contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
43 | A | Football | PROGRAMMING | 1,000 | [
"strings"
] | A. Football | 2 | 256 | One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. | Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. | [
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] | [
"ABC\n",
"A\n"
] | none | 500 | [
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,600,793,031 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 280 | 409,600 | from collections import *
print(sorted(Counter([*open(0)][1:]).items(), key=lambda x: x[1])[::-1][0][0]) | Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none | ```python
from collections import *
print(sorted(Counter([*open(0)][1:]).items(), key=lambda x: x[1])[::-1][0][0])
``` | 3.929237 |
22 | A | Second Order Statistics | PROGRAMMING | 800 | [
"brute force"
] | A. Second Order Statistics | 2 | 256 | Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem. | The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value. | If the given sequence has the second order statistics, output this order statistics, otherwise output NO. | [
"4\n1 2 2 -4\n",
"5\n1 2 3 1 1\n"
] | [
"1\n",
"2\n"
] | none | 0 | [
{
"input": "4\n1 2 2 -4",
"output": "1"
},
{
"input": "5\n1 2 3 1 1",
"output": "2"
},
{
"input": "1\n28",
"output": "NO"
},
{
"input": "2\n-28 12",
"output": "12"
},
{
"input": "3\n-83 40 -80",
"output": "-80"
},
{
"input": "8\n93 77 -92 26 21 -48 53 91",
"output": "-48"
},
{
"input": "20\n-72 -9 -86 80 7 -10 40 -27 -94 92 96 56 28 -19 79 36 -3 -73 -63 -49",
"output": "-86"
},
{
"input": "49\n-74 -100 -80 23 -8 -83 -41 -20 48 17 46 -73 -55 67 85 4 40 -60 -69 -75 56 -74 -42 93 74 -95 64 -46 97 -47 55 0 -78 -34 -31 40 -63 -49 -76 48 21 -1 -49 -29 -98 -11 76 26 94",
"output": "-98"
},
{
"input": "88\n63 48 1 -53 -89 -49 64 -70 -49 71 -17 -16 76 81 -26 -50 67 -59 -56 97 2 100 14 18 -91 -80 42 92 -25 -88 59 8 -56 38 48 -71 -78 24 -14 48 -1 69 73 -76 54 16 -92 44 47 33 -34 -17 -81 21 -59 -61 53 26 10 -76 67 35 -29 70 65 -13 -29 81 80 32 74 -6 34 46 57 1 -45 -55 69 79 -58 11 -2 22 -18 -16 -89 -46",
"output": "-91"
},
{
"input": "100\n34 32 88 20 76 53 -71 -39 -98 -10 57 37 63 -3 -54 -64 -78 -82 73 20 -30 -4 22 75 51 -64 -91 29 -52 -48 83 19 18 -47 46 57 -44 95 89 89 -30 84 -83 67 58 -99 -90 -53 92 -60 -5 -56 -61 27 68 -48 52 -95 64 -48 -30 -67 66 89 14 -33 -31 -91 39 7 -94 -54 92 -96 -99 -83 -16 91 -28 -66 81 44 14 -85 -21 18 40 16 -13 -82 -33 47 -10 -40 -19 10 25 60 -34 -89",
"output": "-98"
},
{
"input": "2\n-1 -1",
"output": "NO"
},
{
"input": "3\n-2 -2 -2",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "10\n40 71 -85 -85 40 -85 -85 64 -85 47",
"output": "40"
},
{
"input": "23\n-90 -90 -41 -64 -64 -90 -15 10 -43 -90 -64 -64 89 -64 36 47 38 -90 -64 -90 -90 68 -90",
"output": "-64"
},
{
"input": "39\n-97 -93 -42 -93 -97 -93 56 -97 -97 -97 76 -33 -60 91 7 82 17 47 -97 -97 -93 73 -97 12 -97 -97 -97 -97 56 -92 -83 -93 -93 49 -93 -97 -97 -17 -93",
"output": "-93"
},
{
"input": "51\n-21 6 -35 -98 -86 -98 -86 -43 -65 32 -98 -40 96 -98 -98 -98 -98 -86 -86 -98 56 -86 -98 -98 -30 -98 -86 -31 -98 -86 -86 -86 -86 -30 96 -86 -86 -86 -60 25 88 -86 -86 58 31 -47 57 -86 37 44 -83",
"output": "-86"
},
{
"input": "66\n-14 -95 65 -95 -95 -97 -90 -71 -97 -97 70 -95 -95 -97 -95 -27 35 -87 -95 -5 -97 -97 87 34 -49 -95 -97 -95 -97 -95 -30 -95 -97 47 -95 -17 -97 -95 -97 -69 51 -97 -97 -95 -75 87 59 21 63 56 76 -91 98 -97 6 -97 -95 -95 -97 -73 11 -97 -35 -95 -95 -43",
"output": "-95"
},
{
"input": "77\n-67 -93 -93 -92 97 29 93 -93 -93 -5 -93 -7 60 -92 -93 44 -84 68 -92 -93 69 -92 -37 56 43 -93 35 -92 -93 19 -79 18 -92 -93 -93 -37 -93 -47 -93 -92 -92 74 67 19 40 -92 -92 -92 -92 -93 -93 -41 -93 -92 -93 -93 -92 -93 51 -80 6 -42 -92 -92 -66 -12 -92 -92 -3 93 -92 -49 -93 40 62 -92 -92",
"output": "-92"
},
{
"input": "89\n-98 40 16 -87 -98 63 -100 55 -96 -98 -21 -100 -93 26 -98 -98 -100 -89 -98 -5 -65 -28 -100 -6 -66 67 -100 -98 -98 10 -98 -98 -70 7 -98 2 -100 -100 -98 25 -100 -100 -98 23 -68 -100 -98 3 98 -100 -98 -98 -98 -98 -24 -100 -100 -9 -98 35 -100 99 -5 -98 -100 -100 37 -100 -84 57 -98 40 -47 -100 -1 -92 -76 -98 -98 -100 -100 -100 -63 30 21 -100 -100 -100 -12",
"output": "-98"
},
{
"input": "99\n10 -84 -100 -100 73 -64 -100 -94 33 -100 -100 -100 -100 71 64 24 7 -100 -32 -100 -100 77 -100 62 -12 55 45 -100 -100 -80 -100 -100 -100 -100 -100 -100 -100 -100 -100 -39 -48 -100 -34 47 -100 -100 -100 -100 -100 -77 -100 -100 -100 -100 -100 -100 -52 40 -55 -100 -44 -100 72 33 70 -100 -100 -78 -100 -3 100 -77 22 -100 95 -30 -100 10 -69 -100 -100 -100 -100 52 -39 -100 -100 -100 7 -100 -98 -66 95 -17 -100 52 -100 68 -100",
"output": "-98"
},
{
"input": "100\n-99 -98 -64 89 53 57 -99 29 -78 18 -3 -54 76 -98 -99 -98 37 -98 19 -47 89 73 -98 -91 -99 -99 -98 -48 -99 22 -99 -98 -99 -99 -98 -60 84 67 -99 -98 20 -98 88 -98 46 -98 -99 -98 -99 -71 -99 -98 -98 -39 83 95 -98 63 -98 -99 32 -98 -99 -64 57 -30 -53 -83 -4 -99 58 20 -98 -10 -99 -44 -99 -99 -99 -99 75 34 -98 -52 -98 -30 -98 -99 -98 -98 51 -99 -99 -99 -98 -99 -99 -82 -90 92",
"output": "-98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "9\n99 99 99 99 100 100 100 100 100",
"output": "100"
},
{
"input": "5\n-100 -100 -100 -100 -100",
"output": "NO"
}
] | 1,587,764,897 | 2,147,483,647 | Python 3 | OK | TESTS | 31 | 218 | 0 | n=int(input())
l=list(map(int,input().split()))
s=list(set(l))
s.sort()
if len(s)>=2:
print(s[1])
else:
print("NO")
| Title: Second Order Statistics
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
Output Specification:
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
Demo Input:
['4\n1 2 2 -4\n', '5\n1 2 3 1 1\n']
Demo Output:
['1\n', '2\n']
Note:
none | ```python
n=int(input())
l=list(map(int,input().split()))
s=list(set(l))
s.sort()
if len(s)>=2:
print(s[1])
else:
print("NO")
``` | 3.9455 |
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,663,696,838 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | t = int(input("Enter here: "))
x =0
y =0
z =0
for i in range(t):#You can also take t as an input here directly
a = list(map(int, input().split()))
x += a[0]
y += a[1]
z += a[2]
if x == 0 and y ==0 and z == 0:
print("YES")
else:
print("NO")
| Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
t = int(input("Enter here: "))
x =0
y =0
z =0
for i in range(t):#You can also take t as an input here directly
a = list(map(int, input().split()))
x += a[0]
y += a[1]
z += a[2]
if x == 0 and y ==0 and z == 0:
print("YES")
else:
print("NO")
``` | 0 |
825 | B | Five-In-a-Row | PROGRAMMING | 1,600 | [
"brute force",
"implementation"
] | null | null | Alice and Bob play 5-in-a-row game. They have a playing field of size 10<=×<=10. In turns they put either crosses or noughts, one at a time. Alice puts crosses and Bob puts noughts.
In current match they have made some turns and now it's Alice's turn. She wonders if she can put cross in such empty cell that she wins immediately.
Alice wins if some crosses in the field form line of length not smaller than 5. This line can be horizontal, vertical and diagonal. | You are given matrix 10<=×<=10 (10 lines of 10 characters each) with capital Latin letters 'X' being a cross, letters 'O' being a nought and '.' being an empty cell. The number of 'X' cells is equal to the number of 'O' cells and there is at least one of each type. There is at least one empty cell.
It is guaranteed that in the current arrangement nobody has still won. | Print 'YES' if it's possible for Alice to win in one turn by putting cross in some empty cell. Otherwise print 'NO'. | [
"XX.XX.....\n.....OOOO.\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n",
"XXOXX.....\nOO.O......\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n"
] | [
"YES\n",
"NO\n"
] | none | 0 | [
{
"input": "O.......O.\n.....O.X..\n......O...\n....X.O...\n.O.O.....X\n.XO.....XX\n...X...X.O\n........O.\n........O.\n.X.X.....X",
"output": "NO"
},
{
"input": "....OX....\n..........\n.O..X...X.\nXXO..XO..O\nO.......X.\n...XX.....\n..O.O...OX\n.........X\n.....X..OO\n........O.",
"output": "NO"
},
{
"input": "..O..X.X..\n.O..X...O.\n........O.\n...O..O...\nX.XX....X.\n..O....O.X\n..X.X....O\n......X..X\nO.........\n..X.O...OO",
"output": "NO"
},
{
"input": "..........\n..........\n..........\n..........\n..........\nX.........\n.........X\n..........\n..O.......\n.O...X...O",
"output": "NO"
},
{
"input": ".OXXOOOXXO\nXOX.O.X.O.\nXX.X...OXX\nOOOX......\nX.OX.X.O..\nX.O...O.O.\n.OXOXOO...\nOO.XOOX...\nO..XX...XX\nXX.OXXOOXO",
"output": "YES"
},
{
"input": ".OX.XX.OOO\n..OXXOXOO.\nX..XXXOO.X\nXOX.O.OXOX\nO.O.X.XX.O\nOXXXOXXOXX\nO.OOO...XO\nO.X....OXX\nXO...XXO.O\nXOX.OOO.OX",
"output": "YES"
},
{
"input": "....X.....\n...X......\n..........\n.X........\nX.........\n..........\n..........\n..........\n..........\n......OOOO",
"output": "YES"
},
{
"input": "..........\n..........\n..........\n..........\n..........\n....X.....\n...X.....O\n.........O\n.X.......O\nX........O",
"output": "YES"
},
{
"input": "OOOO......\n..........\n..........\n..........\n..........\n..........\n......X...\n.......X..\n........X.\n.........X",
"output": "YES"
},
{
"input": "..........\n..........\n..........\n..........\n..........\n..........\n......X...\nOOOO...X..\n........X.\n.........X",
"output": "YES"
},
{
"input": "..........\n.........X\n........X.\n.......X..\n......X...\n..........\n..........\n..........\n..........\n......OOOO",
"output": "YES"
},
{
"input": "..........\n......OOO.\n..........\n..........\n..........\n.....O....\n......X...\n.......X..\n........X.\n.........X",
"output": "NO"
},
{
"input": ".........X\n........X.\n.......X..\n......X...\n..........\n..........\n..........\n..........\n..........\n......OOOO",
"output": "YES"
},
{
"input": "..........\n..........\n..........\n.....X....\n....X.....\n...X......\n.........O\n.X.......O\n.........O\n.........O",
"output": "YES"
},
{
"input": ".X........\n..........\n...X......\n....X.....\n.....X....\n..........\n..........\n..........\n..........\n......OOOO",
"output": "YES"
},
{
"input": "O.........\nOO........\nOOO.......\nOOO.......\n..........\n......O.OO\n.....OXXXX\n.....OXXXX\n.....OXXXX\n.....OXXXX",
"output": "YES"
},
{
"input": ".XX.....X.\n.X...O.X..\n.O........\n.....X....\n.X..XO.O..\n.X........\n.X.......O\n.........O\n..O.......\n..O....O.O",
"output": "YES"
},
{
"input": ".........X\n........X.\n.......X..\n..........\n.....X....\n..........\n..........\n..........\n..........\n......OOOO",
"output": "YES"
},
{
"input": "..........\n.....OOOO.\n..........\n..........\n..........\n..........\n.........X\n.........X\n.........X\n.........X",
"output": "YES"
},
{
"input": "..........\n.....OOOO.\n..........\n..........\n..........\n..........\n......X...\n.......X..\n........X.\n.........X",
"output": "YES"
},
{
"input": ".XX.....X.\n.X...O.X.X\n.O........\n.....X....\n.X..XO.O..\n.X........\n.X.......O\nO........O\n..O.......\n..O....O.O",
"output": "YES"
},
{
"input": "..........\n..........\n..........\n..........\n..........\n..O......X\n..O......X\n..O.......\n..O......X\n.........X",
"output": "YES"
},
{
"input": "..........\n..........\n..O.......\n...O......\n....O.....\n.....O....\n......X...\n.......X..\n........X.\n.........X",
"output": "NO"
},
{
"input": "OOO...O...\n.X...X.O..\n...O.XXX.O\n.O..XOX.X.\n..O.XXX.O.\n..X.OO.O..\n.OOXXOXXO.\n.OOX.OX.X.\n.XXX....XX\n.OO...OXO.",
"output": "YES"
},
{
"input": "..........\n.........O\n.........O\n.........O\n.........O\n..........\n.........X\n.........X\n.........X\n.........X",
"output": "YES"
},
{
"input": ".....OXXXX\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n......OOO.",
"output": "NO"
},
{
"input": "..........\n.....OOOO.\n.......OO.\n..........\n..........\n..........\n..........\n.......X..\n........X.\n......XXXX",
"output": "YES"
},
{
"input": "X.XX..XXXX\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n..........\nOOO.O.O.OO",
"output": "YES"
},
{
"input": ".....OXXXX\n..........\n..........\n..........\n..........\n.....O....\nOOO...X...\nOOOO...X..\n........X.\n....X....X",
"output": "NO"
},
{
"input": "..........\n.....OOOO.\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n......XXXX",
"output": "YES"
},
{
"input": "..........\n.....OOOO.\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n...X.X.X.X",
"output": "NO"
},
{
"input": ".....O....\n....X..O.O\n...X.....O\n..X.......\n.X.......O\n..........\n..........\n..........\n..........\n.........X",
"output": "YES"
},
{
"input": "....X.....\n...X......\n..X.......\n.X........\n..........\n..........\n..........\n..........\n..........\n......OOOO",
"output": "YES"
},
{
"input": ".......XXX\nX.........\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n......OOOO",
"output": "NO"
}
] | 1,671,948,841 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 15 | 0 | a=[]
jauap='NO'
v=''
d=''
for i in range(10):
s=input()
if 'X' in s and len(s[s.index('X'):s.rindex('X')])>=5 and s[s.index('X'):s.rindex('X')].count('O')==0:
jauap='YES'
exit()
a.append(s)
for i in range(10):
for j in range(10):
if j==0:
v+=a[i][j]
if i==j:
d+=a[i][j]
if 'X' in v and len(v[v.index('X'):v.rindex('X')])>=5 and v[v.index('X'):v.rindex('X')].count('O')==0:
jauap='YES'
if 'X' in d and len(d[d.index('X'):d.rindex('X')])>=5 and d[d.index('X'):d.rindex('X')].count('O')==0:
jauap='YES'
print(jauap) | Title: Five-In-a-Row
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice and Bob play 5-in-a-row game. They have a playing field of size 10<=×<=10. In turns they put either crosses or noughts, one at a time. Alice puts crosses and Bob puts noughts.
In current match they have made some turns and now it's Alice's turn. She wonders if she can put cross in such empty cell that she wins immediately.
Alice wins if some crosses in the field form line of length not smaller than 5. This line can be horizontal, vertical and diagonal.
Input Specification:
You are given matrix 10<=×<=10 (10 lines of 10 characters each) with capital Latin letters 'X' being a cross, letters 'O' being a nought and '.' being an empty cell. The number of 'X' cells is equal to the number of 'O' cells and there is at least one of each type. There is at least one empty cell.
It is guaranteed that in the current arrangement nobody has still won.
Output Specification:
Print 'YES' if it's possible for Alice to win in one turn by putting cross in some empty cell. Otherwise print 'NO'.
Demo Input:
['XX.XX.....\n.....OOOO.\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n', 'XXOXX.....\nOO.O......\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n..........\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
a=[]
jauap='NO'
v=''
d=''
for i in range(10):
s=input()
if 'X' in s and len(s[s.index('X'):s.rindex('X')])>=5 and s[s.index('X'):s.rindex('X')].count('O')==0:
jauap='YES'
exit()
a.append(s)
for i in range(10):
for j in range(10):
if j==0:
v+=a[i][j]
if i==j:
d+=a[i][j]
if 'X' in v and len(v[v.index('X'):v.rindex('X')])>=5 and v[v.index('X'):v.rindex('X')].count('O')==0:
jauap='YES'
if 'X' in d and len(d[d.index('X'):d.rindex('X')])>=5 and d[d.index('X'):d.rindex('X')].count('O')==0:
jauap='YES'
print(jauap)
``` | 0 |
|
742 | A | Arpa’s hard exam and Mehrdad’s naive cheat | PROGRAMMING | 1,000 | [
"implementation",
"math",
"number theory"
] | null | null | There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat. | The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109). | Print single integer — the last digit of 1378*n*. | [
"1\n",
"2\n"
] | [
"8",
"4"
] | In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4. | 500 | [
{
"input": "1",
"output": "8"
},
{
"input": "2",
"output": "4"
},
{
"input": "1000",
"output": "6"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "6"
},
{
"input": "1000000000",
"output": "6"
},
{
"input": "5",
"output": "8"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "2"
},
{
"input": "1378",
"output": "4"
},
{
"input": "13781378",
"output": "4"
},
{
"input": "51202278",
"output": "4"
},
{
"input": "999999998",
"output": "4"
},
{
"input": "999999997",
"output": "8"
},
{
"input": "12193721",
"output": "8"
},
{
"input": "0",
"output": "1"
},
{
"input": "989898989",
"output": "8"
},
{
"input": "7",
"output": "2"
},
{
"input": "8",
"output": "6"
},
{
"input": "9",
"output": "8"
},
{
"input": "10",
"output": "4"
},
{
"input": "11",
"output": "2"
},
{
"input": "12",
"output": "6"
},
{
"input": "13",
"output": "8"
},
{
"input": "14",
"output": "4"
},
{
"input": "15",
"output": "2"
},
{
"input": "16",
"output": "6"
},
{
"input": "999999996",
"output": "6"
},
{
"input": "999999995",
"output": "2"
},
{
"input": "999999994",
"output": "4"
}
] | 1,666,302,046 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 1,000 | 25,088,000 | print((1378**(int(input())))%10) | Title: Arpa’s hard exam and Mehrdad’s naive cheat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
Input Specification:
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
Output Specification:
Print single integer — the last digit of 1378*n*.
Demo Input:
['1\n', '2\n']
Demo Output:
['8', '4']
Note:
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4. | ```python
print((1378**(int(input())))%10)
``` | 0 |
|
908 | A | New Year and Counting Cards | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true. | The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit. | Print a single integer, the minimum number of cards you must turn over to verify your claim. | [
"ee\n",
"z\n",
"0ay1\n"
] | [
"2\n",
"0\n",
"2\n"
] | In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards. | 500 | [
{
"input": "ee",
"output": "2"
},
{
"input": "z",
"output": "0"
},
{
"input": "0ay1",
"output": "2"
},
{
"input": "0abcdefghijklmnopqrstuvwxyz1234567896",
"output": "10"
},
{
"input": "0a0a9e9e2i2i9o9o6u6u9z9z4x4x9b9b",
"output": "18"
},
{
"input": "01234567890123456789012345678901234567890123456789",
"output": "25"
},
{
"input": "qwertyuioplkjhgfdsazxcvbnmqwertyuioplkjhgfdsazxcvb",
"output": "10"
},
{
"input": "cjw2dwmr10pku4yxohe0wglktd",
"output": "4"
},
{
"input": "6z2tx805jie8cfybwtfqvmlveec3iak5z5u3lu62vbxyqht6",
"output": "13"
},
{
"input": "kaq7jyialrfp4ilkni90eq8v3amcbygon7py0hb8z26fbl8ss1",
"output": "13"
},
{
"input": "hpwn50zgbmct80k9rizjqg40nycgs0acwikjqt11nr6m61krfs",
"output": "8"
},
{
"input": "l3rw91a4m25l8iytxyeuixsegzcbm4h41ornf3pixkrmwznrzc",
"output": "14"
},
{
"input": "2222",
"output": "0"
},
{
"input": "13579",
"output": "5"
},
{
"input": "1",
"output": "1"
},
{
"input": "0",
"output": "0"
},
{
"input": "a",
"output": "1"
},
{
"input": "y",
"output": "0"
},
{
"input": "w",
"output": "0"
},
{
"input": "oo",
"output": "2"
},
{
"input": "oy",
"output": "1"
},
{
"input": "yo",
"output": "1"
},
{
"input": "yy",
"output": "0"
},
{
"input": "a0",
"output": "1"
},
{
"input": "a9",
"output": "2"
},
{
"input": "y0",
"output": "0"
},
{
"input": "y7",
"output": "1"
},
{
"input": "0a",
"output": "1"
},
{
"input": "3a",
"output": "2"
},
{
"input": "06",
"output": "0"
},
{
"input": "07",
"output": "1"
},
{
"input": "70",
"output": "1"
},
{
"input": "77",
"output": "2"
},
{
"input": "13570",
"output": "4"
},
{
"input": "0000000000011111",
"output": "5"
},
{
"input": "1357",
"output": "4"
},
{
"input": "uuuuuuuuuuuuuuuuuu",
"output": "18"
},
{
"input": "gabieurat",
"output": "5"
}
] | 1,638,274,519 | 2,147,483,647 | Python 3 | OK | TESTS | 38 | 46 | 0 | s = input()
vowels = ['a', 'e', 'i', 'o', 'u']
cards_to_turn = 0
for w in s:
if (w in vowels): cards_to_turn += 1
elif (w.isnumeric() and int(w) % 2 != 0): cards_to_turn += 1
print(cards_to_turn)
| Title: New Year and Counting Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
Input Specification:
The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
Output Specification:
Print a single integer, the minimum number of cards you must turn over to verify your claim.
Demo Input:
['ee\n', 'z\n', '0ay1\n']
Demo Output:
['2\n', '0\n', '2\n']
Note:
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards. | ```python
s = input()
vowels = ['a', 'e', 'i', 'o', 'u']
cards_to_turn = 0
for w in s:
if (w in vowels): cards_to_turn += 1
elif (w.isnumeric() and int(w) % 2 != 0): cards_to_turn += 1
print(cards_to_turn)
``` | 3 |
|
122 | A | Lucky Division | PROGRAMMING | 1,000 | [
"brute force",
"number theory"
] | null | null | Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky. | The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked. | In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes). | [
"47\n",
"16\n",
"78\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4. | 500 | [
{
"input": "47",
"output": "YES"
},
{
"input": "16",
"output": "YES"
},
{
"input": "78",
"output": "NO"
},
{
"input": "48",
"output": "YES"
},
{
"input": "100",
"output": "YES"
},
{
"input": "107",
"output": "NO"
},
{
"input": "77",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "480",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "3",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "49",
"output": "YES"
},
{
"input": "56",
"output": "YES"
},
{
"input": "124",
"output": "YES"
},
{
"input": "1000",
"output": "YES"
},
{
"input": "999",
"output": "NO"
},
{
"input": "298",
"output": "NO"
},
{
"input": "274",
"output": "NO"
},
{
"input": "998",
"output": "NO"
},
{
"input": "42",
"output": "YES"
},
{
"input": "788",
"output": "YES"
},
{
"input": "70",
"output": "YES"
},
{
"input": "444",
"output": "YES"
},
{
"input": "777",
"output": "YES"
},
{
"input": "799",
"output": "YES"
},
{
"input": "25",
"output": "NO"
},
{
"input": "882",
"output": "YES"
},
{
"input": "88",
"output": "YES"
},
{
"input": "11",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "7",
"output": "YES"
},
{
"input": "8",
"output": "YES"
},
{
"input": "94",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "141",
"output": "YES"
}
] | 1,693,201,434 | 2,147,483,647 | Python 3 | OK | TESTS | 36 | 92 | 0 | def is_lucky(number):
# Function to check if a number is lucky (contains only 4 and 7)
while number > 0:
digit = number % 10
if digit != 4 and digit != 7:
return False
number //= 10
return True
def is_almost_lucky(n):
# Function to check if a number is almost lucky
for i in range(1, n + 1):
if n % i == 0 and (is_lucky(i) or is_lucky(n // i)):
return True
return False
# Read the input
n = int(input())
# Check if n is almost lucky and print the result
if is_almost_lucky(n):
print("YES")
else:
print("NO")
| Title: Lucky Division
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
Output Specification:
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
Demo Input:
['47\n', '16\n', '78\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4. | ```python
def is_lucky(number):
# Function to check if a number is lucky (contains only 4 and 7)
while number > 0:
digit = number % 10
if digit != 4 and digit != 7:
return False
number //= 10
return True
def is_almost_lucky(n):
# Function to check if a number is almost lucky
for i in range(1, n + 1):
if n % i == 0 and (is_lucky(i) or is_lucky(n // i)):
return True
return False
# Read the input
n = int(input())
# Check if n is almost lucky and print the result
if is_almost_lucky(n):
print("YES")
else:
print("NO")
``` | 3 |
|
776 | B | Sherlock and his girlfriend | PROGRAMMING | 1,200 | [
"constructive algorithms",
"number theory"
] | null | null | Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task. | The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces. | The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them. | [
"3\n",
"4\n"
] | [
"2\n1 1 2 ",
"2\n2 1 1 2\n"
] | In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct. | 1,000 | [
{
"input": "3",
"output": "2\n1 1 2 "
},
{
"input": "4",
"output": "2\n1 1 2 1 "
},
{
"input": "17",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 "
},
{
"input": "25",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 "
},
{
"input": "85",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 "
},
{
"input": "105",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 "
},
{
"input": "123",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "452",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "641",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "293",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "733",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "10",
"output": "2\n1 1 2 1 2 1 2 2 2 1 "
},
{
"input": "287",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3202",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "728",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3509",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "5137",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2023",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "4890",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "8507",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1796",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "3466",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1098",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11226",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11731",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11644",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "14553",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "17307",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "23189",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "6818",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1054",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "28163",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "30885",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "27673",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "11656",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "36325",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "31205",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29958",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "1696",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "44907",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "13736",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "29594",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "19283",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "15346",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "41794",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99998",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "100000",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
},
{
"input": "99971",
"output": "2\n1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 2 2 1 2 2 2 2 ..."
}
] | 1,673,028,060 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | n = int(input())
# Initialize an array to store the colors of the jewelry
colors = [0] * (n + 1)
# Color for each prime number
color = 1
# Loop through the jewelry prices
for i in range(2, n + 1):
# If the jewelry price is prime, assign a new color
if colors[i] == 0:
colors[i] = color
color += 1
# For all other jewelry, assign the smallest unused color
j = 2
while i * j <= n:
if colors[i * j] == 0:
colors[i * j] = colors[i]
j += 1
# Print the minimum number of colors used
print(color - 1)
# Print the colors of the jewelry in increasing order of price
for i in range(2, n + 1):
print(colors[i])
| Title: Sherlock and his girlfriend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sherlock has a new girlfriend (so unlike him!). Valentine's day is coming and he wants to gift her some jewelry.
He bought *n* pieces of jewelry. The *i*-th piece has price equal to *i*<=+<=1, that is, the prices of the jewelry are 2,<=3,<=4,<=... *n*<=+<=1.
Watson gave Sherlock a challenge to color these jewelry pieces such that two pieces don't have the same color if the price of one piece is a prime divisor of the price of the other piece. Also, Watson asked him to minimize the number of different colors used.
Help Sherlock complete this trivial task.
Input Specification:
The only line contains single integer *n* (1<=≤<=*n*<=≤<=100000) — the number of jewelry pieces.
Output Specification:
The first line of output should contain a single integer *k*, the minimum number of colors that can be used to color the pieces of jewelry with the given constraints.
The next line should consist of *n* space-separated integers (between 1 and *k*) that specify the color of each piece in the order of increasing price.
If there are multiple ways to color the pieces using *k* colors, you can output any of them.
Demo Input:
['3\n', '4\n']
Demo Output:
['2\n1 1 2 ', '2\n2 1 1 2\n']
Note:
In the first input, the colors for first, second and third pieces of jewelry having respective prices 2, 3 and 4 are 1, 1 and 2 respectively.
In this case, as 2 is a prime divisor of 4, colors of jewelry having prices 2 and 4 must be distinct. | ```python
n = int(input())
# Initialize an array to store the colors of the jewelry
colors = [0] * (n + 1)
# Color for each prime number
color = 1
# Loop through the jewelry prices
for i in range(2, n + 1):
# If the jewelry price is prime, assign a new color
if colors[i] == 0:
colors[i] = color
color += 1
# For all other jewelry, assign the smallest unused color
j = 2
while i * j <= n:
if colors[i * j] == 0:
colors[i * j] = colors[i]
j += 1
# Print the minimum number of colors used
print(color - 1)
# Print the colors of the jewelry in increasing order of price
for i in range(2, n + 1):
print(colors[i])
``` | 0 |
|
822 | A | I'm bored with life | PROGRAMMING | 800 | [
"implementation",
"math",
"number theory"
] | null | null | Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you? | The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12). | Print a single integer denoting the greatest common divisor of integers *A*! and *B*!. | [
"4 3\n"
] | [
"6\n"
] | Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6. | 500 | [
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,632,210,310 | 2,147,483,647 | PyPy 3 | OK | TESTS | 59 | 93 | 20,172,800 | import math
u,i=map(int,input().split())
e=min(u,i)
print(math.factorial(e)) | Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6. | ```python
import math
u,i=map(int,input().split())
e=min(u,i)
print(math.factorial(e))
``` | 3 |
|
523 | A | Rotate, Flip and Zoom | PROGRAMMING | 1,200 | [
"*special",
"implementation"
] | null | null | Polycarp is writing the prototype of a graphic editor. He has already made up his mind that the basic image transformations in his editor will be: rotate the image 90 degrees clockwise, flip the image horizontally (symmetry relative to the vertical line, that is, the right part of the image moves to the left, and vice versa) and zooming on the image. He is sure that that there is a large number of transformations that can be expressed through these three.
