossword is 01101010, then its encoding is an array {2,<=1,<=1}; - If *x*<==<=5 and the crossword is 11111, then its encoding is an array {5}; - If *x*<==<=5 and the crossword is 00000, then its encoding is an empty array.
Mishka wants to create a new one-dimensional Japanese crossword. He has already picked the length and the encoding for this crossword. And now he needs to check if there is exactly one crossword such that its length and encoding are equal to the length and encoding he picked. Help him to check it!
Input Specification:
The first line contains two integer numbers *n* and *x* (1<=≤<=*n*<=≤<=100000, 1<=≤<=*x*<=≤<=109) — the number of elements in the encoding and the length of the crossword Mishka picked.
The second line contains *n* integer numbers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=10000) — the encoding.
Output Specification:
Print YES if there exists exaclty one crossword with chosen length and encoding. Otherwise, print NO.
Demo Input:
['2 4\n1 3\n', '3 10\n3 3 2\n', '2 10\n1 3\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none | ```python
import sys
import math
#import random
#sys.setrecursionlimit(1000000)
input = sys.stdin.readline
############ ---- USER DEFINED INPUT FUNCTIONS ---- ############
def inp():
return(int(input()))
def inara():
return(list(map(int,input().split())))
def insr():
s = input()
return(list(s[:len(s) - 1]))
def invr():
return(map(int,input().split()))
################################################################
############ ---- THE ACTUAL CODE STARTS BELOW ---- ############
n,x=invr()
ara=inara()
tot=n-1
for num in ara:
tot+=num
if tot==x:
print("YES")
else:
print("NO")
``` | 3 |
|
509 | A | Maximum in Table | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above. | The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table. | Print a single line containing a positive integer *m* — the maximum value in the table. | [
"1\n",
"5\n"
] | [
"1",
"70"
] | In the second test the rows of the table look as follows: | 0 | [
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,615,683,835 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 61 | 2,764,800 | from math import factorial
from typing import Callable, Iterator, TypeVar, cast
_F = TypeVar("_F", bound=Callable[[], None])
_I = TypeVar("_I", bound=Iterator[int])
def repeater(func: _F) -> _F:
def wrapper():
for _ in range(int(input())):
func()
return cast(_F, wrapper)
def get_num_input() -> _I:
return map(int, input().split())
# @repeater
def main() -> None:
limit: int = int(input())
print(factorial(limit * 2) // factorial(limit) ** 2)
if __name__ == "__main__":
main()
| Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows: | ```python
from math import factorial
from typing import Callable, Iterator, TypeVar, cast
_F = TypeVar("_F", bound=Callable[[], None])
_I = TypeVar("_I", bound=Iterator[int])
def repeater(func: _F) -> _F:
def wrapper():
for _ in range(int(input())):
func()
return cast(_F, wrapper)
def get_num_input() -> _I:
return map(int, input().split())
# @repeater
def main() -> None:
limit: int = int(input())
print(factorial(limit * 2) // factorial(limit) ** 2)
if __name__ == "__main__":
main()
``` | 0 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.