He has recently stopped implementing all three transformations for monochrome images. To test this feature, he asked you to write a code that will consecutively perform three actions with a monochrome image: first it will rotate the image 90 degrees clockwise, then it will flip the image horizontally and finally, it will zoom in twice on the image (that is, it will double all the linear sizes).
Implement this feature to help Polycarp test his editor. | The first line contains two integers, *w* and *h* (1<=≤<=*w*,<=*h*<=≤<=100) — the width and height of an image in pixels. The picture is given in *h* lines, each line contains *w* characters — each character encodes the color of the corresponding pixel of the image. The line consists only of characters "." and "*", as the image is monochrome. | Print 2*w* lines, each containing 2*h* characters — the result of consecutive implementing of the three transformations, described above. | [
"3 2\n.*.\n.*.\n",
"9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*\n"
] | [
"....\n....\n****\n****\n....\n....\n",
"********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......******************..**********....\n......******************..**********....\n........****************....**********..\n........****************....**********..\n............************......**********\n............************......**********\n"
] | none | 500 | [
{
"input": "3 2\n.*.\n.*.",
"output": "....\n....\n****\n****\n....\n...."
},
{
"input": "9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*",
"output": "********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......*..."
},
{
"input": "1 100\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "........................................................................................................................................................................................................\n........................................................................................................................................................................................................"
},
{
"input": "1 100\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*",
"output": "********************************************************************************************************************************************************************************************************\n********************************************************************************************************************************************************************************************************"
},
{
"input": "1 100\n.\n*\n.\n.\n.\n*\n.\n.\n.\n*\n*\n*\n.\n.\n.\n.\n.\n.\n*\n.\n.\n.\n*\n.\n*\n.\n.\n*\n*\n.\n*\n.\n.\n*\n.\n.\n*\n*\n.\n.\n.\n.\n.\n*\n.\n*\n.\n*\n.\n.\n.\n.\n*\n*\n*\n.\n.\n.\n.\n*\n.\n.\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n*\n*\n*\n*\n*\n*\n*\n.\n.\n*\n.\n.\n*\n*\n.",
"output": "..**......**......******............**......**..**....****..**....**....****..........**..**..**........******........**....********..**********..********************....**************....**....****..\n..**......**......******............**......**..**....****..**....**....****..........**..**..**........******........**....********..**********..********************....**************....**....****.."
},
{
"input": "100 1\n****************************************************************************************************",
"output": "**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n..."
},
{
"input": "100 1\n*...***.....**.*...*.*.**.************.**..**.*..**..**.*.**...***.*...*.*..*.*.*......**..*..*...**",
"output": "**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n**\n**\n**\n**\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n..\n..\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n**\n**\n**\n**\n..\n..\n**\n**\n..\n..\n**\n**\n**\n**\n..\n..\n..\n..\n..\n..\n**\n**\n..."
},
{
"input": "1 1\n.",
"output": "..\n.."
},
{
"input": "1 1\n*",
"output": "**\n**"
},
{
"input": "2 2\n.*\n*.",
"output": "..**\n..**\n**..\n**.."
},
{
"input": "1 2\n*\n.",
"output": "**..\n**.."
},
{
"input": "2 1\n*.",
"output": "**\n**\n..\n.."
}
] | 1,654,176,471 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | m,n=map(int,raw_input().split())
for v in zip(*[raw_input() for _ in range(n)]):
s=''.join(c*2 for c in v)
print s
print s | Title: Rotate, Flip and Zoom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is writing the prototype of a graphic editor. He has already made up his mind that the basic image transformations in his editor will be: rotate the image 90 degrees clockwise, flip the image horizontally (symmetry relative to the vertical line, that is, the right part of the image moves to the left, and vice versa) and zooming on the image. He is sure that that there is a large number of transformations that can be expressed through these three.
He has recently stopped implementing all three transformations for monochrome images. To test this feature, he asked you to write a code that will consecutively perform three actions with a monochrome image: first it will rotate the image 90 degrees clockwise, then it will flip the image horizontally and finally, it will zoom in twice on the image (that is, it will double all the linear sizes).
Implement this feature to help Polycarp test his editor.
Input Specification:
The first line contains two integers, *w* and *h* (1<=≤<=*w*,<=*h*<=≤<=100) — the width and height of an image in pixels. The picture is given in *h* lines, each line contains *w* characters — each character encodes the color of the corresponding pixel of the image. The line consists only of characters "." and "*", as the image is monochrome.
Output Specification:
Print 2*w* lines, each containing 2*h* characters — the result of consecutive implementing of the three transformations, described above.
Demo Input:
['3 2\n.*.\n.*.\n', '9 20\n**.......\n****.....\n******...\n*******..\n..******.\n....****.\n......***\n*.....***\n*********\n*********\n*********\n*********\n....**...\n...****..\n..******.\n.********\n****..***\n***...***\n**.....**\n*.......*\n']
Demo Output:
['....\n....\n****\n****\n....\n....\n', '********......**********........********\n********......**********........********\n********........********......********..\n********........********......********..\n..********......********....********....\n..********......********....********....\n..********......********..********......\n..********......********..********......\n....********....****************........\n....********....****************........\n....********....****************........\n....********....****************........\n......******************..**********....\n......******************..**********....\n........****************....**********..\n........****************....**********..\n............************......**********\n............************......**********\n']
Note:
none | ```python
m,n=map(int,raw_input().split())
for v in zip(*[raw_input() for _ in range(n)]):
s=''.join(c*2 for c in v)
print s
print s
``` | -1 |
|
35 | C | Fire Again | PROGRAMMING | 1,500 | [
"brute force",
"dfs and similar",
"shortest paths"
] | C. Fire Again | 2 | 64 | After a terrifying forest fire in Berland a forest rebirth program was carried out. Due to it *N* rows with *M* trees each were planted and the rows were so neat that one could map it on a system of coordinates so that the *j*-th tree in the *i*-th row would have the coordinates of (*i*,<=*j*). However a terrible thing happened and the young forest caught fire. Now we must find the coordinates of the tree that will catch fire last to plan evacuation.
The burning began in *K* points simultaneously, which means that initially *K* trees started to burn. Every minute the fire gets from the burning trees to the ones that aren’t burning and that the distance from them to the nearest burning tree equals to 1.
Find the tree that will be the last to start burning. If there are several such trees, output any. | The first input line contains two integers *N*,<=*M* (1<=≤<=*N*,<=*M*<=≤<=2000) — the size of the forest. The trees were planted in all points of the (*x*,<=*y*) (1<=≤<=*x*<=≤<=*N*,<=1<=≤<=*y*<=≤<=*M*) type, *x* and *y* are integers.
The second line contains an integer *K* (1<=≤<=*K*<=≤<=10) — amount of trees, burning in the beginning.
The third line contains *K* pairs of integers: *x*1,<=*y*1,<=*x*2,<=*y*2,<=...,<=*x**k*,<=*y**k* (1<=≤<=*x**i*<=≤<=*N*,<=1<=≤<=*y**i*<=≤<=*M*) — coordinates of the points from which the fire started. It is guaranteed that no two points coincide. | Output a line with two space-separated integers *x* and *y* — coordinates of the tree that will be the last one to start burning. If there are several such trees, output any. | [
"3 3\n1\n2 2\n",
"3 3\n1\n1 1\n",
"3 3\n2\n1 1 3 3\n"
] | [
"1 1\n",
"3 3\n",
"2 2"
] | none | 1,500 | [
{
"input": "3 3\n1\n2 2",
"output": "1 1"
},
{
"input": "3 3\n1\n1 1",
"output": "3 3"
},
{
"input": "3 3\n2\n1 1 3 3",
"output": "1 3"
},
{
"input": "1 1\n1\n1 1",
"output": "1 1"
},
{
"input": "2 2\n1\n2 2",
"output": "1 1"
},
{
"input": "2 2\n2\n1 1 2 1",
"output": "1 2"
},
{
"input": "2 2\n3\n1 2 2 1 1 1",
"output": "2 2"
},
{
"input": "2 2\n4\n2 1 2 2 1 1 1 2",
"output": "1 1"
},
{
"input": "10 10\n1\n5 5",
"output": "10 10"
},
{
"input": "10 10\n2\n7 8 1 9",
"output": "3 1"
},
{
"input": "10 10\n3\n3 9 6 3 3 5",
"output": "10 7"
},
{
"input": "10 10\n4\n5 3 4 7 7 5 8 5",
"output": "10 10"
},
{
"input": "10 10\n5\n2 7 10 6 5 3 9 5 2 9",
"output": "1 1"
},
{
"input": "10 10\n6\n5 1 4 6 3 9 9 9 5 7 7 2",
"output": "1 3"
},
{
"input": "10 10\n7\n5 8 4 6 4 1 6 2 1 10 3 2 7 10",
"output": "10 5"
},
{
"input": "10 10\n8\n9 4 9 10 5 8 6 5 1 3 2 5 10 6 2 1",
"output": "1 10"
},
{
"input": "10 10\n9\n10 1 10 4 8 4 6 6 1 9 10 10 7 7 6 5 7 10",
"output": "1 1"
},
{
"input": "10 10\n10\n7 2 1 9 5 8 6 10 9 4 10 8 6 8 8 7 4 1 9 5",
"output": "1 3"
},
{
"input": "100 100\n1\n44 3",
"output": "100 100"
},
{
"input": "100 100\n2\n79 84 76 63",
"output": "1 1"
},
{
"input": "100 100\n3\n89 93 99 32 32 82",
"output": "1 1"
},
{
"input": "100 100\n4\n72 12 1 66 57 67 25 67",
"output": "100 100"
},
{
"input": "100 100\n5\n22 41 82 16 6 3 20 6 69 78",
"output": "1 100"
},
{
"input": "100 100\n6\n92 32 90 80 32 40 24 19 36 37 39 13",
"output": "1 100"
},
{
"input": "100 100\n7\n30 32 29 63 86 78 88 2 86 50 41 60 54 28",
"output": "1 100"
},
{
"input": "100 100\n8\n40 43 96 8 17 63 61 59 16 69 4 95 30 62 12 91",
"output": "100 100"
},
{
"input": "100 100\n9\n18 16 41 71 25 1 43 38 78 92 77 70 99 8 33 54 76 78",
"output": "1 100"
},
{
"input": "100 100\n10\n58 98 33 62 75 13 94 86 81 42 14 53 12 66 7 14 3 63 87 37",
"output": "40 1"
},
{
"input": "2000 2000\n1\n407 594",
"output": "2000 2000"
},
{
"input": "2000 2000\n2\n1884 43 1235 1111",
"output": "1 2000"
},
{
"input": "2000 2000\n3\n1740 1797 1279 1552 329 756",
"output": "2000 1"
},
{
"input": "2000 2000\n4\n1844 1342 171 1810 1558 1141 1917 1999",
"output": "530 1"
},
{
"input": "2000 2000\n5\n1846 327 1911 1534 134 1615 1664 682 1982 1112",
"output": "346 1"
},
{
"input": "2000 2000\n6\n1744 1102 852 723 409 179 89 1085 997 1433 1082 1680",
"output": "2000 1"
},
{
"input": "2000 2000\n7\n1890 22 288 1729 383 831 1192 1206 721 1376 969 492 510 1699",
"output": "2000 2000"
},
{
"input": "2000 2000\n8\n286 381 572 1849 1703 1574 622 1047 1507 941 871 663 1930 120 1084 1830",
"output": "1 1423"
},
{
"input": "2000 2000\n9\n226 531 56 138 722 405 1082 608 1355 1426 83 544 275 1268 683 412 1880 1049",
"output": "1701 1"
},
{
"input": "2000 2000\n10\n763 851 1182 571 1758 389 247 1907 730 881 531 1970 1430 667 169 765 1729 120 129 967",
"output": "2000 1793"
},
{
"input": "2000 2000\n10\n655 95 1640 1656 1344 79 666 1677 968 1180 522 1394 1850 1568 336 130 412 920 29 1664",
"output": "2000 570"
},
{
"input": "10 1\n10\n4 1 6 1 10 1 9 1 1 1 7 1 5 1 2 1 8 1 3 1",
"output": "1 1"
},
{
"input": "1 10\n10\n1 10 1 4 1 3 1 7 1 6 1 1 1 8 1 2 1 9 1 5",
"output": "1 1"
},
{
"input": "1 100\n10\n1 68 1 18 1 43 1 12 1 64 1 34 1 23 1 70 1 46 1 33",
"output": "1 100"
},
{
"input": "100 1\n10\n62 1 63 1 57 1 76 1 35 1 69 1 73 1 95 1 96 1 21 1",
"output": "1 1"
},
{
"input": "1 2000\n10\n1 1730 1 1374 1 831 1 1076 1 580 1 914 1 123 1 668 1 1288 1 160",
"output": "1 2000"
},
{
"input": "2000 1\n10\n1058 1 1779 1 1995 1 1398 1 96 1 1599 1 1496 1 1659 1 385 1 1485 1",
"output": "721 1"
},
{
"input": "5 5\n1\n1 1",
"output": "5 5"
},
{
"input": "2 5\n10\n1 1 1 2 1 3 1 4 1 5 2 1 2 2 2 3 2 4 2 5",
"output": "1 1"
},
{
"input": "1 10\n9\n1 1 1 2 1 3 1 4 1 6 1 7 1 8 1 9 1 10",
"output": "1 5"
},
{
"input": "3 3\n5\n1 1 1 3 2 2 3 1 3 3",
"output": "1 2"
},
{
"input": "999 999\n4\n1 499 499 1 499 999 999 499",
"output": "500 500"
}
] | 1,623,785,131 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 154 | 512,000 | '''
___ ____
____ _____ _____/ (_)_ ______ ____ _____/ / /_ __ ______ ___ __
/ __ `/ __ `/ __ / / / / / __ \/ __ `/ __ / __ \/ / / / __ `/ / / /
/ /_/ / /_/ / /_/ / / /_/ / /_/ / /_/ / /_/ / / / / /_/ / /_/ / /_/ /
\__,_/\__,_/\__,_/_/\__,_/ .___/\__,_/\__,_/_/ /_/\__, /\__,_/\__, /
/_/ /____/ /____/
'''
import os.path
from math import gcd, floor, ceil
from collections import *
import sys
mod = 1000000007
INF = float('inf')
def st(): return list(sys.stdin.readline().strip())
def li(): return list(map(int, sys.stdin.readline().split()))
def mp(): return map(int, sys.stdin.readline().split())
def inp(): return int(sys.stdin.readline())
def pr(n): return sys.stdout.write(str(n)+"\n")
def prl(n): return sys.stdout.write(str(n)+" ")
if os.path.exists('input.txt'):
sys.stdin = open('input.txt', 'r')
sys.stdout = open('output.txt', 'w')
dx = [0, 0, 1, -1, 1, 1, -1, -1]
dy = [1, -1, 0, 0, 1, -1, 1, -1]
def solve():
n, m = mp()
k = inp()
l = li()
q = deque()
v = defaultdict(int)
dist = defaultdict(int)
for i in range(0, 2*k - 1, 2):
q.append((l[i], l[i+1]))
v[(l[i], l[i+1])] = 1
last = []
while q:
last = q[0]
a, b = q.popleft()
for i in range(8):
A, B = a+dx[i], b+dy[i]
if A > 0 and A <= n and B > 0 and B <= m:
if not v[(A, B)]:
q.append((A, B))
dist[(A, B)] = dist[(a, b)] + 1
v[(A, B)] = 1
ans = []
ma = 0
for i in dist:
if dist[i] > ma:
ma = dist[i]
ans = i
print(*ans)
for _ in range(1):
solve()
| Title: Fire Again
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
After a terrifying forest fire in Berland a forest rebirth program was carried out. Due to it *N* rows with *M* trees each were planted and the rows were so neat that one could map it on a system of coordinates so that the *j*-th tree in the *i*-th row would have the coordinates of (*i*,<=*j*). However a terrible thing happened and the young forest caught fire. Now we must find the coordinates of the tree that will catch fire last to plan evacuation.
The burning began in *K* points simultaneously, which means that initially *K* trees started to burn. Every minute the fire gets from the burning trees to the ones that aren’t burning and that the distance from them to the nearest burning tree equals to 1.
Find the tree that will be the last to start burning. If there are several such trees, output any.
Input Specification:
The first input line contains two integers *N*,<=*M* (1<=≤<=*N*,<=*M*<=≤<=2000) — the size of the forest. The trees were planted in all points of the (*x*,<=*y*) (1<=≤<=*x*<=≤<=*N*,<=1<=≤<=*y*<=≤<=*M*) type, *x* and *y* are integers.
The second line contains an integer *K* (1<=≤<=*K*<=≤<=10) — amount of trees, burning in the beginning.
The third line contains *K* pairs of integers: *x*1,<=*y*1,<=*x*2,<=*y*2,<=...,<=*x**k*,<=*y**k* (1<=≤<=*x**i*<=≤<=*N*,<=1<=≤<=*y**i*<=≤<=*M*) — coordinates of the points from which the fire started. It is guaranteed that no two points coincide.
Output Specification:
Output a line with two space-separated integers *x* and *y* — coordinates of the tree that will be the last one to start burning. If there are several such trees, output any.
Demo Input:
['3 3\n1\n2 2\n', '3 3\n1\n1 1\n', '3 3\n2\n1 1 3 3\n']
Demo Output:
['1 1\n', '3 3\n', '2 2']
Note:
none | ```python
'''
___ ____
____ _____ _____/ (_)_ ______ ____ _____/ / /_ __ ______ ___ __
/ __ `/ __ `/ __ / / / / / __ \/ __ `/ __ / __ \/ / / / __ `/ / / /
/ /_/ / /_/ / /_/ / / /_/ / /_/ / /_/ / /_/ / / / / /_/ / /_/ / /_/ /
\__,_/\__,_/\__,_/_/\__,_/ .___/\__,_/\__,_/_/ /_/\__, /\__,_/\__, /
/_/ /____/ /____/
'''
import os.path
from math import gcd, floor, ceil
from collections import *
import sys
mod = 1000000007
INF = float('inf')
def st(): return list(sys.stdin.readline().strip())
def li(): return list(map(int, sys.stdin.readline().split()))
def mp(): return map(int, sys.stdin.readline().split())
def inp(): return int(sys.stdin.readline())
def pr(n): return sys.stdout.write(str(n)+"\n")
def prl(n): return sys.stdout.write(str(n)+" ")
if os.path.exists('input.txt'):
sys.stdin = open('input.txt', 'r')
sys.stdout = open('output.txt', 'w')
dx = [0, 0, 1, -1, 1, 1, -1, -1]
dy = [1, -1, 0, 0, 1, -1, 1, -1]
def solve():
n, m = mp()
k = inp()
l = li()
q = deque()
v = defaultdict(int)
dist = defaultdict(int)
for i in range(0, 2*k - 1, 2):
q.append((l[i], l[i+1]))
v[(l[i], l[i+1])] = 1
last = []
while q:
last = q[0]
a, b = q.popleft()
for i in range(8):
A, B = a+dx[i], b+dy[i]
if A > 0 and A <= n and B > 0 and B <= m:
if not v[(A, B)]:
q.append((A, B))
dist[(A, B)] = dist[(a, b)] + 1
v[(A, B)] = 1
ans = []
ma = 0
for i in dist:
if dist[i] > ma:
ma = dist[i]
ans = i
print(*ans)
for _ in range(1):
solve()
``` | 0 |
3 | C | Tic-tac-toe | PROGRAMMING | 1,800 | [
"brute force",
"games",
"implementation"
] | C. Tic-tac-toe | 1 | 64 | Certainly, everyone is familiar with tic-tac-toe game. The rules are very simple indeed. Two players take turns marking the cells in a 3<=×<=3 grid (one player always draws crosses, the other — noughts). The player who succeeds first in placing three of his marks in a horizontal, vertical or diagonal line wins, and the game is finished. The player who draws crosses goes first. If the grid is filled, but neither Xs, nor 0s form the required line, a draw is announced.
You are given a 3<=×<=3 grid, each grid cell is empty, or occupied by a cross or a nought. You have to find the player (first or second), whose turn is next, or print one of the verdicts below:
- illegal — if the given board layout can't appear during a valid game; - the first player won — if in the given board layout the first player has just won; - the second player won — if in the given board layout the second player has just won; - draw — if the given board layout has just let to a draw. | The input consists of three lines, each of the lines contains characters ".", "X" or "0" (a period, a capital letter X, or a digit zero). | Print one of the six verdicts: first, second, illegal, the first player won, the second player won or draw. | [
"X0X\n.0.\n.X.\n"
] | [
"second\n"
] | none | 0 | [
{
"input": "X0X\n.0.\n.X.",
"output": "second"
},
{
"input": "0.X\nXX.\n000",
"output": "illegal"
},
{
"input": "XXX\n.0.\n000",
"output": "illegal"
},
{
"input": "XXX\n...\n000",
"output": "illegal"
},
{
"input": "X.X\nX..\n00.",
"output": "second"
},
{
"input": "X.X\nX.0\n0.0",
"output": "first"
},
{
"input": "XXX\nX00\nX00",
"output": "the first player won"
},
{
"input": "000\nX.X\nX.X",
"output": "illegal"
},
{
"input": "XXX\n0.0\n0..",
"output": "illegal"
},
{
"input": "X0X\n0X0\nX0X",
"output": "the first player won"
},
{
"input": "XX.\nX0X\nX..",
"output": "illegal"
},
{
"input": "X0X\n0X0\nX..",
"output": "the first player won"
},
{
"input": "XX0\n0..\n000",
"output": "illegal"
},
{
"input": "XXX\n0..\n.0.",
"output": "the first player won"
},
{
"input": "XXX\nX..\n.00",
"output": "illegal"
},
{
"input": "X00\n0.0\nXX0",
"output": "illegal"
},
{
"input": "0.0\n0XX\n..0",
"output": "illegal"
},
{
"input": ".00\nX.X\n0..",
"output": "illegal"
},
{
"input": "..0\n.00\n.0X",
"output": "illegal"
},
{
"input": "..0\n0..\n00X",
"output": "illegal"
},
{
"input": "..0\n.XX\nX..",
"output": "illegal"
},
{
"input": "0.X\n0X0\n.00",
"output": "illegal"
},
{
"input": "..X\n0X0\n0X.",
"output": "first"
},
{
"input": "0X0\nX..\nX.0",
"output": "first"
},
{
"input": ".0.\nX.X\n0..",
"output": "first"
},
{
"input": "0X0\n00X\n.00",
"output": "illegal"
},
{
"input": ".0.\n.X0\nX..",
"output": "first"
},
{
"input": "00X\n0.X\n00X",
"output": "illegal"
},
{
"input": "00X\n0XX\n0X.",
"output": "the second player won"
},
{
"input": "X00\n..0\nX.X",
"output": "first"
},
{
"input": "X00\nX00\n.X0",
"output": "illegal"
},
{
"input": "X0X\n.X0\n0..",
"output": "first"
},
{
"input": "..0\nXXX\n000",
"output": "illegal"
},
{
"input": "XXX\n...\n.0.",
"output": "illegal"
},
{
"input": "0..\n000\nX0X",
"output": "illegal"
},
{
"input": ".00\n0X.\n0.0",
"output": "illegal"
},
{
"input": "X..\nX00\n0.0",
"output": "illegal"
},
{
"input": ".X0\nXX0\nX.X",
"output": "illegal"
},
{
"input": "X.X\n0.0\nX..",
"output": "second"
},
{
"input": "00X\n.00\n..0",
"output": "illegal"
},
{
"input": "..0\n0.X\n00.",
"output": "illegal"
},
{
"input": "0.X\nX0X\n.X0",
"output": "illegal"
},
{
"input": "0X.\n.X.\n0X0",
"output": "illegal"
},
{
"input": "00.\nX0.\n..X",
"output": "illegal"
},
{
"input": "..X\n.00\nXX.",
"output": "second"
},
{
"input": ".00\n.0.\n.X.",
"output": "illegal"
},
{
"input": "XX0\nX.0\nXX0",
"output": "illegal"
},
{
"input": "00.\n00.\nX.X",
"output": "illegal"
},
{
"input": "X00\nX.0\nX.0",
"output": "illegal"
},
{
"input": "0X.\n0XX\n000",
"output": "illegal"
},
{
"input": "00.\n00.\n.X.",
"output": "illegal"
},
{
"input": "X0X\n00.\n0.X",
"output": "illegal"
},
{
"input": "XX0\nXXX\n0X0",
"output": "illegal"
},
{
"input": "XX0\n..X\nXX0",
"output": "illegal"
},
{
"input": "0X.\n..X\nX..",
"output": "illegal"
},
{
"input": "...\nX0.\nXX0",
"output": "second"
},
{
"input": "..X\n.0.\n0..",
"output": "illegal"
},
{
"input": "00X\nXX.\n00X",
"output": "first"
},
{
"input": "..0\nXX0\n..X",
"output": "second"
},
{
"input": ".0.\n.00\nX00",
"output": "illegal"
},
{
"input": "X00\n.XX\n00.",
"output": "illegal"
},
{
"input": ".00\n0.X\n000",
"output": "illegal"
},
{
"input": "X0.\n..0\nX.0",
"output": "illegal"
},
{
"input": "X0X\n.XX\n00.",
"output": "second"
},
{
"input": "0X.\n00.\n.X.",
"output": "illegal"
},
{
"input": ".0.\n...\n0.0",
"output": "illegal"
},
{
"input": "..X\nX00\n0.0",
"output": "illegal"
},
{
"input": "0XX\n...\nX0.",
"output": "second"
},
{
"input": "X.X\n0X.\n.0X",
"output": "illegal"
},
{
"input": "XX0\nX.X\n00.",
"output": "second"
},
{
"input": ".0X\n.00\n00.",
"output": "illegal"
},
{
"input": ".XX\nXXX\n0..",
"output": "illegal"
},
{
"input": "XX0\n.X0\n.0.",
"output": "first"
},
{
"input": "X00\n0.X\nX..",
"output": "first"
},
{
"input": "X..\n.X0\nX0.",
"output": "second"
},
{
"input": ".0X\nX..\nXXX",
"output": "illegal"
},
{
"input": "X0X\nXXX\nX.X",
"output": "illegal"
},
{
"input": ".00\nX0.\n00X",
"output": "illegal"
},
{
"input": "0XX\n.X0\n0.0",
"output": "illegal"
},
{
"input": "00X\nXXX\n..0",
"output": "the first player won"
},
{
"input": "X0X\n...\n.X.",
"output": "illegal"
},
{
"input": ".X0\n...\n0X.",
"output": "first"
},
{
"input": "X..\n0X0\nX.0",
"output": "first"
},
{
"input": "..0\n.00\nX.0",
"output": "illegal"
},
{
"input": ".XX\n.0.\nX0X",
"output": "illegal"
},
{
"input": "00.\n0XX\n..0",
"output": "illegal"
},
{
"input": ".0.\n00.\n00.",
"output": "illegal"
},
{
"input": "00.\n000\nX.X",
"output": "illegal"
},
{
"input": "0X0\n.X0\n.X.",
"output": "illegal"
},
{
"input": "00X\n0..\n0..",
"output": "illegal"
},
{
"input": ".X.\n.X0\nX.0",
"output": "second"
},
{
"input": ".0.\n0X0\nX0X",
"output": "illegal"
},
{
"input": "...\nX.0\n0..",
"output": "illegal"
},
{
"input": "..0\nXX.\n00X",
"output": "first"
},
{
"input": "0.X\n.0X\nX00",
"output": "illegal"
},
{
"input": "..X\n0X.\n.0.",
"output": "first"
},
{
"input": "..X\nX.0\n.0X",
"output": "second"
},
{
"input": "X0.\n.0X\nX0X",
"output": "illegal"
},
{
"input": "...\n.0.\n.X0",
"output": "illegal"
},
{
"input": ".X0\nXX0\n0..",
"output": "first"
},
{
"input": "0X.\n...\nX..",
"output": "second"
},
{
"input": ".0.\n0.0\n0.X",
"output": "illegal"
},
{
"input": "XX.\n.X0\n.0X",
"output": "illegal"
},
{
"input": ".0.\nX0X\nX00",
"output": "illegal"
},
{
"input": "0X.\n.X0\nX..",
"output": "second"
},
{
"input": "..0\n0X.\n000",
"output": "illegal"
},
{
"input": "0.0\nX.X\nXX.",
"output": "illegal"
},
{
"input": ".X.\n.XX\nX0.",
"output": "illegal"
},
{
"input": "X.X\n.XX\n0X.",
"output": "illegal"
},
{
"input": "X.0\n0XX\n..0",
"output": "first"
},
{
"input": "X.0\n0XX\n.X0",
"output": "second"
},
{
"input": "X00\n0XX\n.X0",
"output": "first"
},
{
"input": "X00\n0XX\nXX0",
"output": "draw"
},
{
"input": "X00\n0XX\n0X0",
"output": "illegal"
},
{
"input": "XXX\nXXX\nXXX",
"output": "illegal"
},
{
"input": "000\n000\n000",
"output": "illegal"
},
{
"input": "XX0\n00X\nXX0",
"output": "draw"
},
{
"input": "X00\n00X\nXX0",
"output": "illegal"
},
{
"input": "X.0\n00.\nXXX",
"output": "the first player won"
},
{
"input": "X..\nX0.\nX0.",
"output": "the first player won"
},
{
"input": ".XX\n000\nXX0",
"output": "the second player won"
},
{
"input": "X0.\nX.X\nX00",
"output": "the first player won"
},
{
"input": "00X\nX00\nXXX",
"output": "the first player won"
},
{
"input": "XXX\n.00\nX0.",
"output": "the first player won"
},
{
"input": "XX0\n000\nXX.",
"output": "the second player won"
},
{
"input": ".X0\n0.0\nXXX",
"output": "the first player won"
},
{
"input": "0XX\nX00\n0XX",
"output": "draw"
},
{
"input": "0XX\nX0X\n00X",
"output": "the first player won"
},
{
"input": "XX0\n0XX\n0X0",
"output": "the first player won"
},
{
"input": "0X0\nX0X\nX0X",
"output": "draw"
},
{
"input": "X0X\n0XX\n00X",
"output": "the first player won"
},
{
"input": "0XX\nX0.\nX00",
"output": "the second player won"
},
{
"input": "X.0\n0X0\nXX0",
"output": "the second player won"
},
{
"input": "X0X\nX0X\n0X0",
"output": "draw"
},
{
"input": "X.0\n00X\n0XX",
"output": "the second player won"
},
{
"input": "00X\nX0X\n.X0",
"output": "the second player won"
},
{
"input": "X0X\n.00\nX0X",
"output": "the second player won"
},
{
"input": "0XX\nX00\nX0X",
"output": "draw"
},
{
"input": "000\nX0X\n.XX",
"output": "the second player won"
},
{
"input": "0.0\n0.X\nXXX",
"output": "the first player won"
},
{
"input": "X.0\nX0.\n0X.",
"output": "the second player won"
},
{
"input": "X0X\n0X0\n..X",
"output": "the first player won"
},
{
"input": "0X0\nXX0\n.X.",
"output": "the first player won"
},
{
"input": "X0.\n.X.\n0.X",
"output": "the first player won"
},
{
"input": "0XX\nX00\n.X0",
"output": "the second player won"
},
{
"input": "0.0\nXXX\n0.X",
"output": "the first player won"
},
{
"input": ".0X\n.X.\nX.0",
"output": "the first player won"
},
{
"input": "XXX\nX.0\n0.0",
"output": "the first player won"
},
{
"input": "XX0\nX..\nX00",
"output": "the first player won"
},
{
"input": "XXX\n00X\n00X",
"output": "the first player won"
},
{
"input": "X00\n00X\nXXX",
"output": "the first player won"
},
{
"input": "0X0\nX0X\n0X.",
"output": "the second player won"
},
{
"input": "XX0\nX00\n0X.",
"output": "the second player won"
},
{
"input": "..X\n0X0\nX..",
"output": "the first player won"
},
{
"input": "X0.\n00.\nXXX",
"output": "the first player won"
},
{
"input": "0.X\nX00\nXX0",
"output": "the second player won"
},
{
"input": "X0.\n0X.\n..X",
"output": "the first player won"
},
{
"input": "00X\nX0.\nXX0",
"output": "the second player won"
},
{
"input": "XX.\n000\n0XX",
"output": "the second player won"
},
{
"input": "..X\n0.X\n.0X",
"output": "the first player won"
},
{
"input": "X00\n.0X\n0XX",
"output": "the second player won"
},
{
"input": "00X\n0X.\nXX.",
"output": "the first player won"
},
{
"input": "X00\nXX.\n0.X",
"output": "the first player won"
},
{
"input": "XXX\n00X\n0X0",
"output": "the first player won"
},
{
"input": "X00\nXX0\n0XX",
"output": "the first player won"
},
{
"input": "0X0\nX00\nXXX",
"output": "the first player won"
},
{
"input": "XX0\nX00\n.X0",
"output": "the second player won"
}
] | 1,691,592,054 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | # LUOGU_RID: 119972118
ss = [input() for i in range(3)]
s = "".join(ss)
x, o, p = s.count("X"), s.count("O"), s.count(".")
if o > x or x > o + 1:
print("illegal") | Title: Tic-tac-toe
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Certainly, everyone is familiar with tic-tac-toe game. The rules are very simple indeed. Two players take turns marking the cells in a 3<=×<=3 grid (one player always draws crosses, the other — noughts). The player who succeeds first in placing three of his marks in a horizontal, vertical or diagonal line wins, and the game is finished. The player who draws crosses goes first. If the grid is filled, but neither Xs, nor 0s form the required line, a draw is announced.
You are given a 3<=×<=3 grid, each grid cell is empty, or occupied by a cross or a nought. You have to find the player (first or second), whose turn is next, or print one of the verdicts below:
- illegal — if the given board layout can't appear during a valid game; - the first player won — if in the given board layout the first player has just won; - the second player won — if in the given board layout the second player has just won; - draw — if the given board layout has just let to a draw.
Input Specification:
The input consists of three lines, each of the lines contains characters ".", "X" or "0" (a period, a capital letter X, or a digit zero).
Output Specification:
Print one of the six verdicts: first, second, illegal, the first player won, the second player won or draw.
Demo Input:
['X0X\n.0.\n.X.\n']
Demo Output:
['second\n']
Note:
none | ```python
# LUOGU_RID: 119972118
ss = [input() for i in range(3)]
s = "".join(ss)
x, o, p = s.count("X"), s.count("O"), s.count(".")
if o > x or x > o + 1:
print("illegal")
``` | 0 |
779 | B | Weird Rounding | PROGRAMMING | 1,100 | [
"brute force",
"greedy"
] | null | null | Polycarp is crazy about round numbers. He especially likes the numbers divisible by 10*k*.
In the given number of *n* Polycarp wants to remove the least number of digits to get a number that is divisible by 10*k*. For example, if *k*<==<=3, in the number 30020 it is enough to delete a single digit (2). In this case, the result is 3000 that is divisible by 103<==<=1000.
Write a program that prints the minimum number of digits to be deleted from the given integer number *n*, so that the result is divisible by 10*k*. The result should not start with the unnecessary leading zero (i.e., zero can start only the number 0, which is required to be written as exactly one digit).
It is guaranteed that the answer exists. | The only line of the input contains two integer numbers *n* and *k* (0<=≤<=*n*<=≤<=2<=000<=000<=000, 1<=≤<=*k*<=≤<=9).
It is guaranteed that the answer exists. All numbers in the input are written in traditional notation of integers, that is, without any extra leading zeros. | Print *w* — the required minimal number of digits to erase. After removing the appropriate *w* digits from the number *n*, the result should have a value that is divisible by 10*k*. The result can start with digit 0 in the single case (the result is zero and written by exactly the only digit 0). | [
"30020 3\n",
"100 9\n",
"10203049 2\n"
] | [
"1\n",
"2\n",
"3\n"
] | In the example 2 you can remove two digits: 1 and any 0. The result is number 0 which is divisible by any number. | 1,000 | [
{
"input": "30020 3",
"output": "1"
},
{
"input": "100 9",
"output": "2"
},
{
"input": "10203049 2",
"output": "3"
},
{
"input": "0 1",
"output": "0"
},
{
"input": "0 9",
"output": "0"
},
{
"input": "100 2",
"output": "0"
},
{
"input": "102030404 2",
"output": "2"
},
{
"input": "1000999999 3",
"output": "6"
},
{
"input": "12000000 4",
"output": "0"
},
{
"input": "1090090090 5",
"output": "2"
},
{
"input": "10 1",
"output": "0"
},
{
"input": "10 2",
"output": "1"
},
{
"input": "10 9",
"output": "1"
},
{
"input": "100 1",
"output": "0"
},
{
"input": "100 3",
"output": "2"
},
{
"input": "101010110 3",
"output": "3"
},
{
"input": "101010110 1",
"output": "0"
},
{
"input": "101010110 2",
"output": "2"
},
{
"input": "101010110 4",
"output": "4"
},
{
"input": "101010110 5",
"output": "8"
},
{
"input": "101010110 9",
"output": "8"
},
{
"input": "1234567890 1",
"output": "0"
},
{
"input": "1234567890 2",
"output": "9"
},
{
"input": "1234567890 9",
"output": "9"
},
{
"input": "2000000000 1",
"output": "0"
},
{
"input": "2000000000 2",
"output": "0"
},
{
"input": "2000000000 3",
"output": "0"
},
{
"input": "2000000000 9",
"output": "0"
},
{
"input": "1010101010 1",
"output": "0"
},
{
"input": "1010101010 2",
"output": "1"
},
{
"input": "1010101010 3",
"output": "2"
},
{
"input": "1010101010 4",
"output": "3"
},
{
"input": "1010101010 5",
"output": "4"
},
{
"input": "1010101010 6",
"output": "9"
},
{
"input": "1010101010 7",
"output": "9"
},
{
"input": "1010101010 8",
"output": "9"
},
{
"input": "1010101010 9",
"output": "9"
},
{
"input": "10001000 1",
"output": "0"
},
{
"input": "10001000 2",
"output": "0"
},
{
"input": "10001000 3",
"output": "0"
},
{
"input": "10001000 4",
"output": "1"
},
{
"input": "10001000 5",
"output": "1"
},
{
"input": "10001000 6",
"output": "1"
},
{
"input": "10001000 7",
"output": "7"
},
{
"input": "10001000 8",
"output": "7"
},
{
"input": "10001000 9",
"output": "7"
},
{
"input": "1000000001 1",
"output": "1"
},
{
"input": "1000000001 2",
"output": "1"
},
{
"input": "1000000001 3",
"output": "1"
},
{
"input": "1000000001 6",
"output": "1"
},
{
"input": "1000000001 7",
"output": "1"
},
{
"input": "1000000001 8",
"output": "1"
},
{
"input": "1000000001 9",
"output": "9"
},
{
"input": "1000 1",
"output": "0"
},
{
"input": "100001100 3",
"output": "2"
},
{
"input": "7057 6",
"output": "3"
},
{
"input": "30000000 5",
"output": "0"
},
{
"input": "470 1",
"output": "0"
},
{
"input": "500500000 4",
"output": "0"
},
{
"input": "2103 8",
"output": "3"
},
{
"input": "600000000 2",
"output": "0"
},
{
"input": "708404442 1",
"output": "4"
},
{
"input": "5000140 6",
"output": "6"
},
{
"input": "1100047 3",
"output": "2"
},
{
"input": "309500 5",
"output": "5"
},
{
"input": "70053160 4",
"output": "7"
},
{
"input": "44000 1",
"output": "0"
},
{
"input": "400370000 3",
"output": "0"
},
{
"input": "5800 6",
"output": "3"
},
{
"input": "20700050 1",
"output": "0"
},
{
"input": "650 1",
"output": "0"
},
{
"input": "320005070 6",
"output": "8"
},
{
"input": "370000 4",
"output": "0"
},
{
"input": "1011 2",
"output": "3"
},
{
"input": "1000111 5",
"output": "6"
},
{
"input": "1001111 5",
"output": "6"
},
{
"input": "99990 3",
"output": "4"
},
{
"input": "10100200 6",
"output": "7"
},
{
"input": "200 3",
"output": "2"
},
{
"input": "103055 3",
"output": "5"
},
{
"input": "1030555 3",
"output": "6"
},
{
"input": "100111 4",
"output": "5"
},
{
"input": "101 2",
"output": "2"
},
{
"input": "1001 3",
"output": "3"
},
{
"input": "100000 6",
"output": "5"
},
{
"input": "1100000 6",
"output": "6"
},
{
"input": "123450 2",
"output": "5"
},
{
"input": "1003 3",
"output": "3"
},
{
"input": "1111100 4",
"output": "6"
},
{
"input": "532415007 8",
"output": "8"
},
{
"input": "801 2",
"output": "2"
},
{
"input": "1230 2",
"output": "3"
},
{
"input": "9900 3",
"output": "3"
},
{
"input": "14540444 2",
"output": "7"
},
{
"input": "11111100 4",
"output": "7"
},
{
"input": "11001 3",
"output": "4"
},
{
"input": "1011110 3",
"output": "6"
},
{
"input": "15450112 2",
"output": "7"
},
{
"input": "2220 3",
"output": "3"
},
{
"input": "90099 3",
"output": "4"
},
{
"input": "10005 4",
"output": "4"
},
{
"input": "1010 3",
"output": "3"
},
{
"input": "444444400 3",
"output": "8"
},
{
"input": "10020 4",
"output": "4"
},
{
"input": "10303 3",
"output": "4"
},
{
"input": "123000 4",
"output": "5"
},
{
"input": "12300 3",
"output": "4"
},
{
"input": "101 1",
"output": "1"
},
{
"input": "500001 8",
"output": "5"
},
{
"input": "121002 3",
"output": "5"
},
{
"input": "10011 3",
"output": "4"
},
{
"input": "505050 4",
"output": "5"
},
{
"input": "1421011 2",
"output": "6"
},
{
"input": "1202022 3",
"output": "6"
},
{
"input": "1000023 7",
"output": "6"
},
{
"input": "110 2",
"output": "2"
},
{
"input": "111000 4",
"output": "5"
},
{
"input": "10340 3",
"output": "4"
},
{
"input": "101 9",
"output": "2"
},
{
"input": "2001 3",
"output": "3"
},
{
"input": "122320 2",
"output": "5"
},
{
"input": "22200 3",
"output": "4"
},
{
"input": "11110 2",
"output": "4"
},
{
"input": "11010 3",
"output": "4"
},
{
"input": "1000002333 6",
"output": "9"
},
{
"input": "101010 4",
"output": "5"
},
{
"input": "210 9",
"output": "2"
},
{
"input": "500555 3",
"output": "5"
},
{
"input": "1110111 3",
"output": "6"
},
{
"input": "1100000000 9",
"output": "9"
},
{
"input": "11000 4",
"output": "4"
},
{
"input": "100 4",
"output": "2"
},
{
"input": "234560 3",
"output": "5"
},
{
"input": "10230 3",
"output": "4"
},
{
"input": "10030234 5",
"output": "7"
},
{
"input": "1200 3",
"output": "3"
},
{
"input": "123400 3",
"output": "5"
},
{
"input": "1034543 4",
"output": "6"
},
{
"input": "10100 4",
"output": "4"
},
{
"input": "10 5",
"output": "1"
},
{
"input": "4501022 3",
"output": "6"
},
{
"input": "12340 2",
"output": "4"
},
{
"input": "30020 4",
"output": "4"
},
{
"input": "1111100 6",
"output": "6"
},
{
"input": "10101 5",
"output": "4"
},
{
"input": "32132100 3",
"output": "7"
},
{
"input": "1000023 6",
"output": "6"
},
{
"input": "12300 4",
"output": "4"
},
{
"input": "78400 3",
"output": "4"
},
{
"input": "10203049 5",
"output": "7"
},
{
"input": "404044 3",
"output": "5"
},
{
"input": "1024 2",
"output": "3"
},
{
"input": "505 2",
"output": "2"
},
{
"input": "20 2",
"output": "1"
},
{
"input": "1111100 3",
"output": "6"
},
{
"input": "1000 9",
"output": "3"
},
{
"input": "3333300 3",
"output": "6"
},
{
"input": "1100 3",
"output": "3"
},
{
"input": "963000 4",
"output": "5"
},
{
"input": "100457 5",
"output": "5"
},
{
"input": "10049 3",
"output": "4"
}
] | 1,489,545,591 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 46 | 4,505,600 | nn = int(input())
k = int(input())
n = str(nn)
#m = input().split() #list
#[a, b, c] = [int(x) for x in input().split()]
zeros = 0
dls = 0
i = len(n) - 1
while zeros < k:
if (i == -1):
print(len(n) - 1)
break
if n[i] == '0':
zeros += 1
else:
dls += 1
i -= 1
if zeros == k:
print(dls)
| Title: Weird Rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is crazy about round numbers. He especially likes the numbers divisible by 10*k*.
In the given number of *n* Polycarp wants to remove the least number of digits to get a number that is divisible by 10*k*. For example, if *k*<==<=3, in the number 30020 it is enough to delete a single digit (2). In this case, the result is 3000 that is divisible by 103<==<=1000.
Write a program that prints the minimum number of digits to be deleted from the given integer number *n*, so that the result is divisible by 10*k*. The result should not start with the unnecessary leading zero (i.e., zero can start only the number 0, which is required to be written as exactly one digit).
It is guaranteed that the answer exists.
Input Specification:
The only line of the input contains two integer numbers *n* and *k* (0<=≤<=*n*<=≤<=2<=000<=000<=000, 1<=≤<=*k*<=≤<=9).
It is guaranteed that the answer exists. All numbers in the input are written in traditional notation of integers, that is, without any extra leading zeros.
Output Specification:
Print *w* — the required minimal number of digits to erase. After removing the appropriate *w* digits from the number *n*, the result should have a value that is divisible by 10*k*. The result can start with digit 0 in the single case (the result is zero and written by exactly the only digit 0).
Demo Input:
['30020 3\n', '100 9\n', '10203049 2\n']
Demo Output:
['1\n', '2\n', '3\n']
Note:
In the example 2 you can remove two digits: 1 and any 0. The result is number 0 which is divisible by any number. | ```python
nn = int(input())
k = int(input())
n = str(nn)
#m = input().split() #list
#[a, b, c] = [int(x) for x in input().split()]
zeros = 0
dls = 0
i = len(n) - 1
while zeros < k:
if (i == -1):
print(len(n) - 1)
break
if n[i] == '0':
zeros += 1
else:
dls += 1
i -= 1
if zeros == k:
print(dls)
``` | -1 |
|
445 | A | DZY Loves Chessboard | PROGRAMMING | 1,200 | [
"dfs and similar",
"implementation"
] | null | null | DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard. | The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad. | Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists. | [
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] | [
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] | In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are. | 500 | [
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,628,205,805 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 77 | 6,963,200 | a,b = map(int, input().split())
mat = []
for i in range(0,a):
x = input()
mat.append([])
for j in range(0,b):
if x[j] != '-':
if (i % 2 == 0 and j % 2 == 0) or (i % 2 == 1 and j % 2 == 1):
mat[i].append('B')
else:
mat[i].append('W')
else:
mat[i].append('-')
for i in range(0,a):
print(''.join(mat[i])) | Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are. | ```python
a,b = map(int, input().split())
mat = []
for i in range(0,a):
x = input()
mat.append([])
for j in range(0,b):
if x[j] != '-':
if (i % 2 == 0 and j % 2 == 0) or (i % 2 == 1 and j % 2 == 1):
mat[i].append('B')
else:
mat[i].append('W')
else:
mat[i].append('-')
for i in range(0,a):
print(''.join(mat[i]))
``` | 3 |
|
124 | B | Permutations | PROGRAMMING | 1,400 | [
"brute force",
"combinatorics",
"implementation"
] | null | null | You are given *n* *k*-digit integers. You have to rearrange the digits in the integers so that the difference between the largest and the smallest number was minimum. Digits should be rearranged by the same rule in all integers. | The first line contains integers *n* and *k* — the number and digit capacity of numbers correspondingly (1<=≤<=*n*,<=*k*<=≤<=8). Next *n* lines contain *k*-digit positive integers. Leading zeroes are allowed both in the initial integers and the integers resulting from the rearranging of digits. | Print a single number: the minimally possible difference between the largest and the smallest number after the digits are rearranged in all integers by the same rule. | [
"6 4\n5237\n2753\n7523\n5723\n5327\n2537\n",
"3 3\n010\n909\n012\n",
"7 5\n50808\n36603\n37198\n44911\n29994\n42543\n50156\n"
] | [
"2700\n",
"3\n",
"20522\n"
] | In the first sample, if we rearrange the digits in numbers as (3,1,4,2), then the 2-nd and the 4-th numbers will equal 5237 and 2537 correspondingly (they will be maximum and minimum for such order of digits).
In the second sample, if we swap the second digits and the first ones, we get integers 100, 99 and 102. | 1,000 | [
{
"input": "6 4\n5237\n2753\n7523\n5723\n5327\n2537",
"output": "2700"
},
{
"input": "3 3\n010\n909\n012",
"output": "3"
},
{
"input": "7 5\n50808\n36603\n37198\n44911\n29994\n42543\n50156",
"output": "20522"
},
{
"input": "5 5\n61374\n74304\n41924\n46010\n09118",
"output": "64592"
},
{
"input": "8 8\n68785928\n11981277\n32480720\n72495162\n69969623\n42118868\n64235849\n81412116",
"output": "52901157"
},
{
"input": "7 1\n1\n0\n8\n5\n4\n9\n8",
"output": "9"
},
{
"input": "3 8\n34848224\n16307102\n25181102",
"output": "8612277"
},
{
"input": "2 8\n13633861\n68468345",
"output": "14445725"
},
{
"input": "4 4\n0950\n0634\n9264\n8684",
"output": "3738"
},
{
"input": "6 5\n65777\n80932\n32260\n49089\n00936\n85557",
"output": "41439"
},
{
"input": "5 6\n687443\n279213\n765651\n611680\n500192",
"output": "258067"
},
{
"input": "8 6\n034753\n917195\n222679\n778596\n980006\n467267\n482763\n807481",
"output": "647026"
},
{
"input": "8 6\n075967\n240855\n352399\n791547\n103244\n982259\n409866\n926586",
"output": "491255"
},
{
"input": "3 1\n7\n2\n9",
"output": "7"
},
{
"input": "6 4\n5407\n4617\n3050\n7647\n8647\n1993",
"output": "6474"
},
{
"input": "8 5\n47553\n55138\n81768\n78902\n50691\n73010\n93969\n01675",
"output": "71123"
},
{
"input": "8 7\n5945843\n9094433\n0750024\n6255984\n1784849\n7275947\n6513944\n0145523",
"output": "5152379"
},
{
"input": "8 7\n8112819\n8982110\n5457941\n4575033\n5203331\n7410823\n0532182\n8151054",
"output": "6194602"
},
{
"input": "8 8\n63315032\n20587190\n05461152\n76872565\n71177578\n53541174\n00451913\n85740357",
"output": "60622457"
},
{
"input": "2 3\n135\n725",
"output": "4"
},
{
"input": "7 1\n9\n5\n8\n9\n7\n6\n9",
"output": "4"
},
{
"input": "5 3\n560\n978\n543\n846\n714",
"output": "435"
},
{
"input": "7 2\n53\n74\n84\n62\n14\n77\n59",
"output": "69"
},
{
"input": "3 4\n0537\n2174\n5299",
"output": "3583"
},
{
"input": "7 5\n13532\n16394\n97663\n73133\n22712\n58185\n65035",
"output": "26455"
},
{
"input": "8 5\n07936\n07927\n46068\n99158\n90958\n41283\n59266\n87841",
"output": "52364"
},
{
"input": "8 6\n867468\n695388\n700723\n444270\n545657\n178053\n315040\n554471",
"output": "559559"
},
{
"input": "7 7\n6575460\n6965366\n1912357\n7080608\n2561692\n5209630\n0439095",
"output": "5917123"
},
{
"input": "1 2\n96",
"output": "0"
},
{
"input": "1 3\n289",
"output": "0"
},
{
"input": "1 8\n78795220",
"output": "0"
},
{
"input": "8 7\n2407792\n7023368\n2609925\n0587109\n3543873\n6602371\n4579875\n9893509",
"output": "6790457"
},
{
"input": "4 6\n065169\n150326\n924608\n490012",
"output": "488134"
},
{
"input": "4 4\n8851\n6190\n0521\n1659",
"output": "6596"
},
{
"input": "4 4\n4381\n3147\n7017\n5593",
"output": "3690"
},
{
"input": "8 4\n0344\n9196\n1379\n5470\n0989\n8316\n7096\n7918",
"output": "7801"
},
{
"input": "1 6\n430254",
"output": "0"
},
{
"input": "8 1\n4\n0\n8\n5\n9\n0\n4\n7",
"output": "9"
},
{
"input": "5 2\n60\n08\n77\n66\n03",
"output": "74"
},
{
"input": "3 1\n9\n8\n2",
"output": "7"
},
{
"input": "7 2\n89\n00\n59\n90\n99\n22\n55",
"output": "99"
},
{
"input": "2 4\n7694\n6577",
"output": "712"
},
{
"input": "8 8\n68785928\n11981277\n32480720\n72495162\n69969623\n42118868\n64235849\n81412116",
"output": "52901157"
},
{
"input": "2 7\n9183508\n9276377",
"output": "26912"
},
{
"input": "5 4\n7411\n3080\n9578\n5902\n3225",
"output": "6498"
},
{
"input": "3 4\n0136\n4556\n4268",
"output": "2134"
},
{
"input": "6 8\n99358096\n38390629\n71597322\n35940809\n48949759\n66204248",
"output": "53570178"
},
{
"input": "7 2\n23\n11\n88\n25\n22\n45\n10",
"output": "78"
},
{
"input": "2 3\n834\n630",
"output": "24"
},
{
"input": "4 2\n87\n03\n95\n23",
"output": "48"
},
{
"input": "2 8\n10715643\n97664296",
"output": "1244714"
},
{
"input": "6 1\n9\n3\n1\n3\n4\n5",
"output": "8"
},
{
"input": "8 5\n47553\n55138\n81768\n78902\n50691\n73010\n93969\n01675",
"output": "71123"
},
{
"input": "4 4\n7603\n0859\n5241\n7680",
"output": "5518"
},
{
"input": "1 7\n4605461",
"output": "0"
},
{
"input": "3 4\n3061\n3404\n6670",
"output": "2916"
},
{
"input": "8 4\n1847\n0962\n3216\n0772\n6399\n3082\n7997\n0625",
"output": "7246"
},
{
"input": "2 6\n834527\n764560",
"output": "577"
},
{
"input": "5 6\n959808\n303464\n414335\n758650\n828038",
"output": "486245"
},
{
"input": "4 1\n0\n7\n5\n1",
"output": "7"
},
{
"input": "6 7\n4565736\n9842969\n1412800\n6411011\n5744909\n3791659",
"output": "4066781"
},
{
"input": "4 1\n0\n7\n5\n1",
"output": "7"
},
{
"input": "1 3\n250",
"output": "0"
},
{
"input": "2 1\n2\n0",
"output": "2"
},
{
"input": "8 8\n96805230\n73119021\n06552907\n86283347\n88650846\n19155689\n37032451\n19310120",
"output": "53604668"
},
{
"input": "3 2\n64\n94\n65",
"output": "10"
},
{
"input": "8 4\n8008\n4983\n0295\n0353\n5838\n1960\n0270\n7144",
"output": "7475"
},
{
"input": "4 8\n22025344\n54085308\n77633421\n59238322",
"output": "7681556"
},
{
"input": "5 3\n504\n878\n599\n683\n083",
"output": "615"
},
{
"input": "5 4\n7663\n4755\n2941\n4588\n0232",
"output": "5346"
},
{
"input": "6 2\n97\n57\n40\n99\n22\n94",
"output": "77"
},
{
"input": "6 7\n4104025\n1370353\n3472874\n5258456\n5595923\n0279404",
"output": "2790148"
},
{
"input": "8 2\n42\n86\n25\n30\n27\n64\n67\n38",
"output": "61"
},
{
"input": "5 2\n52\n22\n05\n37\n74",
"output": "51"
},
{
"input": "2 2\n63\n50",
"output": "13"
},
{
"input": "6 7\n4104025\n1370353\n3472874\n5258456\n5595923\n0279404",
"output": "2790148"
},
{
"input": "6 2\n95\n56\n06\n46\n77\n51",
"output": "62"
},
{
"input": "3 5\n97424\n96460\n47766",
"output": "9536"
},
{
"input": "2 3\n596\n246",
"output": "35"
},
{
"input": "3 1\n1\n2\n2",
"output": "1"
},
{
"input": "4 2\n87\n03\n95\n23",
"output": "48"
},
{
"input": "7 5\n41078\n41257\n35324\n70082\n66783\n99954\n85784",
"output": "56901"
},
{
"input": "8 7\n8943041\n2427704\n3775080\n2956111\n1345704\n0937172\n1979973\n7081540",
"output": "3544246"
},
{
"input": "6 6\n505845\n903151\n055779\n733849\n508266\n029177",
"output": "249045"
},
{
"input": "4 4\n1871\n9417\n7444\n4294",
"output": "5368"
},
{
"input": "2 5\n60106\n07866",
"output": "5224"
},
{
"input": "3 3\n195\n860\n567",
"output": "258"
},
{
"input": "8 5\n68186\n57779\n78079\n47451\n69788\n82172\n75373\n50157",
"output": "32237"
},
{
"input": "4 7\n5342341\n5194611\n4032103\n8739798",
"output": "4056779"
},
{
"input": "4 8\n91401735\n53979237\n20857777\n94594293",
"output": "34567247"
},
{
"input": "1 2\n95",
"output": "0"
},
{
"input": "6 4\n0443\n7108\n7211\n4287\n6439\n7711",
"output": "5301"
},
{
"input": "6 7\n5794383\n4078451\n0263676\n7682294\n7436158\n3363189",
"output": "3560125"
},
{
"input": "2 5\n07259\n51985",
"output": "23657"
},
{
"input": "3 3\n624\n125\n097",
"output": "247"
},
{
"input": "8 1\n9\n7\n6\n2\n9\n6\n4\n8",
"output": "7"
},
{
"input": "6 3\n530\n862\n874\n932\n972\n157",
"output": "442"
},
{
"input": "3 2\n51\n39\n97",
"output": "58"
},
{
"input": "8 4\n4650\n1735\n4269\n8023\n0948\n9685\n3675\n6017",
"output": "6836"
},
{
"input": "5 3\n168\n513\n110\n386\n501",
"output": "403"
},
{
"input": "6 2\n01\n81\n60\n27\n23\n67",
"output": "70"
},
{
"input": "4 4\n2759\n7250\n3572\n8067",
"output": "2028"
},
{
"input": "8 5\n12658\n00588\n23491\n09985\n63973\n78517\n98187\n29863",
"output": "68592"
},
{
"input": "3 1\n5\n4\n2",
"output": "3"
},
{
"input": "7 8\n24925537\n07626274\n77060131\n82415056\n70422753\n60455207\n32176884",
"output": "54680138"
},
{
"input": "5 8\n94157433\n85577189\n62547277\n11815893\n35445851",
"output": "15679126"
},
{
"input": "5 5\n31164\n27213\n17981\n48806\n01273",
"output": "33367"
},
{
"input": "3 6\n743197\n172242\n635654",
"output": "261245"
},
{
"input": "4 6\n760130\n653002\n902824\n380915",
"output": "268111"
},
{
"input": "8 8\n83239439\n62184887\n58968944\n39808261\n68740623\n38480328\n81965504\n52600488",
"output": "44481119"
},
{
"input": "8 2\n99\n20\n22\n39\n33\n60\n54\n08",
"output": "91"
},
{
"input": "1 7\n3545113",
"output": "0"
},
{
"input": "6 7\n3761949\n8095136\n4875085\n5017784\n4459097\n4354762",
"output": "4126934"
},
{
"input": "6 8\n50157346\n63836375\n03176371\n83637145\n28631038\n18617159",
"output": "24702445"
},
{
"input": "1 5\n84932",
"output": "0"
},
{
"input": "4 3\n204\n515\n280\n840",
"output": "467"
},
{
"input": "8 2\n40\n41\n02\n55\n26\n52\n60\n25",
"output": "58"
},
{
"input": "2 5\n90526\n32565",
"output": "586"
},
{
"input": "4 4\n3058\n2370\n0288\n5983",
"output": "2972"
},
{
"input": "6 7\n9085507\n7716507\n1952887\n6569746\n1900754\n9212439",
"output": "3180457"
},
{
"input": "5 2\n01\n07\n63\n71\n99",
"output": "89"
},
{
"input": "6 4\n4505\n3672\n4248\n2783\n9780\n6579",
"output": "4484"
},
{
"input": "2 3\n281\n498",
"output": "127"
},
{
"input": "8 5\n16966\n36762\n49579\n71703\n66646\n41125\n94022\n26623",
"output": "66868"
},
{
"input": "1 6\n170086",
"output": "0"
},
{
"input": "4 1\n4\n2\n2\n2",
"output": "2"
},
{
"input": "3 8\n12418144\n74773130\n10504811",
"output": "22901234"
},
{
"input": "6 7\n3761949\n8095136\n4875085\n5017784\n4459097\n4354762",
"output": "4126934"
}
] | 1,688,796,440 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 4 | 1,000 | 5,017,600 | from itertools import permutations
n, k = map(int, input().split())
a = []
for _ in range(n):
a.append(list(input()))
s = ''.join([str(x) for x in range(k)])
prm = list(permutations(s))
inf = int(1e9)
min_delta = inf
for p in prm:
min_val = inf
max_val = 0
for x in a:
num = ''
for i in range(k):
num += x[int(p[i])]
num = int(num)
max_val = max(max_val, num)
min_val = min(min_val, num)
min_delta = min(min_delta, max_val - min_val)
print(min_delta)
| Title: Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* *k*-digit integers. You have to rearrange the digits in the integers so that the difference between the largest and the smallest number was minimum. Digits should be rearranged by the same rule in all integers.
Input Specification:
The first line contains integers *n* and *k* — the number and digit capacity of numbers correspondingly (1<=≤<=*n*,<=*k*<=≤<=8). Next *n* lines contain *k*-digit positive integers. Leading zeroes are allowed both in the initial integers and the integers resulting from the rearranging of digits.
Output Specification:
Print a single number: the minimally possible difference between the largest and the smallest number after the digits are rearranged in all integers by the same rule.
Demo Input:
['6 4\n5237\n2753\n7523\n5723\n5327\n2537\n', '3 3\n010\n909\n012\n', '7 5\n50808\n36603\n37198\n44911\n29994\n42543\n50156\n']
Demo Output:
['2700\n', '3\n', '20522\n']
Note:
In the first sample, if we rearrange the digits in numbers as (3,1,4,2), then the 2-nd and the 4-th numbers will equal 5237 and 2537 correspondingly (they will be maximum and minimum for such order of digits).
In the second sample, if we swap the second digits and the first ones, we get integers 100, 99 and 102. | ```python
from itertools import permutations
n, k = map(int, input().split())
a = []
for _ in range(n):
a.append(list(input()))
s = ''.join([str(x) for x in range(k)])
prm = list(permutations(s))
inf = int(1e9)
min_delta = inf
for p in prm:
min_val = inf
max_val = 0
for x in a:
num = ''
for i in range(k):
num += x[int(p[i])]
num = int(num)
max_val = max(max_val, num)
min_val = min(min_val, num)
min_delta = min(min_delta, max_val - min_val)
print(min_delta)
``` | 0 |
|
339 | B | Xenia and Ringroad | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time. | The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=*n*). Note that Xenia can have multiple consecutive tasks in one house. | Print a single integer — the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"4 3\n3 2 3\n",
"4 3\n2 3 3\n"
] | [
"6\n",
"2\n"
] | In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1 → 2 → 3 → 4 → 1 → 2 → 3. This is optimal sequence. So, she needs 6 time units. | 1,000 | [
{
"input": "4 3\n3 2 3",
"output": "6"
},
{
"input": "4 3\n2 3 3",
"output": "2"
},
{
"input": "2 2\n1 1",
"output": "0"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "100 100\n56 46 1 47 5 86 45 35 81 1 31 70 67 70 62 99 100 47 44 33 78 35 32 37 92 12 95 18 3 22 54 24 22 90 25 22 78 88 51 92 46 84 15 29 28 40 8 5 93 68 77 47 45 76 85 39 84 94 52 69 93 64 31 60 99 17 51 59 62 37 46 47 86 60 88 14 68 22 47 93 50 10 55 87 46 50 43 63 44 43 61 65 91 43 33 97 67 57 66 70",
"output": "4869"
},
{
"input": "78 58\n23 14 73 45 47 14 27 59 65 39 15 23 5 1 50 37 3 51 46 69 75 65 45 68 48 59 77 39 53 21 72 33 46 32 34 5 69 55 56 53 47 31 32 5 42 23 76 15 2 77 65 24 16 68 61 28 55 10",
"output": "2505"
},
{
"input": "14 54\n9 13 14 9 5 12 4 7 3 14 5 12 13 1 1 11 10 2 7 9 5 2 2 8 10 7 3 9 5 11 2 2 6 12 11 5 4 11 11 6 2 11 14 13 8 7 13 9 4 9 11 3 7 13",
"output": "362"
},
{
"input": "100 100\n48 73 63 16 49 88 36 17 66 6 87 13 94 52 58 70 71 52 7 70 25 42 24 36 57 9 79 26 75 39 13 14 38 26 33 66 88 28 75 98 53 48 67 54 63 25 69 87 88 32 72 17 36 35 29 67 74 89 70 47 20 90 78 13 94 57 32 73 29 74 45 78 85 64 81 56 12 65 19 67 34 86 55 71 41 33 76 13 100 47 44 76 86 78 37 15 26 98 83 98",
"output": "4997"
},
{
"input": "99 100\n88 65 10 91 18 35 58 49 42 2 22 57 74 31 53 24 27 93 45 4 71 2 69 39 21 90 97 89 45 73 20 45 82 98 35 90 37 76 68 26 21 65 95 63 24 74 50 59 3 93 65 6 30 37 62 71 18 88 40 12 56 40 89 56 38 71 90 41 97 43 44 23 19 22 10 80 3 24 32 85 26 65 70 60 76 85 66 68 74 11 64 88 12 63 16 15 79 57 93 58",
"output": "4809"
},
{
"input": "65 100\n53 14 5 10 32 60 31 52 52 56 38 6 8 17 52 23 59 3 18 28 15 2 46 26 8 2 40 6 58 30 28 46 49 23 47 24 9 53 3 47 55 12 36 49 12 24 54 55 58 7 50 42 15 4 58 49 34 40 19 4 59 19 31 17 35 65 36 50 45 5 33 11 29 52 55 40 48 11 32 41 31 7 46 55 32 41 56 51 39 13 5 59 58 34 38 50 55 10 43 30",
"output": "3149"
},
{
"input": "10 100\n7 6 2 10 7 2 3 8 10 4 6 1 4 5 7 10 1 2 3 5 4 10 8 2 3 3 6 8 3 9 4 1 9 10 1 2 5 1 8 8 5 9 2 8 1 2 3 2 1 10 10 7 1 3 2 2 7 1 6 6 6 9 2 3 1 7 2 2 9 7 3 3 2 10 7 4 7 3 3 3 2 4 4 2 2 8 4 1 10 10 5 10 6 10 6 10 3 10 8 9",
"output": "428"
},
{
"input": "2 100\n1 1 2 2 2 2 1 2 1 2 2 2 1 1 2 2 2 2 1 1 2 1 2 2 1 1 2 2 2 1 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 1 1 2 2 1 2 1 2 2 2 1 1 1 1 1 2 2 2 1 1 2 2 1 1 2 2 1 1 2 1 1 1 1 2 2 1 1 1 2 1 1 1 1 1 1 1 2",
"output": "47"
},
{
"input": "67 100\n49 5 25 48 37 55 5 33 14 30 59 28 57 46 45 32 47 22 40 28 58 34 27 29 4 52 63 44 31 65 42 61 11 17 32 17 18 1 12 33 38 11 59 46 43 55 23 30 23 2 42 21 45 51 30 19 35 15 10 30 13 21 32 34 33 3 5 59 23 63 6 9 20 43 64 3 42 41 40 4 14 20 40 33 25 44 1 2 50 46 13 10 3 20 22 64 28 42 58 30",
"output": "3245"
},
{
"input": "100 100\n81 62 26 90 7 87 60 35 75 81 54 94 53 71 64 80 58 83 53 70 40 96 87 50 37 63 5 77 83 75 53 28 22 98 52 45 72 70 62 21 1 99 37 93 16 98 68 27 96 37 21 83 92 23 62 96 85 31 85 66 38 77 45 16 90 86 6 21 75 42 18 60 2 17 51 61 94 68 97 79 17 59 66 14 87 78 70 40 63 78 58 22 87 7 90 17 20 97 9 31",
"output": "5530"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 10\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "2 10\n1 1 1 2 2 2 1 1 1 2",
"output": "3"
},
{
"input": "3 6\n1 2 3 3 2 1",
"output": "6"
}
] | 1,698,151,587 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 6 | 2,000 | 11,059,200 | n, m=map(int, input().split())
a=map(int,input().split())
# lijst_a=list(a)
new_lijst=[]
output=0
pre_test_var=0
for i, var in enumerate(a):
#print(var)
if i==0:
pre_test_var=var
elif var >= pre_test_var:
pre_test_var=var
else:
while var < pre_test_var:
var=var+n
pre_test_var=var
output=var
# print(new_lijst)
#output=max(new_lijst) - 1
print(output-1) | Title: Xenia and Ringroad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia lives in a city that has *n* houses built along the main ringroad. The ringroad houses are numbered 1 through *n* in the clockwise order. The ringroad traffic is one way and also is clockwise.
Xenia has recently moved into the ringroad house number 1. As a result, she's got *m* things to do. In order to complete the *i*-th task, she needs to be in the house number *a**i* and complete all tasks with numbers less than *i*. Initially, Xenia is in the house number 1, find the minimum time she needs to complete all her tasks if moving from a house to a neighboring one along the ringroad takes one unit of time.
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=1<=≤<=*m*<=≤<=105). The second line contains *m* integers *a*1,<=*a*2,<=...,<=*a**m* (1<=≤<=*a**i*<=≤<=*n*). Note that Xenia can have multiple consecutive tasks in one house.
Output Specification:
Print a single integer — the time Xenia needs to complete all tasks.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n3 2 3\n', '4 3\n2 3 3\n']
Demo Output:
['6\n', '2\n']
Note:
In the first test example the sequence of Xenia's moves along the ringroad looks as follows: 1 → 2 → 3 → 4 → 1 → 2 → 3. This is optimal sequence. So, she needs 6 time units. | ```python
n, m=map(int, input().split())
a=map(int,input().split())
# lijst_a=list(a)
new_lijst=[]
output=0
pre_test_var=0
for i, var in enumerate(a):
#print(var)
if i==0:
pre_test_var=var
elif var >= pre_test_var:
pre_test_var=var
else:
while var < pre_test_var:
var=var+n
pre_test_var=var
output=var
# print(new_lijst)
#output=max(new_lijst) - 1
print(output-1)
``` | 0 |
|
171 | D | Broken checker | PROGRAMMING | 1,300 | [
"*special",
"brute force"
] | null | null | "This problem is rubbish! There is not statement, and there are only 5 test cases. The problemsetter took liberties with this problem!" — people complained in the comments to one round on Codeforces. And even more... No, wait, the checker for the problem was alright, that's a mercy. | The only line of the input contains an integer between 1 and 5, inclusive. All tests for this problem are different. The contents of the test case doesn't need to be equal to its index. | The only line of the output contains an integer between 1 and 3, inclusive. | [] | [] | This problem has no samples, since there so few test cases. | 0 | [
{
"input": "3",
"output": "1"
},
{
"input": "1",
"output": "2"
},
{
"input": "4",
"output": "2"
},
{
"input": "2",
"output": "3"
},
{
"input": "5",
"output": "1"
}
] | 1,561,462,990 | 2,147,483,647 | Python 3 | OK | TESTS | 5 | 216 | 0 | print((int(input())%5)%3+1) | Title: Broken checker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"This problem is rubbish! There is not statement, and there are only 5 test cases. The problemsetter took liberties with this problem!" — people complained in the comments to one round on Codeforces. And even more... No, wait, the checker for the problem was alright, that's a mercy.
Input Specification:
The only line of the input contains an integer between 1 and 5, inclusive. All tests for this problem are different. The contents of the test case doesn't need to be equal to its index.
Output Specification:
The only line of the output contains an integer between 1 and 3, inclusive.
Note:
This problem has no samples, since there so few test cases. | ```python
print((int(input())%5)%3+1)
``` | 3 |
|
721 | B | Passwords | PROGRAMMING | 1,100 | [
"implementation",
"math",
"sortings",
"strings"
] | null | null | Vanya is managed to enter his favourite site Codehorses. Vanya uses *n* distinct passwords for sites at all, however he can't remember which one exactly he specified during Codehorses registration.
Vanya will enter passwords in order of non-decreasing their lengths, and he will enter passwords of same length in arbitrary order. Just when Vanya will have entered the correct password, he is immediately authorized on the site. Vanya will not enter any password twice.
Entering any passwords takes one second for Vanya. But if Vanya will enter wrong password *k* times, then he is able to make the next try only 5 seconds after that. Vanya makes each try immediately, that is, at each moment when Vanya is able to enter password, he is doing that.
Determine how many seconds will Vanya need to enter Codehorses in the best case for him (if he spends minimum possible number of second) and in the worst case (if he spends maximum possible amount of seconds). | The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of Vanya's passwords and the number of failed tries, after which the access to the site is blocked for 5 seconds.
The next *n* lines contains passwords, one per line — pairwise distinct non-empty strings consisting of latin letters and digits. Each password length does not exceed 100 characters.
The last line of the input contains the Vanya's Codehorses password. It is guaranteed that the Vanya's Codehorses password is equal to some of his *n* passwords. | Print two integers — time (in seconds), Vanya needs to be authorized to Codehorses in the best case for him and in the worst case respectively. | [
"5 2\ncba\nabc\nbb1\nabC\nABC\nabc\n",
"4 100\n11\n22\n1\n2\n22\n"
] | [
"1 15\n",
"3 4\n"
] | Consider the first sample case. As soon as all passwords have the same length, Vanya can enter the right password at the first try as well as at the last try. If he enters it at the first try, he spends exactly 1 second. Thus in the best case the answer is 1. If, at the other hand, he enters it at the last try, he enters another 4 passwords before. He spends 2 seconds to enter first 2 passwords, then he waits 5 seconds as soon as he made 2 wrong tries. Then he spends 2 more seconds to enter 2 wrong passwords, again waits 5 seconds and, finally, enters the correct password spending 1 more second. In summary in the worst case he is able to be authorized in 15 seconds.
Consider the second sample case. There is no way of entering passwords and get the access to the site blocked. As soon as the required password has length of 2, Vanya enters all passwords of length 1 anyway, spending 2 seconds for that. Then, in the best case, he immediately enters the correct password and the answer for the best case is 3, but in the worst case he enters wrong password of length 2 and only then the right one, spending 4 seconds at all. | 1,000 | [
{
"input": "5 2\ncba\nabc\nbb1\nabC\nABC\nabc",
"output": "1 15"
},
{
"input": "4 100\n11\n22\n1\n2\n22",
"output": "3 4"
},
{
"input": "1 1\na1\na1",
"output": "1 1"
},
{
"input": "1 100\na1\na1",
"output": "1 1"
},
{
"input": "2 1\nabc\nAbc\nAbc",
"output": "1 7"
},
{
"input": "2 2\nabc\nAbc\nabc",
"output": "1 2"
},
{
"input": "2 1\nab\nabc\nab",
"output": "1 1"
},
{
"input": "2 2\nab\nabc\nab",
"output": "1 1"
},
{
"input": "2 1\nab\nabc\nabc",
"output": "7 7"
},
{
"input": "2 2\nab\nabc\nabc",
"output": "2 2"
},
{
"input": "10 3\nOIbV1igi\no\nZS\nQM\n9woLzI\nWreboD\nQ7yl\nA5Rb\nS9Lno72TkP\nfT97o\no",
"output": "1 1"
},
{
"input": "10 3\nHJZNMsT\nLaPcH2C\nlrhqIO\n9cxw\noTC1XwjW\nGHL9Ul6\nUyIs\nPuzwgR4ZKa\nyIByoKR5\nd3QA\nPuzwgR4ZKa",
"output": "25 25"
},
{
"input": "20 5\nvSyC787KlIL8kZ2Uv5sw\nWKWOP\n7i8J3E8EByIq\nNW2VyGweL\nmyR2sRNu\nmXusPP0\nf4jgGxra\n4wHRzRhOCpEt\npPz9kybGb\nOtSpePCRoG5nkjZ2VxRy\nwHYsSttWbJkg\nKBOP9\nQfiOiFyHPPsw3GHo8J8\nxB8\nqCpehZEeEhdq\niOLjICK6\nQ91\nHmCsfMGTFKoFFnv238c\nJKjhg\ngkEUh\nKBOP9",
"output": "3 11"
},
{
"input": "15 2\nw6S9WyU\nMVh\nkgUhQHW\nhGQNOF\nUuym\n7rGQA\nBM8vLPRB\n9E\nDs32U\no\nz1aV2C5T\n8\nzSXjrqQ\n1FO\n3kIt\nBM8vLPRB",
"output": "44 50"
},
{
"input": "20 2\ni\n5Rp6\nE4vsr\nSY\nORXx\nh13C\nk6tzC\ne\nN\nKQf4C\nWZcdL\ndiA3v\n0InQT\nuJkAr\nGCamp\nBuIRd\nY\nM\nxZYx7\n0a5A\nWZcdL",
"output": "36 65"
},
{
"input": "20 2\naWLQ6\nSgQ9r\nHcPdj\n2BNaO\n3TjNb\nnvwFM\nqsKt7\nFnb6N\nLoc0p\njxuLq\nBKAjf\nEKgZB\nBfOSa\nsMIvr\nuIWcR\nIura3\nLAqSf\ntXq3G\n8rQ8I\n8otAO\nsMIvr",
"output": "1 65"
},
{
"input": "20 15\n0ZpQugVlN7\nm0SlKGnohN\nRFXTqhNGcn\n1qm2ZbB\nQXtJWdf78P\nbc2vH\nP21dty2Z1P\nm2c71LFhCk\n23EuP1Dvh3\nanwri5RhQN\n55v6HYv288\n1u5uKOjM5r\n6vg0GC1\nDAPYiA3ns1\nUZaaJ3Gmnk\nwB44x7V4Zi\n4hgB2oyU8P\npYFQpy8gGK\ndbz\nBv\n55v6HYv288",
"output": "6 25"
},
{
"input": "3 1\na\nb\naa\naa",
"output": "13 13"
},
{
"input": "6 3\nab\nac\nad\nabc\nabd\nabe\nabc",
"output": "9 11"
},
{
"input": "4 2\n1\n2\n11\n22\n22",
"output": "8 9"
},
{
"input": "2 1\n1\n12\n12",
"output": "7 7"
},
{
"input": "3 1\nab\nabc\nabd\nabc",
"output": "7 13"
},
{
"input": "2 1\na\nab\nab",
"output": "7 7"
},
{
"input": "5 2\na\nb\nc\nab\naa\naa",
"output": "9 15"
},
{
"input": "6 1\n1\n2\n11\n22\n111\n2222\n22",
"output": "13 19"
},
{
"input": "3 1\n1\n2\n11\n11",
"output": "13 13"
},
{
"input": "10 4\na\nb\nc\nd\ne\nf\nab\ncd\nac\nad\nac",
"output": "12 20"
},
{
"input": "4 2\na\nb\nc\nd\na",
"output": "1 9"
},
{
"input": "4 1\n1\n2\n3\n4\n4",
"output": "1 19"
},
{
"input": "5 1\na\nb\nc\nd\nef\nef",
"output": "25 25"
},
{
"input": "6 4\n1\n2\n22\n33\n44\n555\n555",
"output": "11 11"
},
{
"input": "5 2\na\nb\nc\nd\nab\nab",
"output": "15 15"
},
{
"input": "6 2\n1\n2\n3\n4\n5\n23\n23",
"output": "16 16"
},
{
"input": "4 2\na\nb\naa\nbb\naa",
"output": "8 9"
},
{
"input": "5 4\na\nbb\ncc\ndd\nee\nbb",
"output": "2 10"
},
{
"input": "4 1\na\nb\nc\nab\nab",
"output": "19 19"
},
{
"input": "7 100\na\nb\nc\nd\ne\ng\nab\nab",
"output": "7 7"
},
{
"input": "6 1\na\nb\nc\nd\ne\naa\naa",
"output": "31 31"
},
{
"input": "4 1\na\nas\nasd\nasde\nasde",
"output": "19 19"
},
{
"input": "5 2\n1\n2\n3\n11\n22\n22",
"output": "9 15"
},
{
"input": "10 2\na\nb\nc\nd\nee\nff\ngg\nhh\nii\njj\nii",
"output": "15 30"
},
{
"input": "3 1\na\nab\nbc\nab",
"output": "7 13"
},
{
"input": "6 4\na\nb\nc\nbb\nbc\ncc\ncc",
"output": "4 11"
}
] | 1,569,593,427 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 139 | 0 | #https://codeforces.com/problemset/problem/90/B
'''
Comment
'''
if __name__ == "__main__":
n, k = map(int, input().split())
leng = [0 for _ in range(105)]
for _ in range(n):
line = str(input())
leng[len(line)] += 1
line = str(input());
acPass = len(line)
summ = sum(leng[1: acPass + 1])
res1 = (summ - leng[acPass] + 1) + int((summ - leng[acPass] + 1) / k) * 5
res2 = summ + int(summ / k) * 5
print(res1, res2)
| Title: Passwords
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya is managed to enter his favourite site Codehorses. Vanya uses *n* distinct passwords for sites at all, however he can't remember which one exactly he specified during Codehorses registration.
Vanya will enter passwords in order of non-decreasing their lengths, and he will enter passwords of same length in arbitrary order. Just when Vanya will have entered the correct password, he is immediately authorized on the site. Vanya will not enter any password twice.
Entering any passwords takes one second for Vanya. But if Vanya will enter wrong password *k* times, then he is able to make the next try only 5 seconds after that. Vanya makes each try immediately, that is, at each moment when Vanya is able to enter password, he is doing that.
Determine how many seconds will Vanya need to enter Codehorses in the best case for him (if he spends minimum possible number of second) and in the worst case (if he spends maximum possible amount of seconds).
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of Vanya's passwords and the number of failed tries, after which the access to the site is blocked for 5 seconds.
The next *n* lines contains passwords, one per line — pairwise distinct non-empty strings consisting of latin letters and digits. Each password length does not exceed 100 characters.
The last line of the input contains the Vanya's Codehorses password. It is guaranteed that the Vanya's Codehorses password is equal to some of his *n* passwords.
Output Specification:
Print two integers — time (in seconds), Vanya needs to be authorized to Codehorses in the best case for him and in the worst case respectively.
Demo Input:
['5 2\ncba\nabc\nbb1\nabC\nABC\nabc\n', '4 100\n11\n22\n1\n2\n22\n']
Demo Output:
['1 15\n', '3 4\n']
Note:
Consider the first sample case. As soon as all passwords have the same length, Vanya can enter the right password at the first try as well as at the last try. If he enters it at the first try, he spends exactly 1 second. Thus in the best case the answer is 1. If, at the other hand, he enters it at the last try, he enters another 4 passwords before. He spends 2 seconds to enter first 2 passwords, then he waits 5 seconds as soon as he made 2 wrong tries. Then he spends 2 more seconds to enter 2 wrong passwords, again waits 5 seconds and, finally, enters the correct password spending 1 more second. In summary in the worst case he is able to be authorized in 15 seconds.
Consider the second sample case. There is no way of entering passwords and get the access to the site blocked. As soon as the required password has length of 2, Vanya enters all passwords of length 1 anyway, spending 2 seconds for that. Then, in the best case, he immediately enters the correct password and the answer for the best case is 3, but in the worst case he enters wrong password of length 2 and only then the right one, spending 4 seconds at all. | ```python
#https://codeforces.com/problemset/problem/90/B
'''
Comment
'''
if __name__ == "__main__":
n, k = map(int, input().split())
leng = [0 for _ in range(105)]
for _ in range(n):
line = str(input())
leng[len(line)] += 1
line = str(input());
acPass = len(line)
summ = sum(leng[1: acPass + 1])
res1 = (summ - leng[acPass] + 1) + int((summ - leng[acPass] + 1) / k) * 5
res2 = summ + int(summ / k) * 5
print(res1, res2)
``` | 0 |
|
965 | B | Battleship | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | Arkady is playing Battleship. The rules of this game aren't really important.
There is a field of $n \times n$ cells. There should be exactly one $k$-decker on the field, i. e. a ship that is $k$ cells long oriented either horizontally or vertically. However, Arkady doesn't know where it is located. For each cell Arkady knows if it is definitely empty or can contain a part of the ship.
Consider all possible locations of the ship. Find such a cell that belongs to the maximum possible number of different locations of the ship. | The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the size of the field and the size of the ship.
The next $n$ lines contain the field. Each line contains $n$ characters, each of which is either '#' (denotes a definitely empty cell) or '.' (denotes a cell that can belong to the ship). | Output two integers — the row and the column of a cell that belongs to the maximum possible number of different locations of the ship.
If there are multiple answers, output any of them. In particular, if no ship can be placed on the field, you can output any cell. | [
"4 3\n#..#\n#.#.\n....\n.###\n",
"10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#\n",
"19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#\n"
] | [
"3 2\n",
"6 1\n",
"1 8\n"
] | The picture below shows the three possible locations of the ship that contain the cell $(3, 2)$ in the first sample. | 1,000 | [
{
"input": "4 3\n#..#\n#.#.\n....\n.###",
"output": "3 2"
},
{
"input": "10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#",
"output": "6 1"
},
{
"input": "19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#",
"output": "1 8"
},
{
"input": "10 4\n##..######\n#...######\n#...######\n#......###\n#.......##\n.##.######\n.##.######\n.##.######\n.#....####\n....######",
"output": "4 4"
},
{
"input": "1 1\n.",
"output": "1 1"
},
{
"input": "1 1\n#",
"output": "1 1"
},
{
"input": "5 2\n..##.\n.###.\n#####\n#####\n..#..",
"output": "1 1"
},
{
"input": "5 2\n..##.\n####.\n#####\n.####\n..#..",
"output": "5 1"
},
{
"input": "5 2\n..##.\n####.\n#####\n####.\n..#..",
"output": "5 5"
},
{
"input": "5 2\n.##..\n.###.\n#####\n#####\n..#..",
"output": "1 5"
},
{
"input": "2 2\n##\n##",
"output": "1 1"
},
{
"input": "4 1\n####\n####\n####\n###.",
"output": "4 4"
},
{
"input": "2 2\n#.\n.#",
"output": "1 1"
},
{
"input": "3 3\n###\n##.\n###",
"output": "1 1"
},
{
"input": "4 4\n####\n####\n####\n####",
"output": "1 1"
},
{
"input": "4 3\n####\n####\n####\n####",
"output": "1 1"
},
{
"input": "3 1\n###\n###\n###",
"output": "1 1"
},
{
"input": "3 2\n###\n###\n###",
"output": "1 1"
},
{
"input": "3 3\n.#.\n#.#\n.#.",
"output": "1 1"
}
] | 1,526,139,590 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 77 | 7,065,600 | d=dict()
def func(ch,i,n,d,k):
c=0
for j in range(n):
if ch[j]==".":
c+=1
if (ch[j]=="." and j==n-1) or ch[j]!=".":
if c>=k:
for f in range(c-k+1):
for h in range(j+1-c+f+1,j+1-c+f+1+k):
key=str(i)+" "+str(h)
if key in d:
d[key]+=1
else:
d[key]=1
c=0
def fun2(ch,i,n,d,k):
c=0
for j in range(n):
if ch[j]==".":
c+=1
elif (ch[j]=="." and j==n-1) or ch[j]!=".":
if c>=k:
for f in range(c-k+1):
for h in range(j+1-c+f+1,j+1-c+f+1+k):
key=str(h)+" "+str(i)
if key in d:
d[key]+=1
else:
d[key]=1
c=0
n,k=map(int,input().split())
l=[""]*n
for i in range(n):
ch=input()
for h in range(n):
l[h]+=ch[h]
func(ch,i+1,n,d,k)
#print(l)
for stri in range(n):
#print(l[stri])
fun2(l[stri],stri+1,n,d,k)
m=0
maxkey=""
#print(list(d.keys()))
#print(d)
for key in d.keys():
#print(key)
if d[key]>m:
maxkey=key
m=d[key]
print(maxkey)
| Title: Battleship
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arkady is playing Battleship. The rules of this game aren't really important.
There is a field of $n \times n$ cells. There should be exactly one $k$-decker on the field, i. e. a ship that is $k$ cells long oriented either horizontally or vertically. However, Arkady doesn't know where it is located. For each cell Arkady knows if it is definitely empty or can contain a part of the ship.
Consider all possible locations of the ship. Find such a cell that belongs to the maximum possible number of different locations of the ship.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the size of the field and the size of the ship.
The next $n$ lines contain the field. Each line contains $n$ characters, each of which is either '#' (denotes a definitely empty cell) or '.' (denotes a cell that can belong to the ship).
Output Specification:
Output two integers — the row and the column of a cell that belongs to the maximum possible number of different locations of the ship.
If there are multiple answers, output any of them. In particular, if no ship can be placed on the field, you can output any cell.
Demo Input:
['4 3\n#..#\n#.#.\n....\n.###\n', '10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#\n', '19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#\n']
Demo Output:
['3 2\n', '6 1\n', '1 8\n']
Note:
The picture below shows the three possible locations of the ship that contain the cell $(3, 2)$ in the first sample. | ```python
d=dict()
def func(ch,i,n,d,k):
c=0
for j in range(n):
if ch[j]==".":
c+=1
if (ch[j]=="." and j==n-1) or ch[j]!=".":
if c>=k:
for f in range(c-k+1):
for h in range(j+1-c+f+1,j+1-c+f+1+k):
key=str(i)+" "+str(h)
if key in d:
d[key]+=1
else:
d[key]=1
c=0
def fun2(ch,i,n,d,k):
c=0
for j in range(n):
if ch[j]==".":
c+=1
elif (ch[j]=="." and j==n-1) or ch[j]!=".":
if c>=k:
for f in range(c-k+1):
for h in range(j+1-c+f+1,j+1-c+f+1+k):
key=str(h)+" "+str(i)
if key in d:
d[key]+=1
else:
d[key]=1
c=0
n,k=map(int,input().split())
l=[""]*n
for i in range(n):
ch=input()
for h in range(n):
l[h]+=ch[h]
func(ch,i+1,n,d,k)
#print(l)
for stri in range(n):
#print(l[stri])
fun2(l[stri],stri+1,n,d,k)
m=0
maxkey=""
#print(list(d.keys()))
#print(d)
for key in d.keys():
#print(key)
if d[key]>m:
maxkey=key
m=d[key]
print(maxkey)
``` | 0 |
|
592 | B | The Monster and the Squirrel | PROGRAMMING | 1,100 | [
"math"
] | null | null | Ari the monster always wakes up very early with the first ray of the sun and the first thing she does is feeding her squirrel.
Ari draws a regular convex polygon on the floor and numbers it's vertices 1,<=2,<=...,<=*n* in clockwise order. Then starting from the vertex 1 she draws a ray in the direction of each other vertex. The ray stops when it reaches a vertex or intersects with another ray drawn before. Ari repeats this process for vertex 2,<=3,<=...,<=*n* (in this particular order). And then she puts a walnut in each region inside the polygon.
Ada the squirrel wants to collect all the walnuts, but she is not allowed to step on the lines drawn by Ari. That means Ada have to perform a small jump if she wants to go from one region to another. Ada can jump from one region P to another region Q if and only if P and Q share a side or a corner.
Assuming that Ada starts from outside of the picture, what is the minimum number of jumps she has to perform in order to collect all the walnuts? | The first and only line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=54321) - the number of vertices of the regular polygon drawn by Ari. | Print the minimum number of jumps Ada should make to collect all the walnuts. Note, that she doesn't need to leave the polygon after. | [
"5\n",
"3\n"
] | [
"9\n",
"1\n"
] | One of the possible solutions for the first sample is shown on the picture above. | 1,000 | [
{
"input": "5",
"output": "9"
},
{
"input": "3",
"output": "1"
},
{
"input": "54321",
"output": "2950553761"
},
{
"input": "4",
"output": "4"
},
{
"input": "6",
"output": "16"
},
{
"input": "7",
"output": "25"
},
{
"input": "8",
"output": "36"
},
{
"input": "9",
"output": "49"
},
{
"input": "10",
"output": "64"
},
{
"input": "54320",
"output": "2950445124"
},
{
"input": "54319",
"output": "2950336489"
},
{
"input": "54318",
"output": "2950227856"
},
{
"input": "54317",
"output": "2950119225"
},
{
"input": "54316",
"output": "2950010596"
},
{
"input": "54315",
"output": "2949901969"
},
{
"input": "54314",
"output": "2949793344"
},
{
"input": "8153",
"output": "66438801"
},
{
"input": "51689",
"output": "2671545969"
},
{
"input": "16659",
"output": "277455649"
},
{
"input": "47389",
"output": "2245527769"
},
{
"input": "314",
"output": "97344"
},
{
"input": "23481",
"output": "551263441"
},
{
"input": "20380",
"output": "415262884"
},
{
"input": "1994",
"output": "3968064"
}
] | 1,470,346,984 | 2,147,483,647 | Python 3 | OK | TESTS | 24 | 62 | 4,608,000 | n = int(input()) - 2
print(n * n) | Title: The Monster and the Squirrel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ari the monster always wakes up very early with the first ray of the sun and the first thing she does is feeding her squirrel.
Ari draws a regular convex polygon on the floor and numbers it's vertices 1,<=2,<=...,<=*n* in clockwise order. Then starting from the vertex 1 she draws a ray in the direction of each other vertex. The ray stops when it reaches a vertex or intersects with another ray drawn before. Ari repeats this process for vertex 2,<=3,<=...,<=*n* (in this particular order). And then she puts a walnut in each region inside the polygon.
Ada the squirrel wants to collect all the walnuts, but she is not allowed to step on the lines drawn by Ari. That means Ada have to perform a small jump if she wants to go from one region to another. Ada can jump from one region P to another region Q if and only if P and Q share a side or a corner.
Assuming that Ada starts from outside of the picture, what is the minimum number of jumps she has to perform in order to collect all the walnuts?
Input Specification:
The first and only line of the input contains a single integer *n* (3<=≤<=*n*<=≤<=54321) - the number of vertices of the regular polygon drawn by Ari.
Output Specification:
Print the minimum number of jumps Ada should make to collect all the walnuts. Note, that she doesn't need to leave the polygon after.
Demo Input:
['5\n', '3\n']
Demo Output:
['9\n', '1\n']
Note:
One of the possible solutions for the first sample is shown on the picture above. | ```python
n = int(input()) - 2
print(n * n)
``` | 3 |
|
41 | A | Translation | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Translation | 2 | 256 | The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. | The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. | If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. | [
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,669,118,051 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 92 | 0 | k=input()
p=input()
rev=k[::-1]
if rev==p:
print('YES')
else:
print('NO')
| Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
k=input()
p=input()
rev=k[::-1]
if rev==p:
print('YES')
else:
print('NO')
``` | 3.977 |
66 | B | Petya and Countryside | PROGRAMMING | 1,100 | [
"brute force",
"implementation"
] | B. Petya and Countryside | 2 | 256 | Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000. | Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section. | [
"1\n2\n",
"5\n1 2 1 2 1\n",
"8\n1 2 1 1 1 3 3 4\n"
] | [
"1\n",
"3\n",
"6\n"
] | none | 1,000 | [
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 2 1 2 1",
"output": "3"
},
{
"input": "8\n1 2 1 1 1 3 3 4",
"output": "6"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "10"
},
{
"input": "2\n100 100",
"output": "2"
},
{
"input": "3\n100 100 100",
"output": "3"
},
{
"input": "11\n1 2 3 4 5 6 5 4 3 2 1",
"output": "11"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 100 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 1 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 1 82 83 84 85 86 87 88 89 90 91 92 93 94 100 5 4 3 2 1",
"output": "81"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 1 86 87 88 89 90 91 92 93 100 6 5 4 3 2 1",
"output": "85"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 1 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 100 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 100 8 7 6 1 4 3 2 1",
"output": "96"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 100 10 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 1 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 100 11 10 9 8 7 6 5 4 3 2 1",
"output": "55"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 1 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 100 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "59"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 100 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "86"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 100 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "83"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 100 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 1 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "74"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 100 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 100 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 1 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "52"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 100 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 1 2 1",
"output": "98"
},
{
"input": "10\n1 4 4 4 4 4 1 2 4 3",
"output": "7"
}
] | 1,663,988,665 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 92 | 0 | from sys import exit
n=int(input())
s=list(map(int,input().split()))
z=[]
for i in range(n):
if n==1:
print(1)
exit()
else:
c=0
x=s[i]
if i ==0:
for j in range(n):
if s[j]<=x:
c+=1
x=s[j]
if j==n-1:
break
else:
z.append(c)
break
elif i==n-1:
for j in range(n-1,-1,-1):
if s[j]<=x:
c+=1
x=s[j]
if j==0:
z.append(c)
break
else:
z.append(c)
break
else:
for j in range(i,n):
if s[j]<=x:
c+=1
x=s[j]
else:
break
for j in range(i,-1,-1):
if j<=x:
c+=1
x=s[j]
else:
break
z.append(c-1)
print(max(z))
| Title: Petya and Countryside
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
Output Specification:
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
Demo Input:
['1\n2\n', '5\n1 2 1 2 1\n', '8\n1 2 1 1 1 3 3 4\n']
Demo Output:
['1\n', '3\n', '6\n']
Note:
none | ```python
from sys import exit
n=int(input())
s=list(map(int,input().split()))
z=[]
for i in range(n):
if n==1:
print(1)
exit()
else:
c=0
x=s[i]
if i ==0:
for j in range(n):
if s[j]<=x:
c+=1
x=s[j]
if j==n-1:
break
else:
z.append(c)
break
elif i==n-1:
for j in range(n-1,-1,-1):
if s[j]<=x:
c+=1
x=s[j]
if j==0:
z.append(c)
break
else:
z.append(c)
break
else:
for j in range(i,n):
if s[j]<=x:
c+=1
x=s[j]
else:
break
for j in range(i,-1,-1):
if j<=x:
c+=1
x=s[j]
else:
break
z.append(c-1)
print(max(z))
``` | 0 |
837 | A | Text Volume | PROGRAMMING | 800 | [
"implementation"
] | null | null | You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text. | The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters. | Print one integer number — volume of text. | [
"7\nNonZERO\n",
"24\nthis is zero answer text\n",
"24\nHarbour Space University\n"
] | [
"5\n",
"0\n",
"1\n"
] | In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters. | 0 | [
{
"input": "7\nNonZERO",
"output": "5"
},
{
"input": "24\nthis is zero answer text",
"output": "0"
},
{
"input": "24\nHarbour Space University",
"output": "1"
},
{
"input": "2\nWM",
"output": "2"
},
{
"input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz",
"output": "105"
},
{
"input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g",
"output": "1"
},
{
"input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez",
"output": "50"
},
{
"input": "1\ne",
"output": "0"
},
{
"input": "1\nA",
"output": "1"
},
{
"input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ",
"output": "10"
},
{
"input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "200"
},
{
"input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "24\nHarbour Space UniversitY",
"output": "2"
},
{
"input": "5\naA AA",
"output": "2"
},
{
"input": "10\nas AS ASDA",
"output": "4"
},
{
"input": "10\nas AS ASDZ",
"output": "4"
},
{
"input": "3\na A",
"output": "1"
},
{
"input": "24\nHarbour space UniversitY",
"output": "2"
},
{
"input": "10\nas AS ASAa",
"output": "3"
},
{
"input": "15\naAb ABCDFGRHTJS",
"output": "11"
},
{
"input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR",
"output": "6"
},
{
"input": "10\nABC ABc AB",
"output": "3"
},
{
"input": "10\nA c de CDE",
"output": "3"
},
{
"input": "4\nA AB",
"output": "2"
},
{
"input": "18\nHARbour Space UNIV",
"output": "4"
},
{
"input": "13\na b c d e f A",
"output": "1"
},
{
"input": "6\nA B CA",
"output": "2"
},
{
"input": "4\naa A",
"output": "1"
},
{
"input": "3\nA a",
"output": "1"
}
] | 1,628,935,154 | 2,147,483,647 | Python 3 | OK | TESTS | 29 | 62 | 6,758,400 | n = int(input())
s = input().split()
mx = 0
for w in s:
c = 0
for x in w:
if x.isupper():
c += 1
if c > mx:
mx = c
print(mx) | Title: Text Volume
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Output Specification:
Print one integer number — volume of text.
Demo Input:
['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n']
Demo Output:
['5\n', '0\n', '1\n']
Note:
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters. | ```python
n = int(input())
s = input().split()
mx = 0
for w in s:
c = 0
for x in w:
if x.isupper():
c += 1
if c > mx:
mx = c
print(mx)
``` | 3 |
|
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,693,646,807 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | w=input()
if w%2=0 and w>2:
print("YES)
else:
print("NO") | Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
w=input()
if w%2=0 and w>2:
print("YES)
else:
print("NO")
``` | -1 |
760 | A | Petr and a calendar | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap. | The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday). | Print single integer: the number of columns the table should have. | [
"1 7\n",
"1 1\n",
"11 6\n"
] | [
"6\n",
"5\n",
"5\n"
] | The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough. | 500 | [
{
"input": "1 7",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "1 2",
"output": "5"
},
{
"input": "1 3",
"output": "5"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "6"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "2 4",
"output": "5"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "3 1",
"output": "5"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "5"
},
{
"input": "3 4",
"output": "5"
},
{
"input": "3 5",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "3 7",
"output": "6"
},
{
"input": "4 1",
"output": "5"
},
{
"input": "4 2",
"output": "5"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "4 5",
"output": "5"
},
{
"input": "4 6",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "5"
},
{
"input": "5 3",
"output": "5"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "5 5",
"output": "5"
},
{
"input": "5 6",
"output": "6"
},
{
"input": "5 7",
"output": "6"
},
{
"input": "6 1",
"output": "5"
},
{
"input": "6 2",
"output": "5"
},
{
"input": "6 3",
"output": "5"
},
{
"input": "6 4",
"output": "5"
},
{
"input": "6 5",
"output": "5"
},
{
"input": "6 6",
"output": "5"
},
{
"input": "6 7",
"output": "6"
},
{
"input": "7 1",
"output": "5"
},
{
"input": "7 2",
"output": "5"
},
{
"input": "7 3",
"output": "5"
},
{
"input": "7 4",
"output": "5"
},
{
"input": "7 5",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "8 1",
"output": "5"
},
{
"input": "8 2",
"output": "5"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "5"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "8 7",
"output": "6"
},
{
"input": "9 1",
"output": "5"
},
{
"input": "9 2",
"output": "5"
},
{
"input": "9 3",
"output": "5"
},
{
"input": "9 4",
"output": "5"
},
{
"input": "9 5",
"output": "5"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "10 1",
"output": "5"
},
{
"input": "10 2",
"output": "5"
},
{
"input": "10 3",
"output": "5"
},
{
"input": "10 4",
"output": "5"
},
{
"input": "10 5",
"output": "5"
},
{
"input": "10 6",
"output": "6"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "11 1",
"output": "5"
},
{
"input": "11 2",
"output": "5"
},
{
"input": "11 3",
"output": "5"
},
{
"input": "11 4",
"output": "5"
},
{
"input": "11 5",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "12 1",
"output": "5"
},
{
"input": "12 2",
"output": "5"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "12 4",
"output": "5"
},
{
"input": "12 5",
"output": "5"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 7",
"output": "6"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "6 6",
"output": "5"
}
] | 1,485,109,429 | 529 | Python 3 | OK | TESTS | 104 | 77 | 4,608,000 | m, d = list(map(int, input().split()))
days = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
import math
day = days[m-1]
print(math.ceil((day + d-1)/7))
| Title: Petr and a calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
Input Specification:
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
Output Specification:
Print single integer: the number of columns the table should have.
Demo Input:
['1 7\n', '1 1\n', '11 6\n']
Demo Output:
['6\n', '5\n', '5\n']
Note:
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough. | ```python
m, d = list(map(int, input().split()))
days = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
import math
day = days[m-1]
print(math.ceil((day + d-1)/7))
``` | 3 |
|
50 | B | Choosing Symbol Pairs | PROGRAMMING | 1,500 | [
"strings"
] | B. Choosing Symbol Pairs | 2 | 256 | There is a given string *S* consisting of *N* symbols. Your task is to find the number of ordered pairs of integers *i* and *j* such that
1. 1<=≤<=*i*,<=*j*<=≤<=*N*
2. *S*[*i*]<==<=*S*[*j*], that is the *i*-th symbol of string *S* is equal to the *j*-th. | The single input line contains *S*, consisting of lowercase Latin letters and digits. It is guaranteed that string *S* in not empty and its length does not exceed 105. | Print a single number which represents the number of pairs *i* and *j* with the needed property. Pairs (*x*,<=*y*) and (*y*,<=*x*) should be considered different, i.e. the ordered pairs count. | [
"great10\n",
"aaaaaaaaaa\n"
] | [
"7\n",
"100\n"
] | none | 1,000 | [
{
"input": "great10",
"output": "7"
},
{
"input": "aaaaaaaaaa",
"output": "100"
},
{
"input": "great10",
"output": "7"
},
{
"input": "aaaaaaaaaa",
"output": "100"
},
{
"input": "aabb",
"output": "8"
},
{
"input": "w",
"output": "1"
},
{
"input": "129a",
"output": "4"
},
{
"input": "233444",
"output": "14"
},
{
"input": "abacaba",
"output": "21"
},
{
"input": "abcdefghijklmnopqrstuvwxyz0987654321abcdefghijklmnopqrstuvwxyz0987654321abcdefghijklmnopqrstuvwxyz0987654321",
"output": "324"
},
{
"input": "zazaeeeeeeeq34443333444tttttt",
"output": "155"
},
{
"input": "00000000000000000000000",
"output": "529"
},
{
"input": "999000888775646453342311",
"output": "62"
}
] | 1,646,193,544 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | s=input()
lens=len(s)
sum=0
for i in range(lens):
for j in range(lens):
if s[i]=s[j]:
sum+=1
print(sum) | Title: Choosing Symbol Pairs
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a given string *S* consisting of *N* symbols. Your task is to find the number of ordered pairs of integers *i* and *j* such that
1. 1<=≤<=*i*,<=*j*<=≤<=*N*
2. *S*[*i*]<==<=*S*[*j*], that is the *i*-th symbol of string *S* is equal to the *j*-th.
Input Specification:
The single input line contains *S*, consisting of lowercase Latin letters and digits. It is guaranteed that string *S* in not empty and its length does not exceed 105.
Output Specification:
Print a single number which represents the number of pairs *i* and *j* with the needed property. Pairs (*x*,<=*y*) and (*y*,<=*x*) should be considered different, i.e. the ordered pairs count.
Demo Input:
['great10\n', 'aaaaaaaaaa\n']
Demo Output:
['7\n', '100\n']
Note:
none | ```python
s=input()
lens=len(s)
sum=0
for i in range(lens):
for j in range(lens):
if s[i]=s[j]:
sum+=1
print(sum)
``` | -1 |
337 | A | Puzzles | PROGRAMMING | 900 | [
"greedy"
] | null | null | The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*. | The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop. | Print a single integer — the least possible difference the teacher can obtain. | [
"4 6\n10 12 10 7 5 22\n"
] | [
"5\n"
] | Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5. | 500 | [
{
"input": "4 6\n10 12 10 7 5 22",
"output": "5"
},
{
"input": "2 2\n4 4",
"output": "0"
},
{
"input": "2 10\n4 5 6 7 8 9 10 11 12 12",
"output": "0"
},
{
"input": "4 5\n818 136 713 59 946",
"output": "759"
},
{
"input": "3 20\n446 852 783 313 549 965 40 88 86 617 479 118 768 34 47 826 366 957 463 903",
"output": "13"
},
{
"input": "2 25\n782 633 152 416 432 825 115 97 386 357 836 310 530 413 354 373 847 882 913 682 729 582 671 674 94",
"output": "3"
},
{
"input": "4 25\n226 790 628 528 114 64 239 279 619 39 894 763 763 847 525 93 882 697 999 643 650 244 159 884 190",
"output": "31"
},
{
"input": "2 50\n971 889 628 39 253 157 925 694 129 516 660 272 738 319 611 816 142 717 514 392 41 105 132 676 958 118 306 768 600 685 103 857 704 346 857 309 23 718 618 161 176 379 846 834 640 468 952 878 164 997",
"output": "0"
},
{
"input": "25 50\n582 146 750 905 313 509 402 21 488 512 32 898 282 64 579 869 37 996 377 929 975 697 666 837 311 205 116 992 533 298 648 268 54 479 792 595 152 69 267 417 184 433 894 603 988 712 24 414 301 176",
"output": "412"
},
{
"input": "49 50\n58 820 826 960 271 294 473 102 925 318 729 672 244 914 796 646 868 6 893 882 726 203 528 498 271 195 355 459 721 680 547 147 631 116 169 804 145 996 133 559 110 257 771 476 576 251 607 314 427 886",
"output": "938"
},
{
"input": "50 50\n374 573 323 744 190 806 485 247 628 336 491 606 702 321 991 678 337 579 86 240 993 208 668 686 855 205 363 177 719 249 896 919 782 434 59 647 787 996 286 216 636 212 546 903 958 559 544 126 608 993",
"output": "937"
},
{
"input": "6 50\n6 8 7 8 5 4 4 5 7 8 6 5 7 4 7 7 7 8 6 4 6 6 8 8 7 7 8 7 5 8 5 4 4 7 8 4 4 6 6 6 8 7 4 7 6 6 5 8 4 7",
"output": "0"
},
{
"input": "37 50\n14 5 11 17 8 20 19 16 20 11 17 20 16 9 14 14 13 18 11 20 8 8 8 5 19 17 6 18 10 20 9 7 12 6 14 17 4 4 10 13 7 4 11 6 20 19 12 12 15 19",
"output": "12"
},
{
"input": "40 50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "40 50\n17 20 43 26 41 37 14 8 30 35 30 24 43 8 42 9 41 50 41 35 27 32 35 43 28 36 31 16 5 7 23 16 14 29 8 39 12 16 36 18 49 39 33 37 38 6 6 27 23 17",
"output": "31"
},
{
"input": "2 2\n1000 4",
"output": "996"
},
{
"input": "2 3\n4 502 1000",
"output": "498"
},
{
"input": "3 3\n4 1000 4",
"output": "996"
}
] | 1,683,322,163 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 2 | 1,000 | 0 | x=list(map(int,input().split()))
y=list(map(int,input().split()))
ls=[]
for i in range(len(y)):
lss=[y[i]]
k=0
while len(lss)!=x[0]:
for j in range(len(y)):
if i==j:
continue
elif abs(y[i]-y[j])==k:
lss.append(y[j])
k+=1
a=min(lss)
b=max(lss)
c=b-a
ls.append(c)
print(min(ls)) | Title: Puzzles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The end of the school year is near and Ms. Manana, the teacher, will soon have to say goodbye to a yet another class. She decided to prepare a goodbye present for her *n* students and give each of them a jigsaw puzzle (which, as wikipedia states, is a tiling puzzle that requires the assembly of numerous small, often oddly shaped, interlocking and tessellating pieces).
The shop assistant told the teacher that there are *m* puzzles in the shop, but they might differ in difficulty and size. Specifically, the first jigsaw puzzle consists of *f*1 pieces, the second one consists of *f*2 pieces and so on.
Ms. Manana doesn't want to upset the children, so she decided that the difference between the numbers of pieces in her presents must be as small as possible. Let *A* be the number of pieces in the largest puzzle that the teacher buys and *B* be the number of pieces in the smallest such puzzle. She wants to choose such *n* puzzles that *A*<=-<=*B* is minimum possible. Help the teacher and find the least possible value of *A*<=-<=*B*.
Input Specification:
The first line contains space-separated integers *n* and *m* (2<=≤<=*n*<=≤<=*m*<=≤<=50). The second line contains *m* space-separated integers *f*1,<=*f*2,<=...,<=*f**m* (4<=≤<=*f**i*<=≤<=1000) — the quantities of pieces in the puzzles sold in the shop.
Output Specification:
Print a single integer — the least possible difference the teacher can obtain.
Demo Input:
['4 6\n10 12 10 7 5 22\n']
Demo Output:
['5\n']
Note:
Sample 1. The class has 4 students. The shop sells 6 puzzles. If Ms. Manana buys the first four puzzles consisting of 10, 12, 10 and 7 pieces correspondingly, then the difference between the sizes of the largest and the smallest puzzle will be equal to 5. It is impossible to obtain a smaller difference. Note that the teacher can also buy puzzles 1, 3, 4 and 5 to obtain the difference 5. | ```python
x=list(map(int,input().split()))
y=list(map(int,input().split()))
ls=[]
for i in range(len(y)):
lss=[y[i]]
k=0
while len(lss)!=x[0]:
for j in range(len(y)):
if i==j:
continue
elif abs(y[i]-y[j])==k:
lss.append(y[j])
k+=1
a=min(lss)
b=max(lss)
c=b-a
ls.append(c)
print(min(ls))
``` | 0 |
|
231 | A | Team | PROGRAMMING | 800 | [
"brute force",
"greedy"
] | null | null | One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. | The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. | Print a single integer — the number of problems the friends will implement on the contest. | [
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] | [
"2\n",
"1\n"
] | In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | 500 | [
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,696,094,974 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 92 | 0 | n=int(input())
ans=0
for i in range(n):
x=input()
nb_1=int(x[0])
nb_2=int(x[2])
nb_3=int(x[4])
sm=nb_3+nb_2+nb_1
if sm >=2:
ans=ans+1
print(ans) | Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | ```python
n=int(input())
ans=0
for i in range(n):
x=input()
nb_1=int(x[0])
nb_2=int(x[2])
nb_3=int(x[4])
sm=nb_3+nb_2+nb_1
if sm >=2:
ans=ans+1
print(ans)
``` | 3 |
|
801 | B | Valued Keys | PROGRAMMING | 900 | [
"constructive algorithms",
"greedy",
"strings"
] | null | null | You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists. | The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100. | If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters. | [
"ab\naa\n",
"nzwzl\nniwel\n",
"ab\nba\n"
] | [
"ba\n",
"xiyez\n",
"-1\n"
] | The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba". | 1,000 | [
{
"input": "ab\naa",
"output": "ba"
},
{
"input": "nzwzl\nniwel",
"output": "xiyez"
},
{
"input": "ab\nba",
"output": "-1"
},
{
"input": "r\nl",
"output": "l"
},
{
"input": "d\ny",
"output": "-1"
},
{
"input": "yvowz\ncajav",
"output": "cajav"
},
{
"input": "lwzjp\ninjit",
"output": "-1"
},
{
"input": "epqnlxmiicdidyscjaxqznwur\neodnlemiicdedmkcgavqbnqmm",
"output": "eodnlemiicdedmkcgavqbnqmm"
},
{
"input": "qqdabbsxiibnnjgsgxllfvdqj\nuxmypqtwfdezewdxfgplannrs",
"output": "-1"
},
{
"input": "aanerbaqslfmqmuciqbxyznkevukvznpkmxlcorpmrenwxhzfgbmlfpxtkqpxdrmcqcmbf\naanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf",
"output": "aanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf"
},
{
"input": "mbyrkhjctrcrayisflptgfudwgrtegidhqicsjqafvdloritbjhciyxuwavxknezwwudnk\nvvixsutlbdewqoabqhpuerfkzrddcqptfwmxdlxwbvsaqfjoxztlddvwgflcteqbwaiaen",
"output": "-1"
},
{
"input": "eufycwztywhbjrpqobvknwfqmnboqcfdiahkagykeibbsqpljcghhmsgfmswwsanzyiwtvuirwmppfivtekaywkzskyydfvkjgxb\necfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb",
"output": "ecfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb"
},
{
"input": "qvpltcffyeghtbdhjyhfteojezyzziardduzrbwuxmzzkkoehfnxecafizxglboauhynfbawlfxenmykquyhrxswhjuovvogntok\nchvkcvzxptbcepdjfezcpuvtehewbnvqeoezlcnzhpfwujbmhafoeqmjhtwisnobauinkzyigrvahpuetkgpdjfgbzficsmuqnym",
"output": "-1"
},
{
"input": "nmuwjdihouqrnsuahimssnrbxdpwvxiyqtenahtrlshjkmnfuttnpqhgcagoptinnaptxaccptparldzrhpgbyrzedghudtsswxi\nnilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib",
"output": "nilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib"
},
{
"input": "dyxgwupoauwqtcfoyfjdotzirwztdfrueqiypxoqvkmhiehdppwtdoxrbfvtairdbuvlqohjflznggjpifhwjrshcrfbjtklpykx\ngzqlnoizhxolnditjdhlhptjsbczehicudoybzilwnshmywozwnwuipcgirgzldtvtowdsokfeafggwserzdazkxyddjttiopeew",
"output": "-1"
},
{
"input": "hbgwuqzougqzlxemvyjpeizjfwhgugrfnhbrlxkmkdalikfyunppwgdzmalbwewybnjzqsohwhjkdcyhhzmysflambvhpsjilsyv\nfbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv",
"output": "fbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv"
},
{
"input": "xnjjhjfuhgyxqhpzmvgbaohqarugdoaczcfecofltwemieyxolswkcwhlfagfrgmoiqrgftokbqwtxgxzweozzlikrvafiabivlk\npjfosalbsitcnqiazhmepfifjxvmazvdgffcnozmnqubhonwjldmpdsjagmamniylzjdbklcyrzivjyzgnogahobpkwpwpvraqns",
"output": "-1"
},
{
"input": "zrvzedssbsrfldqvjpgmsefrmsatspzoitwvymahiptphiystjlsauzquzqqbmljobdhijcpdvatorwmyojqgnezvzlgjibxepcf\npesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf",
"output": "pesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf"
},
{
"input": "pdvkuwyzntzfqpblzmbynknyhlnqbxijuqaincviugxohcsrofozrrsategwkbwxcvkyzxhurokefpbdnmcfogfhsojayysqbrow\nbvxruombdrywlcjkrltyayaazwpauuhbtgwfzdrmfwwucgffucwelzvpsdgtapogchblzahsrfymjlaghkbmbssghrpxalkslcvp",
"output": "-1"
},
{
"input": "tgharsjyihroiiahwgbjezlxvlterxivdhtzjcqegzmtigqmrehvhiyjeywegxaseoyoacouijudbiruoghgxvxadwzgdxtnxlds\ntghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp",
"output": "tghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp"
},
{
"input": "jsinejpfwhzloulxndzvzftgogfdagrsscxmatldssqsgaknnbkcvhptebjjpkjhrjegrotzwcdosezkedzxeoyibmyzunkguoqj\nkfmvybobocdpipiripysioruqvloopvbggpjksgmwzyqwyxnesmvhsawnbbmntulspvsysfkjqwpvoelliopbaukyagedextzoej",
"output": "-1"
},
{
"input": "nttdcfceptruiomtmwzestrfchnqpgqeztpcvthzelfyggjgqadylzubpvbrlgndrcsursczpxlnoyoadxezncqalupfzmjeqihe\nkttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe",
"output": "kttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe"
},
{
"input": "diuopwglduasnaxgduwslbzoyayoypzznqspljcyqehweydhlwifcvnjmaowuvyqfwynjghecqvxdvuquuwpvwrjljozocaxnktv\ntrdydprdzmjhgbhzytelrfjpgsebijicsigmwhynmcyjtqrvojcndodchzxfcvyqjxqzwibccdvsjqhsnectdjyrrhzkeamukang",
"output": "-1"
},
{
"input": "ftfr\nftfr",
"output": "ftfr"
},
{
"input": "ftr\nftr",
"output": "ftr"
},
{
"input": "shftr\nshftr",
"output": "shftr"
},
{
"input": "vkvkkv\nvkvkkv",
"output": "vkvkkv"
},
{
"input": "ftrd\nftrd",
"output": "ftrd"
},
{
"input": "fztr\nfztr",
"output": "fztr"
},
{
"input": "frtr\nfrtr",
"output": "frtr"
},
{
"input": "shdftr\nshdftr",
"output": "shdftr"
},
{
"input": "zzz\nzzz",
"output": "zzz"
},
{
"input": "shtr\nshtr",
"output": "shtr"
},
{
"input": "aaaaa\nzzzzz",
"output": "-1"
},
{
"input": "efr\nefr",
"output": "efr"
}
] | 1,492,359,255 | 2,355 | Python 3 | WRONG_ANSWER | PRETESTS | 6 | 61 | 5,529,600 | x = input().strip()
y = input().strip()
def main():
for i in range(len(x)):
if x[i] == y[i]:
print(x[i],end="")
elif x[i] < y[i]:
print(-1)
return
else:
print(y[i], end="")
if __name__ == "__main__":
main() | Title: Valued Keys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
Input Specification:
The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
Output Specification:
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
Demo Input:
['ab\naa\n', 'nzwzl\nniwel\n', 'ab\nba\n']
Demo Output:
['ba\n', 'xiyez\n', '-1\n']
Note:
The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba". | ```python
x = input().strip()
y = input().strip()
def main():
for i in range(len(x)):
if x[i] == y[i]:
print(x[i],end="")
elif x[i] < y[i]:
print(-1)
return
else:
print(y[i], end="")
if __name__ == "__main__":
main()
``` | 0 |
|
807 | A | Is it rated? | PROGRAMMING | 900 | [
"implementation",
"sortings"
] | null | null | Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings. | If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe". | [
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] | [
"rated\n",
"unrated\n",
"maybe\n"
] | In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | 500 | [
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,676,768,089 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 31 | 0 | n = int(input())
q =set()
a=[]
b=[]
for i in range(n):
x, y = [int(x) for x in input().split()]
q.add(x)
q.add(y)
a.append(x)
b.append(y)
sa=[]
sa.extend(a)
sa.sort(reverse=True)
if len(q)==n and a != sa:
print('unrated')
elif len(q)>n:
print('rated')
else:
print('maybe')
| Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | ```python
n = int(input())
q =set()
a=[]
b=[]
for i in range(n):
x, y = [int(x) for x in input().split()]
q.add(x)
q.add(y)
a.append(x)
b.append(y)
sa=[]
sa.extend(a)
sa.sort(reverse=True)
if len(q)==n and a != sa:
print('unrated')
elif len(q)>n:
print('rated')
else:
print('maybe')
``` | 0 |
|
275 | A | Lights Out | PROGRAMMING | 900 | [
"implementation"
] | null | null | Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light. | The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed. | Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0". | [
"1 0 0\n0 0 0\n0 0 1\n",
"1 0 1\n8 8 8\n2 0 3\n"
] | [
"001\n010\n100\n",
"010\n011\n100\n"
] | none | 500 | [
{
"input": "1 0 0\n0 0 0\n0 0 1",
"output": "001\n010\n100"
},
{
"input": "1 0 1\n8 8 8\n2 0 3",
"output": "010\n011\n100"
},
{
"input": "13 85 77\n25 50 45\n65 79 9",
"output": "000\n010\n000"
},
{
"input": "96 95 5\n8 84 74\n67 31 61",
"output": "011\n011\n101"
},
{
"input": "24 54 37\n60 63 6\n1 84 26",
"output": "110\n101\n011"
},
{
"input": "23 10 40\n15 6 40\n92 80 77",
"output": "101\n100\n000"
},
{
"input": "62 74 80\n95 74 93\n2 47 95",
"output": "010\n001\n110"
},
{
"input": "80 83 48\n26 0 66\n47 76 37",
"output": "000\n000\n010"
},
{
"input": "32 15 65\n7 54 36\n5 51 3",
"output": "111\n101\n001"
},
{
"input": "22 97 12\n71 8 24\n100 21 64",
"output": "100\n001\n100"
},
{
"input": "46 37 13\n87 0 50\n90 8 55",
"output": "111\n011\n000"
},
{
"input": "57 43 58\n20 82 83\n66 16 52",
"output": "111\n010\n110"
},
{
"input": "45 56 93\n47 51 59\n18 51 63",
"output": "101\n011\n100"
},
{
"input": "47 66 67\n14 1 37\n27 81 69",
"output": "001\n001\n110"
},
{
"input": "26 69 69\n85 18 23\n14 22 74",
"output": "110\n001\n010"
},
{
"input": "10 70 65\n94 27 25\n74 66 30",
"output": "111\n010\n100"
},
{
"input": "97 1 74\n15 99 1\n88 68 86",
"output": "001\n011\n000"
},
{
"input": "36 48 42\n45 41 66\n26 64 1",
"output": "001\n111\n010"
},
{
"input": "52 81 97\n29 77 71\n66 11 2",
"output": "100\n100\n111"
},
{
"input": "18 66 33\n19 49 49\n48 46 26",
"output": "011\n100\n000"
},
{
"input": "68 79 52\n51 39 100\n29 14 26",
"output": "110\n000\n111"
},
{
"input": "91 69 77\n91 26 64\n91 88 57",
"output": "001\n011\n110"
},
{
"input": "16 69 64\n48 21 80\n81 51 51",
"output": "010\n101\n111"
},
{
"input": "96 14 2\n100 18 12\n65 34 89",
"output": "111\n010\n010"
},
{
"input": "93 95 90\n8 59 42\n53 13 19",
"output": "100\n001\n111"
},
{
"input": "71 84 18\n100 19 67\n9 76 15",
"output": "010\n010\n001"
},
{
"input": "38 93 85\n21 88 64\n4 96 25",
"output": "111\n011\n000"
},
{
"input": "75 20 20\n60 5 78\n77 4 69",
"output": "011\n001\n000"
},
{
"input": "65 70 96\n19 6 83\n33 37 82",
"output": "100\n000\n011"
},
{
"input": "11 13 60\n17 13 46\n42 21 39",
"output": "000\n011\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 0",
"output": "111\n111\n111"
},
{
"input": "0 0 0\n0 1 0\n0 0 0",
"output": "101\n000\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 1",
"output": "111\n110\n100"
}
] | 1,667,708,227 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 33 | 62 | 0 | l1=[int(i) for i in input().split()]
l2=[int(i) for i in input().split()]
l3=[int(i) for i in input().split()]
s1=[1,1,1]
s2=[1,1,1]
s3=[1,1,1]
for j in range(3):
if l1[j]%2!=0:
if j==0:
s1[0]=1-s1[0]
s1[1]=1-s1[1]
s2[0]=1-s2[0]
elif j==1:
s1[0]=1-s1[0]
s1[1]=1-s1[1]
s1[-1]=1-s1[-1]
s2[1]=1-s2[1]
else :
s1[-1]=1-s1[-1]
s1[1]=1-s1[1]
s2[-1]=1-s2[-1]
for k in range(3):
if l2[k]%2!=0:
if k==0:
s1[0]=1-s1[0]
s2[0]=1-s2[0]
s3[0]=1-s3[0]
s2[1]=1-s2[1]
elif k==1:
s2[0]=1-s2[0]
s2[1]=1-s2[1]
s2[-1]=1-s2[-1]
s1[1]=1-s1[1]
s3[1]=1-s3[1]
else :
s1[-1]=1-s1[-1]
s2[-1]=1-s2[-1]
s3[-1]=1-s3[-1]
s2[1]=1-s2[1]
for l in range(3):
if l3[l]%2!=0:
if l==0:
s3[0]=1-s3[0]
s3[1]=1-s3[1]
s2[0]=1-s2[0]
elif l==1:
s3[0]=1-s3[0]
s3[1]=1-s3[1]
s3[-1]=1-s3[-1]
s2[1]=1-s2[1]
else :
s3[-1]=1-s3[-1]
s3[1]=1-s3[1]
s2[-1]=1-s2[-1]
print(*s1,sep="")
print(*s2,sep="")
print(*s3,sep="") | Title: Lights Out
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
Input Specification:
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
Output Specification:
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
Demo Input:
['1 0 0\n0 0 0\n0 0 1\n', '1 0 1\n8 8 8\n2 0 3\n']
Demo Output:
['001\n010\n100\n', '010\n011\n100\n']
Note:
none | ```python
l1=[int(i) for i in input().split()]
l2=[int(i) for i in input().split()]
l3=[int(i) for i in input().split()]
s1=[1,1,1]
s2=[1,1,1]
s3=[1,1,1]
for j in range(3):
if l1[j]%2!=0:
if j==0:
s1[0]=1-s1[0]
s1[1]=1-s1[1]
s2[0]=1-s2[0]
elif j==1:
s1[0]=1-s1[0]
s1[1]=1-s1[1]
s1[-1]=1-s1[-1]
s2[1]=1-s2[1]
else :
s1[-1]=1-s1[-1]
s1[1]=1-s1[1]
s2[-1]=1-s2[-1]
for k in range(3):
if l2[k]%2!=0:
if k==0:
s1[0]=1-s1[0]
s2[0]=1-s2[0]
s3[0]=1-s3[0]
s2[1]=1-s2[1]
elif k==1:
s2[0]=1-s2[0]
s2[1]=1-s2[1]
s2[-1]=1-s2[-1]
s1[1]=1-s1[1]
s3[1]=1-s3[1]
else :
s1[-1]=1-s1[-1]
s2[-1]=1-s2[-1]
s3[-1]=1-s3[-1]
s2[1]=1-s2[1]
for l in range(3):
if l3[l]%2!=0:
if l==0:
s3[0]=1-s3[0]
s3[1]=1-s3[1]
s2[0]=1-s2[0]
elif l==1:
s3[0]=1-s3[0]
s3[1]=1-s3[1]
s3[-1]=1-s3[-1]
s2[1]=1-s2[1]
else :
s3[-1]=1-s3[-1]
s3[1]=1-s3[1]
s2[-1]=1-s2[-1]
print(*s1,sep="")
print(*s2,sep="")
print(*s3,sep="")
``` | 3 |
|
994 | B | Knights of a Polygonal Table | PROGRAMMING | 1,400 | [
"greedy",
"implementation",
"sortings"
] | null | null | Unlike Knights of a Round Table, Knights of a Polygonal Table deprived of nobility and happy to kill each other. But each knight has some power and a knight can kill another knight if and only if his power is greater than the power of victim. However, even such a knight will torment his conscience, so he can kill no more than $k$ other knights. Also, each knight has some number of coins. After a kill, a knight can pick up all victim's coins.
Now each knight ponders: how many coins he can have if only he kills other knights?
You should answer this question for each knight. | The first line contains two integers $n$ and $k$ $(1 \le n \le 10^5, 0 \le k \le \min(n-1,10))$ — the number of knights and the number $k$ from the statement.
The second line contains $n$ integers $p_1, p_2 ,\ldots,p_n$ $(1 \le p_i \le 10^9)$ — powers of the knights. All $p_i$ are distinct.
The third line contains $n$ integers $c_1, c_2 ,\ldots,c_n$ $(0 \le c_i \le 10^9)$ — the number of coins each knight has. | Print $n$ integers — the maximum number of coins each knight can have it only he kills other knights. | [
"4 2\n4 5 9 7\n1 2 11 33\n",
"5 1\n1 2 3 4 5\n1 2 3 4 5\n",
"1 0\n2\n3\n"
] | [
"1 3 46 36 ",
"1 3 5 7 9 ",
"3 "
] | Consider the first example.
- The first knight is the weakest, so he can't kill anyone. That leaves him with the only coin he initially has. - The second knight can kill the first knight and add his coin to his own two. - The third knight is the strongest, but he can't kill more than $k = 2$ other knights. It is optimal to kill the second and the fourth knights: $2+11+33 = 46$. - The fourth knight should kill the first and the second knights: $33+1+2 = 36$.
In the second example the first knight can't kill anyone, while all the others should kill the one with the index less by one than their own.
In the third example there is only one knight, so he can't kill anyone. | 1,000 | [
{
"input": "4 2\n4 5 9 7\n1 2 11 33",
"output": "1 3 46 36 "
},
{
"input": "5 1\n1 2 3 4 5\n1 2 3 4 5",
"output": "1 3 5 7 9 "
},
{
"input": "1 0\n2\n3",
"output": "3 "
},
{
"input": "7 1\n2 3 4 5 7 8 9\n0 3 7 9 5 8 9",
"output": "0 3 10 16 14 17 18 "
},
{
"input": "7 2\n2 4 6 7 8 9 10\n10 8 4 8 4 5 9",
"output": "10 18 22 26 22 23 27 "
},
{
"input": "11 10\n1 2 3 4 5 6 7 8 9 10 11\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1000000000 2000000000 3000000000 4000000000 5000000000 6000000000 7000000000 8000000000 9000000000 10000000000 11000000000 "
},
{
"input": "2 0\n2 3\n3 3",
"output": "3 3 "
},
{
"input": "7 3\n1 2 3 4 5 6 7\n3 3 3 4 5 6 7",
"output": "3 6 9 13 15 18 22 "
},
{
"input": "3 0\n3 2 1\n1 2 3",
"output": "1 2 3 "
},
{
"input": "5 3\n4 5 7 9 11\n10 10 10 10 10",
"output": "10 20 30 40 40 "
},
{
"input": "4 0\n4 5 9 7\n1 2 11 33",
"output": "1 2 11 33 "
},
{
"input": "7 3\n1 2 3 4 5 6 7\n3 3 3 8 8 8 8",
"output": "3 6 9 17 22 27 32 "
},
{
"input": "3 0\n1 2 3\n5 5 5",
"output": "5 5 5 "
},
{
"input": "4 2\n4 5 9 7\n2 2 11 33",
"output": "2 4 46 37 "
},
{
"input": "6 3\n1 2 3 4 5 6\n1 1 1 1 1 1",
"output": "1 2 3 4 4 4 "
},
{
"input": "10 5\n1 2 3 4 5 6 7 8 9 10\n1 1 1 1 1 1 1 1 1 1",
"output": "1 2 3 4 5 6 6 6 6 6 "
},
{
"input": "3 2\n1 2 3\n1 1 1",
"output": "1 2 3 "
},
{
"input": "3 0\n1 2 3\n10 20 30",
"output": "10 20 30 "
},
{
"input": "4 0\n4 5 9 7\n1 2 3 4",
"output": "1 2 3 4 "
},
{
"input": "5 4\n1 2 3 4 5\n1 1 1 1 1",
"output": "1 2 3 4 5 "
},
{
"input": "4 3\n1 2 3 4\n5 5 5 5",
"output": "5 10 15 20 "
},
{
"input": "5 3\n1 2 3 4 5\n7 7 7 7 7",
"output": "7 14 21 28 28 "
}
] | 1,529,581,528 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 77 | 0 | n,m=input().split()
n=int(n)
m=int(m)
l=input().split()
l=[int(i) for i in l]
k=input().split()
k=[int(i) for i in k]
dict={i:j for (i,j) in zip(l,k)}
coins=[]
keys=dict.keys()
keys=sorted(keys)
for i in range(len(keys)):
coins.append(dict[keys[i]])
if(i>0):
for j in range(m):
coins[i]+=dict[keys[i-j-1]]
# print(coins[i])
ans_dict={i:j for (i,j) in zip(keys,coins)}
for i in dict.keys():
print(ans_dict[i],end=' ') | Title: Knights of a Polygonal Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Unlike Knights of a Round Table, Knights of a Polygonal Table deprived of nobility and happy to kill each other. But each knight has some power and a knight can kill another knight if and only if his power is greater than the power of victim. However, even such a knight will torment his conscience, so he can kill no more than $k$ other knights. Also, each knight has some number of coins. After a kill, a knight can pick up all victim's coins.
Now each knight ponders: how many coins he can have if only he kills other knights?
You should answer this question for each knight.
Input Specification:
The first line contains two integers $n$ and $k$ $(1 \le n \le 10^5, 0 \le k \le \min(n-1,10))$ — the number of knights and the number $k$ from the statement.
The second line contains $n$ integers $p_1, p_2 ,\ldots,p_n$ $(1 \le p_i \le 10^9)$ — powers of the knights. All $p_i$ are distinct.
The third line contains $n$ integers $c_1, c_2 ,\ldots,c_n$ $(0 \le c_i \le 10^9)$ — the number of coins each knight has.
Output Specification:
Print $n$ integers — the maximum number of coins each knight can have it only he kills other knights.
Demo Input:
['4 2\n4 5 9 7\n1 2 11 33\n', '5 1\n1 2 3 4 5\n1 2 3 4 5\n', '1 0\n2\n3\n']
Demo Output:
['1 3 46 36 ', '1 3 5 7 9 ', '3 ']
Note:
Consider the first example.
- The first knight is the weakest, so he can't kill anyone. That leaves him with the only coin he initially has. - The second knight can kill the first knight and add his coin to his own two. - The third knight is the strongest, but he can't kill more than $k = 2$ other knights. It is optimal to kill the second and the fourth knights: $2+11+33 = 46$. - The fourth knight should kill the first and the second knights: $33+1+2 = 36$.
In the second example the first knight can't kill anyone, while all the others should kill the one with the index less by one than their own.
In the third example there is only one knight, so he can't kill anyone. | ```python
n,m=input().split()
n=int(n)
m=int(m)
l=input().split()
l=[int(i) for i in l]
k=input().split()
k=[int(i) for i in k]
dict={i:j for (i,j) in zip(l,k)}
coins=[]
keys=dict.keys()
keys=sorted(keys)
for i in range(len(keys)):
coins.append(dict[keys[i]])
if(i>0):
for j in range(m):
coins[i]+=dict[keys[i-j-1]]
# print(coins[i])
ans_dict={i:j for (i,j) in zip(keys,coins)}
for i in dict.keys():
print(ans_dict[i],end=' ')
``` | 0 |
|
182 | D | Common Divisors | PROGRAMMING | 1,400 | [
"brute force",
"hashing",
"implementation",
"math",
"strings"
] | null | null | Vasya has recently learned at school what a number's divisor is and decided to determine a string's divisor. Here is what he came up with.
String *a* is the divisor of string *b* if and only if there exists a positive integer *x* such that if we write out string *a* consecutively *x* times, we get string *b*. For example, string "abab" has two divisors — "ab" and "abab".
Now Vasya wants to write a program that calculates the number of common divisors of two strings. Please help him. | The first input line contains a non-empty string *s*1.
The second input line contains a non-empty string *s*2.
Lengths of strings *s*1 and *s*2 are positive and do not exceed 105. The strings only consist of lowercase Latin letters. | Print the number of common divisors of strings *s*1 and *s*2. | [
"abcdabcd\nabcdabcdabcdabcd\n",
"aaa\naa\n"
] | [
"2\n",
"1\n"
] | In first sample the common divisors are strings "abcd" and "abcdabcd".
In the second sample the common divisor is a single string "a". String "aa" isn't included in the answer as it isn't a divisor of string "aaa". | 1,000 | [
{
"input": "abcdabcd\nabcdabcdabcdabcd",
"output": "2"
},
{
"input": "aaa\naa",
"output": "1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "3"
},
{
"input": "aaaaaaaaaaaaaa\naaaaaaaaaaaaaa",
"output": "4"
},
{
"input": "a\nb",
"output": "0"
},
{
"input": "a\na",
"output": "1"
},
{
"input": "ab\nac",
"output": "0"
},
{
"input": "asdkjjaskldjklasjdhasjdasdas\nasdjahsgdjslkdaygsudhasdkasnjdbayusvduasdklmaklsd",
"output": "0"
},
{
"input": "aaa\naaaaab",
"output": "0"
},
{
"input": "ab\naa",
"output": "0"
},
{
"input": "aa\naac",
"output": "0"
},
{
"input": "aba\nabaaba",
"output": "1"
},
{
"input": "aa\nbb",
"output": "0"
},
{
"input": "abababab\ncdcdcdcd",
"output": "0"
},
{
"input": "ab\nab",
"output": "1"
},
{
"input": "abcabcabc\nertert",
"output": "0"
},
{
"input": "aaaa\nbbbb",
"output": "0"
},
{
"input": "abc\ncde",
"output": "0"
},
{
"input": "abc\nabcabcab",
"output": "0"
},
{
"input": "aba\naaa",
"output": "0"
},
{
"input": "abcabc\nabdabdabd",
"output": "0"
},
{
"input": "aaaaaa\naaaaaaaaa",
"output": "2"
},
{
"input": "aaa\nbbb",
"output": "0"
}
] | 1,689,448,509 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | print("_RANDOM_GUESS_1689448509.142863")# 1689448509.142883 | Title: Common Divisors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has recently learned at school what a number's divisor is and decided to determine a string's divisor. Here is what he came up with.
String *a* is the divisor of string *b* if and only if there exists a positive integer *x* such that if we write out string *a* consecutively *x* times, we get string *b*. For example, string "abab" has two divisors — "ab" and "abab".
Now Vasya wants to write a program that calculates the number of common divisors of two strings. Please help him.
Input Specification:
The first input line contains a non-empty string *s*1.
The second input line contains a non-empty string *s*2.
Lengths of strings *s*1 and *s*2 are positive and do not exceed 105. The strings only consist of lowercase Latin letters.
Output Specification:
Print the number of common divisors of strings *s*1 and *s*2.
Demo Input:
['abcdabcd\nabcdabcdabcdabcd\n', 'aaa\naa\n']
Demo Output:
['2\n', '1\n']
Note:
In first sample the common divisors are strings "abcd" and "abcdabcd".
In the second sample the common divisor is a single string "a". String "aa" isn't included in the answer as it isn't a divisor of string "aaa". | ```python
print("_RANDOM_GUESS_1689448509.142863")# 1689448509.142883
``` | 0 |
|
383 | A | Milking cows | PROGRAMMING | 1,600 | [
"data structures",
"greedy"
] | null | null | Iahub helps his grandfather at the farm. Today he must milk the cows. There are *n* cows sitting in a row, numbered from 1 to *n* from left to right. Each cow is either facing to the left or facing to the right. When Iahub milks a cow, all the cows that see the current cow get scared and lose one unit of the quantity of milk that they can give. A cow facing left sees all the cows with lower indices than her index, and a cow facing right sees all the cows with higher indices than her index. A cow that got scared once can get scared again (and lose one more unit of milk). A cow that has been milked once cannot get scared and lose any more milk. You can assume that a cow never loses all the milk she can give (a cow gives an infinitely amount of milk).
Iahub can decide the order in which he milks the cows. But he must milk each cow exactly once. Iahub wants to lose as little milk as possible. Print the minimum amount of milk that is lost. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=200000). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, where *a**i* is 0 if the cow number *i* is facing left, and 1 if it is facing right. | Print a single integer, the minimum amount of lost milk.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"4\n0 0 1 0\n",
"5\n1 0 1 0 1\n"
] | [
"1",
"3"
] | In the first sample Iahub milks the cows in the following order: cow 3, cow 4, cow 2, cow 1. When he milks cow 3, cow 4 loses 1 unit of milk. After that, no more milk is lost. | 500 | [
{
"input": "4\n0 0 1 0",
"output": "1"
},
{
"input": "5\n1 0 1 0 1",
"output": "3"
},
{
"input": "50\n1 1 0 1 1 1 1 1 1 0 0 1 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 0 0 0 0 0 1 1 0 1 0 0 1 0",
"output": "416"
},
{
"input": "100\n1 1 0 0 1 1 1 1 0 1 1 1 1 1 1 1 0 0 0 0 0 0 1 1 0 1 0 0 0 0 1 1 1 1 0 0 1 0 0 1 1 0 1 1 1 1 1 1 0 0 0 0 1 1 0 0 0 0 0 1 1 0 1 0 0 1 0 0 1 0 1 0 0 0 0 1 0 1 1 0 1 1 1 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 0",
"output": "1446"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "0"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "4\n1 1 1 1",
"output": "0"
}
] | 1,390,233,360 | 1,560 | Python 3 | OK | TESTS | 42 | 265 | 6,860,800 | import sys
n=int(input())
L=list(map(int,sys.stdin.readline().split()))
z=L.count(0)
if(z==n or z==0):
print(0)
Zeros=[0]*n
Zeros[n-1]+=1-L[n-1]
for i in range(n-2,-1,-1):
Zeros[i]=Zeros[i+1]
if(L[i]==0):
Zeros[i]+=1
else:
Zeros=[0]*n
Zeros[n-1]+=1-L[n-1]
for i in range(n-2,-1,-1):
Zeros[i]=Zeros[i+1]
if(L[i]==0):
Zeros[i]+=1
Ans=0
o=0
z=0
p=L[0]
if(L[0]==1):
o+=1
for i in range(1,n):
if(L[i]==p):
if(p==1):
o+=1
else:
if(L[i]==0):
Ans+=Zeros[i]*o
p=0
else:
o=1
p=1
print(Ans)
| Title: Milking cows
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub helps his grandfather at the farm. Today he must milk the cows. There are *n* cows sitting in a row, numbered from 1 to *n* from left to right. Each cow is either facing to the left or facing to the right. When Iahub milks a cow, all the cows that see the current cow get scared and lose one unit of the quantity of milk that they can give. A cow facing left sees all the cows with lower indices than her index, and a cow facing right sees all the cows with higher indices than her index. A cow that got scared once can get scared again (and lose one more unit of milk). A cow that has been milked once cannot get scared and lose any more milk. You can assume that a cow never loses all the milk she can give (a cow gives an infinitely amount of milk).
Iahub can decide the order in which he milks the cows. But he must milk each cow exactly once. Iahub wants to lose as little milk as possible. Print the minimum amount of milk that is lost.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=200000). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, where *a**i* is 0 if the cow number *i* is facing left, and 1 if it is facing right.
Output Specification:
Print a single integer, the minimum amount of lost milk.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4\n0 0 1 0\n', '5\n1 0 1 0 1\n']
Demo Output:
['1', '3']
Note:
In the first sample Iahub milks the cows in the following order: cow 3, cow 4, cow 2, cow 1. When he milks cow 3, cow 4 loses 1 unit of milk. After that, no more milk is lost. | ```python
import sys
n=int(input())
L=list(map(int,sys.stdin.readline().split()))
z=L.count(0)
if(z==n or z==0):
print(0)
Zeros=[0]*n
Zeros[n-1]+=1-L[n-1]
for i in range(n-2,-1,-1):
Zeros[i]=Zeros[i+1]
if(L[i]==0):
Zeros[i]+=1
else:
Zeros=[0]*n
Zeros[n-1]+=1-L[n-1]
for i in range(n-2,-1,-1):
Zeros[i]=Zeros[i+1]
if(L[i]==0):
Zeros[i]+=1
Ans=0
o=0
z=0
p=L[0]
if(L[0]==1):
o+=1
for i in range(1,n):
if(L[i]==p):
if(p==1):
o+=1
else:
if(L[i]==0):
Ans+=Zeros[i]*o
p=0
else:
o=1
p=1
print(Ans)
``` | 3 |
|
560 | A | Currency System in Geraldion | PROGRAMMING | 1,000 | [
"implementation",
"sortings"
] | null | null | A magic island Geraldion, where Gerald lives, has its own currency system. It uses banknotes of several values. But the problem is, the system is not perfect and sometimes it happens that Geraldionians cannot express a certain sum of money with any set of banknotes. Of course, they can use any number of banknotes of each value. Such sum is called unfortunate. Gerald wondered: what is the minimum unfortunate sum? | The first line contains number *n* (1<=≤<=*n*<=≤<=1000) — the number of values of the banknotes that used in Geraldion.
The second line contains *n* distinct space-separated numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the values of the banknotes. | Print a single line — the minimum unfortunate sum. If there are no unfortunate sums, print <=-<=1. | [
"5\n1 2 3 4 5\n"
] | [
"-1\n"
] | none | 500 | [
{
"input": "5\n1 2 3 4 5",
"output": "-1"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "10\n371054 506438 397130 1 766759 208409 769264 549213 641270 771837",
"output": "-1"
},
{
"input": "10\n635370 154890 909382 220996 276501 716105 538714 140162 171960 271264",
"output": "1"
},
{
"input": "50\n110876 835020 859879 999908 712969 788264 287153 921820 330355 499311 209594 484829 296329 940051 174081 931503 1 780512 390075 97866 124255 950067 697612 244256 782385 789882 37608 82153 399889 598867 416717 377988 535636 511221 792568 683271 131077 290194 496712 330720 587436 563481 645817 942562 654093 980561 382937 48293 582608 116156",
"output": "-1"
},
{
"input": "50\n474421 421097 217233 156339 27075 733996 281778 863492 184707 956857 288561 70997 393786 337382 663642 131184 637 273801 799870 295017 392338 842567 161819 297705 102013 930684 375703 838048 154915 138503 629056 256591 893619 19263 787927 684541 320265 841090 421423 490879 394582 493952 619247 633202 612928 50907 276653 407819 489945 153173",
"output": "1"
},
{
"input": "1\n1",
"output": "-1"
},
{
"input": "1\n1000000",
"output": "1"
},
{
"input": "2\n3 2",
"output": "1"
},
{
"input": "2\n2 3",
"output": "1"
}
] | 1,477,936,700 | 2,147,483,647 | Python 3 | OK | TESTS | 16 | 77 | 0 | n = input()
banknotes = [int(x) for x in input().split()]
print('-1') if 1 in banknotes else print('1') | Title: Currency System in Geraldion
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic island Geraldion, where Gerald lives, has its own currency system. It uses banknotes of several values. But the problem is, the system is not perfect and sometimes it happens that Geraldionians cannot express a certain sum of money with any set of banknotes. Of course, they can use any number of banknotes of each value. Such sum is called unfortunate. Gerald wondered: what is the minimum unfortunate sum?
Input Specification:
The first line contains number *n* (1<=≤<=*n*<=≤<=1000) — the number of values of the banknotes that used in Geraldion.
The second line contains *n* distinct space-separated numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=106) — the values of the banknotes.
Output Specification:
Print a single line — the minimum unfortunate sum. If there are no unfortunate sums, print <=-<=1.
Demo Input:
['5\n1 2 3 4 5\n']
Demo Output:
['-1\n']
Note:
none | ```python
n = input()
banknotes = [int(x) for x in input().split()]
print('-1') if 1 in banknotes else print('1')
``` | 3 |
|
514 | C | Watto and Mechanism | PROGRAMMING | 2,000 | [
"binary search",
"data structures",
"hashing",
"string suffix structures",
"strings"
] | null | null | Watto, the owner of a spare parts store, has recently got an order for the mechanism that can process strings in a certain way. Initially the memory of the mechanism is filled with *n* strings. Then the mechanism should be able to process queries of the following type: "Given string *s*, determine if the memory of the mechanism contains string *t* that consists of the same number of characters as *s* and differs from *s* in exactly one position".
Watto has already compiled the mechanism, all that's left is to write a program for it and check it on the data consisting of *n* initial lines and *m* queries. He decided to entrust this job to you. | The first line contains two non-negative numbers *n* and *m* (0<=≤<=*n*<=≤<=3·105, 0<=≤<=*m*<=≤<=3·105) — the number of the initial strings and the number of queries, respectively.
Next follow *n* non-empty strings that are uploaded to the memory of the mechanism.
Next follow *m* non-empty strings that are the queries to the mechanism.
The total length of lines in the input doesn't exceed 6·105. Each line consists only of letters 'a', 'b', 'c'. | For each query print on a single line "YES" (without the quotes), if the memory of the mechanism contains the required string, otherwise print "NO" (without the quotes). | [
"2 3\naaaaa\nacacaca\naabaa\nccacacc\ncaaac\n"
] | [
"YES\nNO\nNO\n"
] | none | 2,000 | [
{
"input": "2 3\naaaaa\nacacaca\naabaa\nccacacc\ncaaac",
"output": "YES\nNO\nNO"
},
{
"input": "1 5\nacbacbacb\ncbacbacb\nacbacbac\naacbacbacb\nacbacbacbb\nacbaabacb",
"output": "NO\nNO\nNO\nNO\nYES"
},
{
"input": "5 4\nab\ncacab\ncbabc\nacc\ncacab\nabc\naa\nacbca\ncb",
"output": "YES\nYES\nNO\nYES"
},
{
"input": "9 9\ncaccbcacabccba\naacbcbcaabacbcbcba\nbabccaaacccacbb\ncaaabcaacbababbabbb\nabbaccacabacaaaa\nbccbccababcaacb\ncaacbcaacbababbabbb\nbcacababbbcaaca\nccbbcbababbccaab\nbbcbccababcaacb\naacccbabbacbabacaca\nbbcbcccbabcaacb\nacbacacbcacc\ncaaabcaaabacabbabbb\nabbbabaaaba\naacccbcaabacbcbcba\nabbaccacabbcaaaa\naaccbbcabbacbcbcba",
"output": "YES\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO"
},
{
"input": "1 1\nbbbbbbbaaaabbbbbaabbbba\naaabbbabbbbbbbaabbabbbb",
"output": "NO"
}
] | 1,676,015,492 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 41 | 343 | 46,694,400 | # Use two hashes to avoid collisions
import sys
input = sys.stdin.readline
MAXN = 6 * 10 ** 5
MOD = 10 ** 9 + 7
base = [5, 7]
# hash stuff
pw = [[1] * MAXN for i in range(2)]
for j in range(2):
for i in range(1, MAXN):
pw[j][i] = pw[j][i - 1] * base[j] % MOD
def hash_s(s: str):
hsh = [0, 0]
for j in range(2):
for i, c in enumerate(s):
hsh[j] = (hsh[j] + (ord(c)-ord('a')+1) * pw[j][i]) % MOD
return hsh
def conv_hash(hsh):
return hsh[0] + hsh[1] * MOD
# Main solution procedure
n, m = map(int, input().split())
possible_string_hashes = set()
for _ in range(n):
s = input().strip()
base_hash = hash_s(s)
for i in range(len(s)):
sc = ord(s[i]) - ord('a')
for c in range(3):
if sc != c:
new_hsh = base_hash.copy()
for j in range(2):
new_hsh[j] = (new_hsh[j] + (c-sc) * pw[j][i]) % MOD
possible_string_hashes.add(conv_hash(new_hsh))
for query in range(m):
s = input().strip()
if conv_hash(hash_s(s)) in possible_string_hashes:
print("YES")
else:
print("NO")
| Title: Watto and Mechanism
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Watto, the owner of a spare parts store, has recently got an order for the mechanism that can process strings in a certain way. Initially the memory of the mechanism is filled with *n* strings. Then the mechanism should be able to process queries of the following type: "Given string *s*, determine if the memory of the mechanism contains string *t* that consists of the same number of characters as *s* and differs from *s* in exactly one position".
Watto has already compiled the mechanism, all that's left is to write a program for it and check it on the data consisting of *n* initial lines and *m* queries. He decided to entrust this job to you.
Input Specification:
The first line contains two non-negative numbers *n* and *m* (0<=≤<=*n*<=≤<=3·105, 0<=≤<=*m*<=≤<=3·105) — the number of the initial strings and the number of queries, respectively.
Next follow *n* non-empty strings that are uploaded to the memory of the mechanism.
Next follow *m* non-empty strings that are the queries to the mechanism.
The total length of lines in the input doesn't exceed 6·105. Each line consists only of letters 'a', 'b', 'c'.
Output Specification:
For each query print on a single line "YES" (without the quotes), if the memory of the mechanism contains the required string, otherwise print "NO" (without the quotes).
Demo Input:
['2 3\naaaaa\nacacaca\naabaa\nccacacc\ncaaac\n']
Demo Output:
['YES\nNO\nNO\n']
Note:
none | ```python
# Use two hashes to avoid collisions
import sys
input = sys.stdin.readline
MAXN = 6 * 10 ** 5
MOD = 10 ** 9 + 7
base = [5, 7]
# hash stuff
pw = [[1] * MAXN for i in range(2)]
for j in range(2):
for i in range(1, MAXN):
pw[j][i] = pw[j][i - 1] * base[j] % MOD
def hash_s(s: str):
hsh = [0, 0]
for j in range(2):
for i, c in enumerate(s):
hsh[j] = (hsh[j] + (ord(c)-ord('a')+1) * pw[j][i]) % MOD
return hsh
def conv_hash(hsh):
return hsh[0] + hsh[1] * MOD
# Main solution procedure
n, m = map(int, input().split())
possible_string_hashes = set()
for _ in range(n):
s = input().strip()
base_hash = hash_s(s)
for i in range(len(s)):
sc = ord(s[i]) - ord('a')
for c in range(3):
if sc != c:
new_hsh = base_hash.copy()
for j in range(2):
new_hsh[j] = (new_hsh[j] + (c-sc) * pw[j][i]) % MOD
possible_string_hashes.add(conv_hash(new_hsh))
for query in range(m):
s = input().strip()
if conv_hash(hash_s(s)) in possible_string_hashes:
print("YES")
else:
print("NO")
``` | 3 |
|
731 | A | Night at the Museum | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it. | The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters. | Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input. | [
"zeus\n",
"map\n",
"ares\n"
] | [
"18\n",
"35\n",
"34\n"
] | To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | 500 | [
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,697,576,970 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 0 | 61 | 2,764,800 | s=input()
curr=chr('a')
sum=0
for i in s:
sum+=min(chr(i)-curr,26-(chr(i)-curr))
curr=chr(i)
print(sum) | Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | ```python
s=input()
curr=chr('a')
sum=0
for i in s:
sum+=min(chr(i)-curr,26-(chr(i)-curr))
curr=chr(i)
print(sum)
``` | -1 |
|
342 | A | Xenia and Divisors | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | null | null | Xenia the mathematician has a sequence consisting of *n* (*n* is divisible by 3) positive integers, each of them is at most 7. She wants to split the sequence into groups of three so that for each group of three *a*,<=*b*,<=*c* the following conditions held:
- *a*<=<<=*b*<=<<=*c*; - *a* divides *b*, *b* divides *c*.
Naturally, Xenia wants each element of the sequence to belong to exactly one group of three. Thus, if the required partition exists, then it has groups of three.
Help Xenia, find the required partition or else say that it doesn't exist. | The first line contains integer *n* (3<=≤<=*n*<=≤<=99999) — the number of elements in the sequence. The next line contains *n* positive integers, each of them is at most 7.
It is guaranteed that *n* is divisible by 3. | If the required partition exists, print groups of three. Print each group as values of the elements it contains. You should print values in increasing order. Separate the groups and integers in groups by whitespaces. If there are multiple solutions, you can print any of them.
If there is no solution, print -1. | [
"6\n1 1 1 2 2 2\n",
"6\n2 2 1 1 4 6\n"
] | [
"-1\n",
"1 2 4\n1 2 6\n"
] | none | 500 | [
{
"input": "6\n1 1 1 2 2 2",
"output": "-1"
},
{
"input": "6\n2 2 1 1 4 6",
"output": "1 2 4\n1 2 6"
},
{
"input": "3\n1 2 3",
"output": "-1"
},
{
"input": "3\n7 5 7",
"output": "-1"
},
{
"input": "3\n1 3 4",
"output": "-1"
},
{
"input": "3\n1 1 1",
"output": "-1"
},
{
"input": "9\n1 3 6 6 3 1 3 1 6",
"output": "1 3 6\n1 3 6\n1 3 6"
},
{
"input": "6\n1 2 4 1 3 5",
"output": "-1"
},
{
"input": "3\n1 3 7",
"output": "-1"
},
{
"input": "3\n1 1 1",
"output": "-1"
},
{
"input": "9\n1 2 4 1 2 4 1 3 6",
"output": "1 2 4\n1 2 4\n1 3 6"
},
{
"input": "12\n3 6 1 1 3 6 1 1 2 6 2 6",
"output": "1 3 6\n1 3 6\n1 2 6\n1 2 6"
},
{
"input": "9\n1 1 1 4 4 4 6 2 2",
"output": "-1"
},
{
"input": "9\n1 2 4 6 3 1 3 1 5",
"output": "-1"
},
{
"input": "15\n2 1 2 1 3 6 1 2 1 6 1 3 4 6 4",
"output": "1 2 4\n1 2 4\n1 3 6\n1 3 6\n1 2 6"
},
{
"input": "3\n2 3 6",
"output": "-1"
},
{
"input": "3\n2 4 6",
"output": "-1"
},
{
"input": "3\n2 5 6",
"output": "-1"
},
{
"input": "3\n2 4 7",
"output": "-1"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "-1"
},
{
"input": "3\n7 7 7",
"output": "-1"
},
{
"input": "6\n1 2 4 7 7 7",
"output": "-1"
},
{
"input": "6\n1 1 2 6 6 6",
"output": "-1"
},
{
"input": "9\n1 1 1 3 3 2 4 4 6",
"output": "-1"
},
{
"input": "6\n1 2 4 5 5 5",
"output": "-1"
},
{
"input": "15\n1 1 1 1 1 2 2 2 2 4 4 6 6 6 6",
"output": "-1"
},
{
"input": "6\n1 1 5 5 7 7",
"output": "-1"
},
{
"input": "9\n1 1 1 2 3 4 5 6 7",
"output": "-1"
},
{
"input": "6\n1 1 4 4 7 7",
"output": "-1"
},
{
"input": "24\n1 1 1 1 1 1 1 1 1 2 2 2 3 3 3 3 3 3 4 4 4 6 6 6",
"output": "-1"
},
{
"input": "3\n1 7 6",
"output": "-1"
},
{
"input": "6\n1 1 2 4 7 7",
"output": "-1"
},
{
"input": "9\n1 1 1 7 7 7 7 7 7",
"output": "-1"
},
{
"input": "9\n1 1 1 2 3 4 6 5 5",
"output": "-1"
}
] | 1,615,977,339 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 1 | 77 | 0 | n=int(input())
nums=list(map(int,input().split()))
nums.sort()
stack=[]
flag=0
for i in range(n):
for j in range(i+1,n):
for k in range(j+1,n):
if nums[i]<nums[j]<nums[k] and nums[j]%nums[i]==0 and nums[k]%nums[j]==0:
stack.append(nums[i])
stack.append(nums[j])
stack.append(nums[k])
flag=1
break
if flag==1:
break
if flag==1:
break
if flag==0:
print(-1)
else:
print(*stack)
| Title: Xenia and Divisors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the mathematician has a sequence consisting of *n* (*n* is divisible by 3) positive integers, each of them is at most 7. She wants to split the sequence into groups of three so that for each group of three *a*,<=*b*,<=*c* the following conditions held:
- *a*<=<<=*b*<=<<=*c*; - *a* divides *b*, *b* divides *c*.
Naturally, Xenia wants each element of the sequence to belong to exactly one group of three. Thus, if the required partition exists, then it has groups of three.
Help Xenia, find the required partition or else say that it doesn't exist.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=99999) — the number of elements in the sequence. The next line contains *n* positive integers, each of them is at most 7.
It is guaranteed that *n* is divisible by 3.
Output Specification:
If the required partition exists, print groups of three. Print each group as values of the elements it contains. You should print values in increasing order. Separate the groups and integers in groups by whitespaces. If there are multiple solutions, you can print any of them.
If there is no solution, print -1.
Demo Input:
['6\n1 1 1 2 2 2\n', '6\n2 2 1 1 4 6\n']
Demo Output:
['-1\n', '1 2 4\n1 2 6\n']
Note:
none | ```python
n=int(input())
nums=list(map(int,input().split()))
nums.sort()
stack=[]
flag=0
for i in range(n):
for j in range(i+1,n):
for k in range(j+1,n):
if nums[i]<nums[j]<nums[k] and nums[j]%nums[i]==0 and nums[k]%nums[j]==0:
stack.append(nums[i])
stack.append(nums[j])
stack.append(nums[k])
flag=1
break
if flag==1:
break
if flag==1:
break
if flag==0:
print(-1)
else:
print(*stack)
``` | 0 |
|
246 | B | Increase and Decrease | PROGRAMMING | 1,300 | [
"greedy",
"math"
] | null | null | Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array. | Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation. | [
"2\n2 1\n",
"3\n1 4 1\n"
] | [
"1\n",
"3\n"
] | none | 1,000 | [
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 4 1",
"output": "3"
},
{
"input": "4\n2 -7 -2 -6",
"output": "3"
},
{
"input": "4\n2 0 -2 -1",
"output": "3"
},
{
"input": "6\n-1 1 0 0 -1 -1",
"output": "5"
},
{
"input": "5\n0 0 0 0 0",
"output": "5"
},
{
"input": "100\n968 793 -628 -416 942 -308 977 168 728 -879 952 781 -425 -475 -480 738 -740 142 -319 -116 -701 -183 41 324 -918 -391 -176 781 763 888 475 -617 134 -802 -133 -211 855 -869 -236 503 550 387 137 -221 -957 -800 -56 -673 440 -791 -217 -959 -892 886 -593 427 890 223 -425 -342 -262 693 -137 924 860 156 -110 444 -12 703 421 -638 725 -551 597 -206 -80 393 -441 -759 617 424 -506 209 579 -685 -861 507 312 597 -81 -491 424 222 -892 629 512 743 -452 -504",
"output": "99"
}
] | 1,539,710,386 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 216 | 0 | n=int(input())
s=sum(map(int, input().split()))
for i in range(n,0,-1):
if s%i==0:
print(i)
exit() | Title: Increase and Decrease
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
Output Specification:
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
Demo Input:
['2\n2 1\n', '3\n1 4 1\n']
Demo Output:
['1\n', '3\n']
Note:
none | ```python
n=int(input())
s=sum(map(int, input().split()))
for i in range(n,0,-1):
if s%i==0:
print(i)
exit()
``` | 0 |
|
599 | A | Patrick and Shopping | PROGRAMMING | 800 | [
"implementation"
] | null | null | Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house.
Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled. | The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths.
- *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops. | Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house. | [
"10 20 30\n",
"1 1 5\n"
] | [
"60\n",
"4\n"
] | The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. | 500 | [
{
"input": "10 20 30",
"output": "60"
},
{
"input": "1 1 5",
"output": "4"
},
{
"input": "100 33 34",
"output": "134"
},
{
"input": "777 777 777",
"output": "2331"
},
{
"input": "2 2 8",
"output": "8"
},
{
"input": "12 34 56",
"output": "92"
},
{
"input": "789 101112 131415",
"output": "203802"
},
{
"input": "27485716 99999999 35182",
"output": "55041796"
},
{
"input": "1 293548 5",
"output": "12"
},
{
"input": "12059 259855 5874875",
"output": "543828"
},
{
"input": "46981 105809 585858",
"output": "305580"
},
{
"input": "9889 1221 2442",
"output": "7326"
},
{
"input": "100500 200600 300700",
"output": "601800"
},
{
"input": "318476 318476 318476",
"output": "955428"
},
{
"input": "23985 3353 75633",
"output": "54676"
},
{
"input": "120 1298 2222",
"output": "2836"
},
{
"input": "98437 23487 666672",
"output": "243848"
},
{
"input": "100000000 100000000 100000000",
"output": "300000000"
},
{
"input": "2 5 2",
"output": "8"
},
{
"input": "1 1000 1",
"output": "4"
},
{
"input": "1 100000000 1",
"output": "4"
}
] | 1,592,815,620 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 0 | 187 | 2,252,800 | d1,d2,d3 = map(int, input().split())
print(min(2*d1+2*d2),min(d1+d2+d3)) | Title: Patrick and Shopping
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today Patrick waits for a visit from his friend Spongebob. To prepare for the visit, Patrick needs to buy some goodies in two stores located near his house. There is a *d*1 meter long road between his house and the first shop and a *d*2 meter long road between his house and the second shop. Also, there is a road of length *d*3 directly connecting these two shops to each other. Help Patrick calculate the minimum distance that he needs to walk in order to go to both shops and return to his house.
Patrick always starts at his house. He should visit both shops moving only along the three existing roads and return back to his house. He doesn't mind visiting the same shop or passing the same road multiple times. The only goal is to minimize the total distance traveled.
Input Specification:
The first line of the input contains three integers *d*1, *d*2, *d*3 (1<=≤<=*d*1,<=*d*2,<=*d*3<=≤<=108) — the lengths of the paths.
- *d*1 is the length of the path connecting Patrick's house and the first shop; - *d*2 is the length of the path connecting Patrick's house and the second shop; - *d*3 is the length of the path connecting both shops.
Output Specification:
Print the minimum distance that Patrick will have to walk in order to visit both shops and return to his house.
Demo Input:
['10 20 30\n', '1 1 5\n']
Demo Output:
['60\n', '4\n']
Note:
The first sample is shown on the picture in the problem statement. One of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house.
In the second sample one of the optimal routes is: house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> first shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> second shop <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> house. | ```python
d1,d2,d3 = map(int, input().split())
print(min(2*d1+2*d2),min(d1+d2+d3))
``` | -1 |
|
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
] | A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] | [
"word\nl10n\ni18n\np43s\n"
] | none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,696,499,871 | 2,147,483,647 | Python 3 | OK | TESTS | 20 | 46 | 0 | for _ in range(int(input())):
inp=input()
if len(inp)<=10:
print(inp)
else:
s=""
s+=inp[0]
s+=str(len(inp)-2)
s+=inp[-1]
print(s)
| Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
for _ in range(int(input())):
inp=input()
if len(inp)<=10:
print(inp)
else:
s=""
s+=inp[0]
s+=str(len(inp)-2)
s+=inp[-1]
print(s)
``` | 3.977 |
633 | C | Spy Syndrome 2 | PROGRAMMING | 1,900 | [
"data structures",
"dp",
"hashing",
"implementation",
"sortings",
"string suffix structures",
"strings"
] | null | null | After observing the results of Spy Syndrome, Yash realised the errors of his ways. He now believes that a super spy such as Siddhant can't use a cipher as basic and ancient as Caesar cipher. After many weeks of observation of Siddhant’s sentences, Yash determined a new cipher technique.
For a given sentence, the cipher is processed as:
1. Convert all letters of the sentence to lowercase. 1. Reverse each of the words of the sentence individually. 1. Remove all the spaces in the sentence.
For example, when this cipher is applied to the sentence
Kira is childish and he hates losing
the resulting string is
ariksihsidlihcdnaehsetahgnisol
Now Yash is given some ciphered string and a list of words. Help him to find out any original sentence composed using only words from the list. Note, that any of the given words could be used in the sentence multiple times. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10<=000) — the length of the ciphered text. The second line consists of *n* lowercase English letters — the ciphered text *t*.
The third line contains a single integer *m* (1<=≤<=*m*<=≤<=100<=000) — the number of words which will be considered while deciphering the text. Each of the next *m* lines contains a non-empty word *w**i* (|*w**i*|<=≤<=1<=000) consisting of uppercase and lowercase English letters only. It's guaranteed that the total length of all words doesn't exceed 1<=000<=000. | Print one line — the original sentence. It is guaranteed that at least one solution exists. If there are multiple solutions, you may output any of those. | [
"30\nariksihsidlihcdnaehsetahgnisol\n10\nKira\nhates\nis\nhe\nlosing\ndeath\nchildish\nL\nand\nNote\n",
"12\niherehtolleh\n5\nHI\nHo\nthere\nHeLLo\nhello\n"
] | [
"Kira is childish and he hates losing \n",
"HI there HeLLo \n"
] | In sample case 2 there may be multiple accepted outputs, "HI there HeLLo" and "HI there hello" you may output any of them. | 1,500 | [
{
"input": "30\nariksihsidlihcdnaehsetahgnisol\n10\nKira\nhates\nis\nhe\nlosing\ndeath\nchildish\nL\nand\nNote",
"output": "Kira is childish and he hates losing "
},
{
"input": "12\niherehtolleh\n5\nHI\nHo\nthere\nHeLLo\nhello",
"output": "HI there HeLLo "
},
{
"input": "71\nbaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n8\na\naa\naaa\naaaa\naaaaa\naaaaaa\naaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaab",
"output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaab "
},
{
"input": "11\naaaaaaaaaaa\n3\naaaa\naaaaa\naaaaaa",
"output": "aaaaaa aaaaa "
},
{
"input": "5\ncbaed\n6\nbc\nea\nab\ncd\nabc\nde",
"output": "abc de "
},
{
"input": "5\nlehet\n3\nel\nhel\nte",
"output": "hel te "
},
{
"input": "3\naab\n2\na\nbaa",
"output": "baa "
},
{
"input": "3\naab\n2\naa\nbaa",
"output": "baa "
},
{
"input": "9\naaaaaaaaa\n2\naa\naaa",
"output": "aaa aa aa aa "
},
{
"input": "7\nabababc\n2\nba\ncba",
"output": "ba ba cba "
},
{
"input": "7\nkirkirk\n2\nrik\nkrik",
"output": "rik krik "
}
] | 1,456,511,623 | 4,723 | Python 3 | RUNTIME_ERROR | PRETESTS | 2 | 170 | 921,600 | dp = dict()
def solve(index,cur_word,temp,n):
if cur_word in dp:
if not dp[cur_word]:
return False
else:
return temp + dp[cur_word]
if cur_word in d:
w = d[cur_word]
else:
w = -1
if index == n:
if w != -1:
return temp + [w]
else:
return False
if w == -1:
dp[cur_word] = solve(index + 1,cur_word + s[index],temp,n)
else:
dp[cur_word] = solve(index + 1,s[index],temp + [w],n) or solve(index + 1,cur_word + s[index],temp,n)
return dp[cur_word]
n = int(input())
s = input()
m = int(input())
words = [input() for i in range(m)]
reversed_lower = [s[::-1].lower() for s in words]
d = {word:index for index, word in enumerate(reversed_lower)}
answer = solve(1,s[0],[],n)
for index in answer:
print(words[index],end = ' ')
print()
| Title: Spy Syndrome 2
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After observing the results of Spy Syndrome, Yash realised the errors of his ways. He now believes that a super spy such as Siddhant can't use a cipher as basic and ancient as Caesar cipher. After many weeks of observation of Siddhant’s sentences, Yash determined a new cipher technique.
For a given sentence, the cipher is processed as:
1. Convert all letters of the sentence to lowercase. 1. Reverse each of the words of the sentence individually. 1. Remove all the spaces in the sentence.
For example, when this cipher is applied to the sentence
Kira is childish and he hates losing
the resulting string is
ariksihsidlihcdnaehsetahgnisol
Now Yash is given some ciphered string and a list of words. Help him to find out any original sentence composed using only words from the list. Note, that any of the given words could be used in the sentence multiple times.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10<=000) — the length of the ciphered text. The second line consists of *n* lowercase English letters — the ciphered text *t*.
The third line contains a single integer *m* (1<=≤<=*m*<=≤<=100<=000) — the number of words which will be considered while deciphering the text. Each of the next *m* lines contains a non-empty word *w**i* (|*w**i*|<=≤<=1<=000) consisting of uppercase and lowercase English letters only. It's guaranteed that the total length of all words doesn't exceed 1<=000<=000.
Output Specification:
Print one line — the original sentence. It is guaranteed that at least one solution exists. If there are multiple solutions, you may output any of those.
Demo Input:
['30\nariksihsidlihcdnaehsetahgnisol\n10\nKira\nhates\nis\nhe\nlosing\ndeath\nchildish\nL\nand\nNote\n', '12\niherehtolleh\n5\nHI\nHo\nthere\nHeLLo\nhello\n']
Demo Output:
['Kira is childish and he hates losing \n', 'HI there HeLLo \n']
Note:
In sample case 2 there may be multiple accepted outputs, "HI there HeLLo" and "HI there hello" you may output any of them. | ```python
dp = dict()
def solve(index,cur_word,temp,n):
if cur_word in dp:
if not dp[cur_word]:
return False
else:
return temp + dp[cur_word]
if cur_word in d:
w = d[cur_word]
else:
w = -1
if index == n:
if w != -1:
return temp + [w]
else:
return False
if w == -1:
dp[cur_word] = solve(index + 1,cur_word + s[index],temp,n)
else:
dp[cur_word] = solve(index + 1,s[index],temp + [w],n) or solve(index + 1,cur_word + s[index],temp,n)
return dp[cur_word]
n = int(input())
s = input()
m = int(input())
words = [input() for i in range(m)]
reversed_lower = [s[::-1].lower() for s in words]
d = {word:index for index, word in enumerate(reversed_lower)}
answer = solve(1,s[0],[],n)
for index in answer:
print(words[index],end = ' ')
print()
``` | -1 |
|
907 | A | Masha and Bears | PROGRAMMING | 1,300 | [
"brute force",
"implementation"
] | null | null | A family consisting of father bear, mother bear and son bear owns three cars. Father bear can climb into the largest car and he likes it. Also, mother bear can climb into the middle car and she likes it. Moreover, son bear can climb into the smallest car and he likes it. It's known that the largest car is strictly larger than the middle car, and the middle car is strictly larger than the smallest car.
Masha came to test these cars. She could climb into all cars, but she liked only the smallest car.
It's known that a character with size *a* can climb into some car with size *b* if and only if *a*<=≤<=*b*, he or she likes it if and only if he can climb into this car and 2*a*<=≥<=*b*.
You are given sizes of bears and Masha. Find out some possible integer non-negative sizes of cars. | You are given four integers *V*1, *V*2, *V*3, *V**m*(1<=≤<=*V**i*<=≤<=100) — sizes of father bear, mother bear, son bear and Masha, respectively. It's guaranteed that *V*1<=><=*V*2<=><=*V*3. | Output three integers — sizes of father bear's car, mother bear's car and son bear's car, respectively.
If there are multiple possible solutions, print any.
If there is no solution, print "-1" (without quotes). | [
"50 30 10 10\n",
"100 50 10 21\n"
] | [
"50\n30\n10\n",
"-1\n"
] | In first test case all conditions for cars' sizes are satisfied.
In second test case there is no answer, because Masha should be able to climb into smallest car (so size of smallest car in not less than 21), but son bear should like it, so maximum possible size of it is 20. | 500 | [
{
"input": "50 30 10 10",
"output": "50\n30\n10"
},
{
"input": "100 50 10 21",
"output": "-1"
},
{
"input": "100 50 19 10",
"output": "100\n50\n19"
},
{
"input": "99 50 25 49",
"output": "100\n99\n49"
},
{
"input": "3 2 1 1",
"output": "4\n3\n1"
},
{
"input": "100 99 98 100",
"output": "-1"
},
{
"input": "100 40 30 40",
"output": "-1"
},
{
"input": "100 50 19 25",
"output": "100\n51\n25"
},
{
"input": "100 50 19 30",
"output": "100\n61\n30"
},
{
"input": "49 48 25 49",
"output": "-1"
},
{
"input": "48 47 23 46",
"output": "94\n93\n46"
},
{
"input": "37 23 16 20",
"output": "42\n41\n20"
},
{
"input": "98 2 1 1",
"output": "98\n3\n1"
},
{
"input": "99 22 13 14",
"output": "99\n29\n14"
},
{
"input": "97 95 3 2",
"output": "97\n95\n3"
},
{
"input": "27 3 2 3",
"output": "-1"
},
{
"input": "13 7 6 2",
"output": "-1"
},
{
"input": "19 17 11 6",
"output": "19\n17\n11"
},
{
"input": "15 6 4 5",
"output": "15\n11\n5"
},
{
"input": "21 3 1 3",
"output": "-1"
},
{
"input": "100 99 98 97",
"output": "196\n195\n98"
},
{
"input": "99 32 13 5",
"output": "-1"
},
{
"input": "5 4 3 1",
"output": "-1"
},
{
"input": "50 20 4 8",
"output": "50\n20\n8"
},
{
"input": "60 30 10 1",
"output": "-1"
},
{
"input": "100 50 10 1",
"output": "-1"
},
{
"input": "40 30 20 10",
"output": "40\n30\n20"
},
{
"input": "50 49 5 10",
"output": "50\n49\n10"
},
{
"input": "99 98 50 97",
"output": "196\n195\n97"
},
{
"input": "50 30 10 5",
"output": "50\n30\n10"
},
{
"input": "4 3 2 1",
"output": "4\n3\n2"
},
{
"input": "100 50 3 1",
"output": "-1"
}
] | 1,514,038,416 | 516 | Python 3 | COMPILATION_ERROR | PRETESTS | 0 | 0 | 0 | #include <bits/stdc++.h>
using namespace std;
int main(){
int V1,V2,V3,C1,C2,C3,Vm;
scanf ("%d%d%d%d",&V1,&V2,&V3,&Vm);
C3 = max(Vm,V3);
C2 = V2;
C1 = V1;
if (V3 <= C3 && 2*V3 >= C3 && 2*Vm >= C3 && Vm <= C3){
printf ("%d\n%d\n%d\n",C1,C2,C3);
}else{
printf ("-1\n");
}
return 0;
}
| Title: Masha and Bears
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A family consisting of father bear, mother bear and son bear owns three cars. Father bear can climb into the largest car and he likes it. Also, mother bear can climb into the middle car and she likes it. Moreover, son bear can climb into the smallest car and he likes it. It's known that the largest car is strictly larger than the middle car, and the middle car is strictly larger than the smallest car.
Masha came to test these cars. She could climb into all cars, but she liked only the smallest car.
It's known that a character with size *a* can climb into some car with size *b* if and only if *a*<=≤<=*b*, he or she likes it if and only if he can climb into this car and 2*a*<=≥<=*b*.
You are given sizes of bears and Masha. Find out some possible integer non-negative sizes of cars.
Input Specification:
You are given four integers *V*1, *V*2, *V*3, *V**m*(1<=≤<=*V**i*<=≤<=100) — sizes of father bear, mother bear, son bear and Masha, respectively. It's guaranteed that *V*1<=><=*V*2<=><=*V*3.
Output Specification:
Output three integers — sizes of father bear's car, mother bear's car and son bear's car, respectively.
If there are multiple possible solutions, print any.
If there is no solution, print "-1" (without quotes).
Demo Input:
['50 30 10 10\n', '100 50 10 21\n']
Demo Output:
['50\n30\n10\n', '-1\n']
Note:
In first test case all conditions for cars' sizes are satisfied.
In second test case there is no answer, because Masha should be able to climb into smallest car (so size of smallest car in not less than 21), but son bear should like it, so maximum possible size of it is 20. | ```python
#include <bits/stdc++.h>
using namespace std;
int main(){
int V1,V2,V3,C1,C2,C3,Vm;
scanf ("%d%d%d%d",&V1,&V2,&V3,&Vm);
C3 = max(Vm,V3);
C2 = V2;
C1 = V1;
if (V3 <= C3 && 2*V3 >= C3 && 2*Vm >= C3 && Vm <= C3){
printf ("%d\n%d\n%d\n",C1,C2,C3);
}else{
printf ("-1\n");
}
return 0;
}
``` | -1 |
|
242 | B | Big Segment | PROGRAMMING | 1,100 | [
"implementation",
"sortings"
] | null | null | A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide. | Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input. | [
"3\n1 1\n2 2\n3 3\n",
"6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n"
] | [
"-1\n",
"3\n"
] | none | 1,000 | [
{
"input": "3\n1 1\n2 2\n3 3",
"output": "-1"
},
{
"input": "6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10",
"output": "3"
},
{
"input": "4\n1 5\n2 2\n2 4\n2 5",
"output": "1"
},
{
"input": "5\n3 3\n1 3\n2 2\n2 3\n1 2",
"output": "2"
},
{
"input": "7\n7 7\n8 8\n3 7\n1 6\n1 7\n4 7\n2 8",
"output": "-1"
},
{
"input": "3\n2 5\n3 4\n2 3",
"output": "1"
},
{
"input": "16\n15 15\n8 12\n6 9\n15 16\n8 14\n3 12\n7 19\n9 13\n5 16\n9 17\n10 15\n9 14\n9 9\n18 19\n5 15\n6 19",
"output": "-1"
},
{
"input": "9\n1 10\n7 8\n6 7\n1 4\n5 9\n2 8\n3 10\n1 1\n2 3",
"output": "1"
},
{
"input": "1\n1 100000",
"output": "1"
},
{
"input": "6\n2 2\n3 3\n3 5\n4 5\n1 1\n1 5",
"output": "6"
},
{
"input": "33\n2 18\n4 14\n2 16\n10 12\n4 6\n9 17\n2 8\n4 12\n8 20\n1 10\n11 14\n11 17\n8 15\n3 16\n3 4\n6 9\n6 19\n4 17\n17 19\n6 16\n3 12\n1 7\n6 20\n8 16\n12 19\n1 3\n12 18\n6 11\n7 20\n16 18\n4 15\n3 15\n15 19",
"output": "-1"
},
{
"input": "34\n3 8\n5 9\n2 9\n1 4\n3 7\n3 3\n8 9\n6 10\n4 7\n6 7\n5 8\n5 10\n1 5\n8 8\n2 5\n3 5\n7 7\n2 8\n4 5\n1 1\n7 9\n5 6\n2 3\n1 2\n2 4\n8 10\n7 8\n1 3\n4 8\n9 10\n1 7\n10 10\n2 2\n1 8",
"output": "-1"
},
{
"input": "55\n3 4\n6 8\n9 10\n3 9\n9 9\n2 5\n4 8\n3 8\n8 10\n1 1\n4 9\n10 10\n6 6\n8 8\n1 8\n5 5\n4 5\n5 9\n2 2\n3 10\n4 6\n3 6\n1 6\n1 7\n6 10\n2 6\n3 7\n2 4\n4 4\n5 10\n1 4\n2 9\n1 3\n7 9\n7 8\n1 9\n1 10\n2 8\n8 9\n6 7\n1 2\n6 9\n7 7\n4 7\n3 3\n2 7\n4 10\n7 10\n2 3\n2 10\n5 7\n3 5\n5 8\n1 5\n5 6",
"output": "37"
},
{
"input": "1\n999999999 1000000000",
"output": "1"
},
{
"input": "3\n1 20\n2 22\n3 18",
"output": "-1"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "2\n100001 100008\n100005 100006",
"output": "1"
},
{
"input": "1\n1000000 10000000",
"output": "1"
},
{
"input": "3\n3 6\n2 4\n1 5",
"output": "-1"
},
{
"input": "2\n3 5\n1 2",
"output": "-1"
}
] | 1,618,949,676 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 9 | 186 | 0 | min_val = float("inf")
max_val = float("-inf")
min_idx = max_idx = 0
idx = 1
for _ in range(int(input())):
x, y = map(int, input().split())
if x == min_val and y == max_val:
pass
elif x <= min_val and y >= max_val:
min_idx = max_idx = idx
elif x < min_val:
min_idx = idx
elif y > max_val:
max_idx = idx
min_val = min(x, min_val)
max_val = max(y, max_val)
idx += 1
if min_idx == max_idx:
print(min_idx)
else:
print(-1) | Title: Big Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
Output Specification:
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n']
Demo Output:
['-1\n', '3\n']
Note:
none | ```python
min_val = float("inf")
max_val = float("-inf")
min_idx = max_idx = 0
idx = 1
for _ in range(int(input())):
x, y = map(int, input().split())
if x == min_val and y == max_val:
pass
elif x <= min_val and y >= max_val:
min_idx = max_idx = idx
elif x < min_val:
min_idx = idx
elif y > max_val:
max_idx = idx
min_val = min(x, min_val)
max_val = max(y, max_val)
idx += 1
if min_idx == max_idx:
print(min_idx)
else:
print(-1)
``` | 0 |
|
472 | A | Design Tutorial: Learn from Math | PROGRAMMING | 800 | [
"math",
"number theory"
] | null | null | One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers. | The only line contains an integer *n* (12<=≤<=*n*<=≤<=106). | Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them. | [
"12\n",
"15\n",
"23\n",
"1000000\n"
] | [
"4 8\n",
"6 9\n",
"8 15\n",
"500000 500000\n"
] | In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number. | 500 | [
{
"input": "12",
"output": "4 8"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "23",
"output": "8 15"
},
{
"input": "1000000",
"output": "500000 500000"
},
{
"input": "63874",
"output": "4 63870"
},
{
"input": "14568",
"output": "4 14564"
},
{
"input": "192",
"output": "4 188"
},
{
"input": "86",
"output": "4 82"
},
{
"input": "46220",
"output": "4 46216"
},
{
"input": "57114",
"output": "4 57110"
},
{
"input": "869",
"output": "4 865"
},
{
"input": "738457",
"output": "4 738453"
},
{
"input": "58113",
"output": "6 58107"
},
{
"input": "4864",
"output": "4 4860"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "74752",
"output": "4 74748"
},
{
"input": "6073",
"output": "4 6069"
},
{
"input": "1289",
"output": "4 1285"
},
{
"input": "20",
"output": "4 16"
},
{
"input": "58134",
"output": "4 58130"
},
{
"input": "57756",
"output": "4 57752"
},
{
"input": "765",
"output": "6 759"
},
{
"input": "59",
"output": "4 55"
},
{
"input": "991666",
"output": "4 991662"
},
{
"input": "70761",
"output": "4 70757"
},
{
"input": "13",
"output": "4 9"
},
{
"input": "999999",
"output": "4 999995"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "21",
"output": "6 15"
},
{
"input": "19",
"output": "4 15"
},
{
"input": "100007",
"output": "6 100001"
},
{
"input": "999987",
"output": "6 999981"
},
{
"input": "22",
"output": "4 18"
}
] | 1,684,276,322 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 33 | 77 | 0 | def prime(n):
if n == 1 or n == 2 :
return True
else:
p = int(n**(1/2))+1
for i in range(2,p):
if n%i == 0:
return False
return True
n = int(input())
i = 3
while prime(i) or prime(n-i) :
i +=1
print(i,n-i) | Title: Design Tutorial: Learn from Math
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
Input Specification:
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output Specification:
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
Demo Input:
['12\n', '15\n', '23\n', '1000000\n']
Demo Output:
['4 8\n', '6 9\n', '8 15\n', '500000 500000\n']
Note:
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number. | ```python
def prime(n):
if n == 1 or n == 2 :
return True
else:
p = int(n**(1/2))+1
for i in range(2,p):
if n%i == 0:
return False
return True
n = int(input())
i = 3
while prime(i) or prime(n-i) :
i +=1
print(i,n-i)
``` | 3 |
|
961 | B | Lecture Sleep | PROGRAMMING | 1,200 | [
"data structures",
"dp",
"implementation",
"two pointers"
] | null | null | Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute.
Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing.
You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells.
You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up. | The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake.
The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute.
The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture. | Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up. | [
"6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n"
] | [
"16\n"
] | In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16. | 0 | [
{
"input": "6 3\n1 3 5 2 5 4\n1 1 0 1 0 0",
"output": "16"
},
{
"input": "5 3\n1 9999 10000 10000 10000\n0 0 0 0 0",
"output": "30000"
},
{
"input": "3 3\n10 10 10\n1 1 0",
"output": "30"
},
{
"input": "1 1\n423\n0",
"output": "423"
},
{
"input": "6 6\n1 3 5 2 5 4\n1 1 0 1 0 0",
"output": "20"
},
{
"input": "5 2\n1 2 3 4 20\n0 0 0 1 0",
"output": "24"
},
{
"input": "3 1\n1 2 3\n0 0 1",
"output": "5"
},
{
"input": "4 2\n4 5 6 8\n1 0 1 0",
"output": "18"
},
{
"input": "6 3\n1 3 5 2 1 15\n1 1 0 1 0 0",
"output": "22"
},
{
"input": "5 5\n1 2 3 4 5\n1 1 1 0 1",
"output": "15"
},
{
"input": "3 3\n3 3 3\n1 0 1",
"output": "9"
},
{
"input": "5 5\n500 44 3 4 50\n1 0 0 0 0",
"output": "601"
},
{
"input": "2 2\n3 2\n1 0",
"output": "5"
},
{
"input": "7 6\n4 9 1 7 1 8 4\n0 0 0 1 0 1 0",
"output": "30"
},
{
"input": "4 3\n6 5 9 6\n1 1 0 1",
"output": "26"
},
{
"input": "2 1\n3 2\n0 0",
"output": "3"
},
{
"input": "1 1\n10\n0",
"output": "10"
},
{
"input": "2 1\n3 2\n1 0",
"output": "5"
},
{
"input": "4 2\n3 6 7 2\n0 0 1 1",
"output": "18"
},
{
"input": "10 5\n3 5 9 2 5 9 3 8 8 1\n0 1 1 1 0 1 0 0 0 0",
"output": "49"
},
{
"input": "10 4\n9 5 6 4 3 9 5 1 10 7\n0 0 0 0 0 0 1 0 0 1",
"output": "36"
},
{
"input": "9 8\n3 3 7 7 1 9 10 7 1\n1 1 1 1 1 1 1 1 1",
"output": "48"
},
{
"input": "2 1\n3 4\n0 0",
"output": "4"
},
{
"input": "2 1\n3 2\n0 1",
"output": "5"
},
{
"input": "10 1\n6 6 8 7 6 6 3 2 5 6\n0 0 1 0 0 1 0 1 1 1",
"output": "34"
},
{
"input": "3 2\n10 10 6\n0 0 0",
"output": "20"
},
{
"input": "6 3\n1 3 5 2 5 4\n1 1 1 1 1 1",
"output": "20"
},
{
"input": "10 5\n1 1 1 1 1 1 1 1 10000 1\n1 1 1 1 1 1 1 1 0 1",
"output": "10009"
}
] | 1,672,850,081 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 19 | 156 | 11,468,800 | N, m = tuple(map(int, input().split()))
arr = list(map(int, input().split()))
state = list(map(int, input().split()))
ones_sum = 0
curr_sum = 0
for i in range(len(state)):
if state[i] == 1:
ones_sum += arr[i]
elif i < m:
curr_sum += arr[i]
ans = 0
for i in range(m, len(state)):
if state[i] == 0:
curr_sum += arr[i]
if state[i - m] == 0:
curr_sum -= arr[i - m]
ans = max(ans, curr_sum)
ans = max(ans, curr_sum) + ones_sum
print(ans) | Title: Lecture Sleep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute.
Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing.
You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells.
You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
Input Specification:
The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake.
The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute.
The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture.
Output Specification:
Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
Demo Input:
['6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n']
Demo Output:
['16\n']
Note:
In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16. | ```python
N, m = tuple(map(int, input().split()))
arr = list(map(int, input().split()))
state = list(map(int, input().split()))
ones_sum = 0
curr_sum = 0
for i in range(len(state)):
if state[i] == 1:
ones_sum += arr[i]
elif i < m:
curr_sum += arr[i]
ans = 0
for i in range(m, len(state)):
if state[i] == 0:
curr_sum += arr[i]
if state[i - m] == 0:
curr_sum -= arr[i - m]
ans = max(ans, curr_sum)
ans = max(ans, curr_sum) + ones_sum
print(ans)
``` | 0 |
|
439 | A | Devu, the Singer and Churu, the Joker | PROGRAMMING | 900 | [
"greedy",
"implementation"
] | null | null | Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event. | The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100). | If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event. | [
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] | [
"5\n",
"-1\n"
] | Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1. | 500 | [
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,611,390,166 | 2,147,483,647 | Python 3 | OK | TESTS | 26 | 77 | 0 |
n,d = map(int,input().split())
a=list(map(int,input().split()))
if d < (sum(a) + (len(a)-1)*10):
print(-1)
else:
x=(d-sum(a))//5
print(x)
| Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1. | ```python
n,d = map(int,input().split())
a=list(map(int,input().split()))
if d < (sum(a) + (len(a)-1)*10):
print(-1)
else:
x=(d-sum(a))//5
print(x)
``` | 3 |
|
270 | A | Fancy Fence | PROGRAMMING | 1,100 | [
"geometry",
"implementation",
"math"
] | null | null | Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? | The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees. | For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. | [
"3\n30\n60\n90\n"
] | [
"NO\nYES\nYES\n"
] | In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | 500 | [
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,642,775,411 | 2,147,483,647 | Python 3 | OK | TESTS | 3 | 92 | 0 | for _ in range(int(input())):
a = int(input())
print("YES") if 360%(180-a)==0 else print("NO") | Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | ```python
for _ in range(int(input())):
a = int(input())
print("YES") if 360%(180-a)==0 else print("NO")
``` | 3 |
|
845 | B | Luba And The Ticket | PROGRAMMING | 1,600 | [
"brute force",
"greedy",
"implementation"
] | null | null | Luba has a ticket consisting of 6 digits. In one move she can choose digit in any position and replace it with arbitrary digit. She wants to know the minimum number of digits she needs to replace in order to make the ticket lucky.
The ticket is considered lucky if the sum of first three digits equals to the sum of last three digits. | You are given a string consisting of 6 characters (all characters are digits from 0 to 9) — this string denotes Luba's ticket. The ticket can start with the digit 0. | Print one number — the minimum possible number of digits Luba needs to replace to make the ticket lucky. | [
"000000\n",
"123456\n",
"111000\n"
] | [
"0\n",
"2\n",
"1\n"
] | In the first example the ticket is already lucky, so the answer is 0.
In the second example Luba can replace 4 and 5 with zeroes, and the ticket will become lucky. It's easy to see that at least two replacements are required.
In the third example Luba can replace any zero with 3. It's easy to see that at least one replacement is required. | 0 | [
{
"input": "000000",
"output": "0"
},
{
"input": "123456",
"output": "2"
},
{
"input": "111000",
"output": "1"
},
{
"input": "120111",
"output": "0"
},
{
"input": "999999",
"output": "0"
},
{
"input": "199880",
"output": "1"
},
{
"input": "899889",
"output": "1"
},
{
"input": "899888",
"output": "1"
},
{
"input": "505777",
"output": "2"
},
{
"input": "999000",
"output": "3"
},
{
"input": "989010",
"output": "3"
},
{
"input": "651894",
"output": "1"
},
{
"input": "858022",
"output": "2"
},
{
"input": "103452",
"output": "1"
},
{
"input": "999801",
"output": "2"
},
{
"input": "999990",
"output": "1"
},
{
"input": "697742",
"output": "1"
},
{
"input": "242367",
"output": "2"
},
{
"input": "099999",
"output": "1"
},
{
"input": "198999",
"output": "1"
},
{
"input": "023680",
"output": "1"
},
{
"input": "999911",
"output": "2"
},
{
"input": "000990",
"output": "2"
},
{
"input": "117099",
"output": "1"
},
{
"input": "990999",
"output": "1"
},
{
"input": "000111",
"output": "1"
},
{
"input": "000444",
"output": "2"
},
{
"input": "202597",
"output": "2"
},
{
"input": "000333",
"output": "1"
},
{
"input": "030039",
"output": "1"
},
{
"input": "000009",
"output": "1"
},
{
"input": "006456",
"output": "1"
},
{
"input": "022995",
"output": "3"
},
{
"input": "999198",
"output": "1"
},
{
"input": "223456",
"output": "2"
},
{
"input": "333665",
"output": "2"
},
{
"input": "123986",
"output": "2"
},
{
"input": "599257",
"output": "1"
},
{
"input": "101488",
"output": "3"
},
{
"input": "111399",
"output": "2"
},
{
"input": "369009",
"output": "1"
},
{
"input": "024887",
"output": "2"
},
{
"input": "314347",
"output": "1"
},
{
"input": "145892",
"output": "1"
},
{
"input": "321933",
"output": "1"
},
{
"input": "100172",
"output": "1"
},
{
"input": "222455",
"output": "2"
},
{
"input": "317596",
"output": "1"
},
{
"input": "979245",
"output": "2"
},
{
"input": "000018",
"output": "1"
},
{
"input": "101389",
"output": "2"
},
{
"input": "123985",
"output": "2"
},
{
"input": "900000",
"output": "1"
},
{
"input": "132069",
"output": "1"
},
{
"input": "949256",
"output": "1"
},
{
"input": "123996",
"output": "2"
},
{
"input": "034988",
"output": "2"
},
{
"input": "320869",
"output": "2"
},
{
"input": "089753",
"output": "1"
},
{
"input": "335667",
"output": "2"
},
{
"input": "868580",
"output": "1"
},
{
"input": "958031",
"output": "2"
},
{
"input": "117999",
"output": "2"
},
{
"input": "000001",
"output": "1"
},
{
"input": "213986",
"output": "2"
},
{
"input": "123987",
"output": "3"
},
{
"input": "111993",
"output": "2"
},
{
"input": "642479",
"output": "1"
},
{
"input": "033788",
"output": "2"
},
{
"input": "766100",
"output": "2"
},
{
"input": "012561",
"output": "1"
},
{
"input": "111695",
"output": "2"
},
{
"input": "123689",
"output": "2"
},
{
"input": "944234",
"output": "1"
},
{
"input": "154999",
"output": "2"
},
{
"input": "333945",
"output": "1"
},
{
"input": "371130",
"output": "1"
},
{
"input": "977330",
"output": "2"
},
{
"input": "777544",
"output": "2"
},
{
"input": "111965",
"output": "2"
},
{
"input": "988430",
"output": "2"
},
{
"input": "123789",
"output": "3"
},
{
"input": "111956",
"output": "2"
},
{
"input": "444776",
"output": "2"
},
{
"input": "001019",
"output": "1"
},
{
"input": "011299",
"output": "2"
},
{
"input": "011389",
"output": "2"
},
{
"input": "999333",
"output": "2"
},
{
"input": "126999",
"output": "2"
},
{
"input": "744438",
"output": "0"
},
{
"input": "588121",
"output": "3"
},
{
"input": "698213",
"output": "2"
},
{
"input": "652858",
"output": "1"
},
{
"input": "989304",
"output": "3"
},
{
"input": "888213",
"output": "3"
},
{
"input": "969503",
"output": "2"
},
{
"input": "988034",
"output": "2"
},
{
"input": "889444",
"output": "2"
},
{
"input": "990900",
"output": "1"
},
{
"input": "301679",
"output": "2"
},
{
"input": "434946",
"output": "1"
},
{
"input": "191578",
"output": "2"
},
{
"input": "118000",
"output": "2"
},
{
"input": "636915",
"output": "0"
},
{
"input": "811010",
"output": "1"
},
{
"input": "822569",
"output": "1"
},
{
"input": "122669",
"output": "2"
},
{
"input": "010339",
"output": "2"
},
{
"input": "213698",
"output": "2"
},
{
"input": "895130",
"output": "2"
},
{
"input": "000900",
"output": "1"
},
{
"input": "191000",
"output": "2"
},
{
"input": "001000",
"output": "1"
},
{
"input": "080189",
"output": "2"
},
{
"input": "990000",
"output": "2"
},
{
"input": "201984",
"output": "2"
},
{
"input": "002667",
"output": "2"
},
{
"input": "877542",
"output": "2"
},
{
"input": "301697",
"output": "2"
},
{
"input": "211597",
"output": "2"
},
{
"input": "420337",
"output": "1"
},
{
"input": "024768",
"output": "2"
},
{
"input": "878033",
"output": "2"
},
{
"input": "788024",
"output": "2"
},
{
"input": "023869",
"output": "2"
},
{
"input": "466341",
"output": "1"
},
{
"input": "696327",
"output": "1"
},
{
"input": "779114",
"output": "2"
},
{
"input": "858643",
"output": "1"
},
{
"input": "011488",
"output": "3"
},
{
"input": "003669",
"output": "2"
},
{
"input": "202877",
"output": "3"
},
{
"input": "738000",
"output": "2"
},
{
"input": "567235",
"output": "2"
},
{
"input": "887321",
"output": "3"
},
{
"input": "401779",
"output": "2"
},
{
"input": "989473",
"output": "2"
},
{
"input": "004977",
"output": "3"
},
{
"input": "023778",
"output": "2"
},
{
"input": "809116",
"output": "1"
},
{
"input": "042762",
"output": "1"
},
{
"input": "777445",
"output": "2"
},
{
"input": "769302",
"output": "2"
},
{
"input": "023977",
"output": "2"
},
{
"input": "990131",
"output": "2"
}
] | 1,504,004,645 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 8 | 62 | 0 | ticket = [int(x) for x in input()]
fst = ticket[:3]
sec = ticket[3:]
diff = abs(sum(fst) - sum(sec))
if diff == 0:
print(0)
elif diff < 0:
if 9 - min(fst) >= diff or max(sec) >= diff:
print(1)
elif 18 - (sum(fst) - max(fst)) >= diff or sum(sec) - min(sec) >= diff:
print(2)
else:
print(3)
else:
if 9 - min(sec) >= diff or max(fst) >= diff:
print(1)
elif 18 - (sum(sec) - max(sec)) >= diff or sum(fst) - min(fst) >= diff:
print(2)
else:
print(3)
| Title: Luba And The Ticket
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luba has a ticket consisting of 6 digits. In one move she can choose digit in any position and replace it with arbitrary digit. She wants to know the minimum number of digits she needs to replace in order to make the ticket lucky.
The ticket is considered lucky if the sum of first three digits equals to the sum of last three digits.
Input Specification:
You are given a string consisting of 6 characters (all characters are digits from 0 to 9) — this string denotes Luba's ticket. The ticket can start with the digit 0.
Output Specification:
Print one number — the minimum possible number of digits Luba needs to replace to make the ticket lucky.
Demo Input:
['000000\n', '123456\n', '111000\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first example the ticket is already lucky, so the answer is 0.
In the second example Luba can replace 4 and 5 with zeroes, and the ticket will become lucky. It's easy to see that at least two replacements are required.
In the third example Luba can replace any zero with 3. It's easy to see that at least one replacement is required. | ```python
ticket = [int(x) for x in input()]
fst = ticket[:3]
sec = ticket[3:]
diff = abs(sum(fst) - sum(sec))
if diff == 0:
print(0)
elif diff < 0:
if 9 - min(fst) >= diff or max(sec) >= diff:
print(1)
elif 18 - (sum(fst) - max(fst)) >= diff or sum(sec) - min(sec) >= diff:
print(2)
else:
print(3)
else:
if 9 - min(sec) >= diff or max(fst) >= diff:
print(1)
elif 18 - (sum(sec) - max(sec)) >= diff or sum(fst) - min(fst) >= diff:
print(2)
else:
print(3)
``` | 0 |
|
559 | B | Equivalent Strings | PROGRAMMING | 1,700 | [
"divide and conquer",
"hashing",
"sortings",
"strings"
] | null | null | Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn! | The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length. | Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise. | [
"aaba\nabaa\n",
"aabb\nabab\n"
] | [
"YES\n",
"NO\n"
] | In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa". | 1,000 | [
{
"input": "aaba\nabaa",
"output": "YES"
},
{
"input": "aabb\nabab",
"output": "NO"
},
{
"input": "a\na",
"output": "YES"
},
{
"input": "a\nb",
"output": "NO"
},
{
"input": "ab\nab",
"output": "YES"
},
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "ab\nbb",
"output": "NO"
},
{
"input": "zzaa\naazz",
"output": "YES"
},
{
"input": "azza\nzaaz",
"output": "YES"
},
{
"input": "abc\nabc",
"output": "YES"
},
{
"input": "abc\nacb",
"output": "NO"
},
{
"input": "azzz\nzzaz",
"output": "YES"
},
{
"input": "abcd\ndcab",
"output": "YES"
},
{
"input": "abcd\ncdab",
"output": "YES"
},
{
"input": "abcd\ndcba",
"output": "YES"
},
{
"input": "abcd\nacbd",
"output": "NO"
},
{
"input": "oloaxgddgujq\noloaxgujqddg",
"output": "YES"
},
{
"input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta",
"output": "YES"
},
{
"input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz",
"output": "YES"
},
{
"input": "snyaydaeobufdg\nsnyaydaeobufdg",
"output": "YES"
},
{
"input": "baaaaa\nabaaaa",
"output": "NO"
},
{
"input": "hhiisug\nmzdjwju",
"output": "NO"
},
{
"input": "bbbabbabaaab\naaaabbabbbbb",
"output": "NO"
},
{
"input": "bbaaab\naababb",
"output": "NO"
},
{
"input": "aabbaaaa\naaaaabab",
"output": "NO"
},
{
"input": "aab\naba",
"output": "NO"
},
{
"input": "abcddd\nbacddd",
"output": "NO"
},
{
"input": "qgiufelsfhanx\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "aabaababaaba\naababaaababa",
"output": "NO"
},
{
"input": "nocdqzdriyyil\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "zdmctxl\nkojqhgw",
"output": "NO"
},
{
"input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw",
"output": "NO"
},
{
"input": "abc\nbac",
"output": "NO"
},
{
"input": "ottceez\npcstdvz",
"output": "NO"
}
] | 1,624,189,115 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 18 | 93 | 3,174,400 | def equal_s(s):
l = len(s)
mid = len(s)//2
if l % 2 == 0:
l = s[:mid]
else:
l = s[:mid+1]
r = s[mid:]
return l, r
a = input().strip()
b = input().strip()
a1, a2 = equal_s(a)
b1, b2 = equal_s(b)
a1, a2, b1, b2 = sorted(a1), sorted(a2), sorted(b1), sorted(b2)
if (a1 == b1 and a2 == b2) or (a1 == b2 and a2 == b1):
print("YES")
else:
print("NO") | Title: Equivalent Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn!
Input Specification:
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
Output Specification:
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
Demo Input:
['aaba\nabaa\n', 'aabb\nabab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa". | ```python
def equal_s(s):
l = len(s)
mid = len(s)//2
if l % 2 == 0:
l = s[:mid]
else:
l = s[:mid+1]
r = s[mid:]
return l, r
a = input().strip()
b = input().strip()
a1, a2 = equal_s(a)
b1, b2 = equal_s(b)
a1, a2, b1, b2 = sorted(a1), sorted(a2), sorted(b1), sorted(b2)
if (a1 == b1 and a2 == b2) or (a1 == b2 and a2 == b1):
print("YES")
else:
print("NO")
``` | 0 |
|
535 | B | Tavas and SaDDas | PROGRAMMING | 1,100 | [
"bitmasks",
"brute force",
"combinatorics",
"implementation"
] | null | null | Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. | The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109). | Print the index of *n* among all lucky numbers. | [
"4\n",
"7\n",
"77\n"
] | [
"1\n",
"2\n",
"6\n"
] | none | 1,000 | [
{
"input": "4",
"output": "1"
},
{
"input": "7",
"output": "2"
},
{
"input": "77",
"output": "6"
},
{
"input": "4",
"output": "1"
},
{
"input": "474744",
"output": "83"
},
{
"input": "777774",
"output": "125"
},
{
"input": "447",
"output": "8"
},
{
"input": "774",
"output": "13"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447747",
"output": "140"
},
{
"input": "7747474",
"output": "233"
},
{
"input": "4444",
"output": "15"
},
{
"input": "4447",
"output": "16"
},
{
"input": "7",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447744",
"output": "139"
},
{
"input": "77474",
"output": "57"
},
{
"input": "7747",
"output": "28"
},
{
"input": "444",
"output": "7"
},
{
"input": "7",
"output": "2"
},
{
"input": "7774477",
"output": "242"
},
{
"input": "4477774",
"output": "157"
},
{
"input": "7444",
"output": "23"
},
{
"input": "7474747",
"output": "212"
},
{
"input": "77",
"output": "6"
},
{
"input": "774477",
"output": "114"
},
{
"input": "7",
"output": "2"
},
{
"input": "47",
"output": "4"
},
{
"input": "747777",
"output": "110"
},
{
"input": "444444444",
"output": "511"
},
{
"input": "777777777",
"output": "1022"
},
{
"input": "477477447",
"output": "728"
},
{
"input": "777744747",
"output": "996"
}
] | 1,585,882,049 | 2,147,483,647 | Python 3 | OK | TESTS | 33 | 109 | 0 | s = input().replace('7', '1').replace('4', '0')
n = 0
for i in range(1, len(s)):
n += 2**i
print(n + int(s, 2) + 1) | Title: Tavas and SaDDas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
Input Specification:
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
Print the index of *n* among all lucky numbers.
Demo Input:
['4\n', '7\n', '77\n']
Demo Output:
['1\n', '2\n', '6\n']
Note:
none | ```python
s = input().replace('7', '1').replace('4', '0')
n = 0
for i in range(1, len(s)):
n += 2**i
print(n + int(s, 2) + 1)
``` | 3 |
|
5 | D | Follow Traffic Rules | PROGRAMMING | 2,100 | [
"implementation",
"math"
] | D. Follow Traffic Rules | 1 | 64 | Everybody knows that the capital of Berland is connected to Bercouver (the Olympic capital) by a direct road. To improve the road's traffic capacity, there was placed just one traffic sign, limiting the maximum speed. Traffic signs in Berland are a bit peculiar, because they limit the speed only at that point on the road where they are placed. Right after passing the sign it is allowed to drive at any speed.
It is known that the car of an average Berland citizen has the acceleration (deceleration) speed of *a* km/h2, and has maximum speed of *v* km/h. The road has the length of *l* km, and the speed sign, limiting the speed to *w* km/h, is placed *d* km (1<=≤<=*d*<=<<=*l*) away from the capital of Berland. The car has a zero speed at the beginning of the journey. Find the minimum time that an average Berland citizen will need to get from the capital to Bercouver, if he drives at the optimal speed.
The car can enter Bercouver at any speed. | The first line of the input file contains two integer numbers *a* and *v* (1<=≤<=*a*,<=*v*<=≤<=10000). The second line contains three integer numbers *l*, *d* and *w* (2<=≤<=*l*<=≤<=10000; 1<=≤<=*d*<=<<=*l*; 1<=≤<=*w*<=≤<=10000). | Print the answer with at least five digits after the decimal point. | [
"1 1\n2 1 3\n",
"5 70\n200 170 40\n"
] | [
"2.500000000000\n",
"8.965874696353\n"
] | none | 0 | [
{
"input": "1 1\n2 1 3",
"output": "2.500000000000"
},
{
"input": "5 70\n200 170 40",
"output": "8.965874696353"
},
{
"input": "6 80\n100 50 10",
"output": "7.312347829731"
},
{
"input": "7 80\n100 50 50",
"output": "5.345224838248"
},
{
"input": "8 80\n100 50 199",
"output": "5.000000000000"
},
{
"input": "200 1000\n3 2 1",
"output": "0.290249882934"
},
{
"input": "200 1000\n3 2 10000",
"output": "0.173205080757"
},
{
"input": "200 1000\n1000 500 1023",
"output": "3.162277660168"
},
{
"input": "200 1000\n1000 999 10",
"output": "4.482261988326"
},
{
"input": "20 40\n10000 1 30",
"output": "251.000000000000"
},
{
"input": "20 40\n10000 799 30",
"output": "251.125000000000"
},
{
"input": "20 40\n9958 9799 30",
"output": "250.075000000000"
},
{
"input": "9998 9999\n3 2 1",
"output": "0.042231317453"
},
{
"input": "9998 9999\n3 2 6580",
"output": "0.024497347285"
},
{
"input": "9998 9999\n800 40 10000",
"output": "0.400040006001"
},
{
"input": "9998 9999\n800 516 124",
"output": "0.668565367679"
},
{
"input": "4 120\n5112 3000 130",
"output": "57.600000000000"
},
{
"input": "4 120\n5112 3000 113",
"output": "57.702083333333"
},
{
"input": "9000 1\n10000 9999 1",
"output": "10000.000055555556"
},
{
"input": "2 10000\n270 64 16",
"output": "16.431676725155"
},
{
"input": "2 20\n270 64 16",
"output": "18.500000000000"
},
{
"input": "2 16\n270 64 16",
"output": "20.875000000000"
},
{
"input": "2000 10000\n8000 4000 4000",
"output": "2.828427124746"
},
{
"input": "2000 4000\n8000 4000 4000",
"output": "3.000000000000"
},
{
"input": "2000 10\n8000 4000 4000",
"output": "800.002500000000"
},
{
"input": "7143 4847\n4193 2677 1991",
"output": "1.438097228927"
},
{
"input": "5744 5873\n3706 1656 8898",
"output": "1.142252435725"
},
{
"input": "7992 3250\n9987 6772 5806",
"output": "3.276251405251"
},
{
"input": "240 4275\n6270 1836 6361",
"output": "7.228416147400"
},
{
"input": "5369 9035\n1418 879 3344",
"output": "0.726785762909"
},
{
"input": "7062 9339\n2920 1289 8668",
"output": "0.909374070882"
},
{
"input": "8755 9643\n1193 27 3992",
"output": "0.522044043034"
},
{
"input": "448 3595\n2696 1020 5667",
"output": "3.469252698452"
},
{
"input": "2141 3899\n968 262 991",
"output": "0.967126013479"
},
{
"input": "3834 4202\n2471 607 6315",
"output": "1.136044961574"
},
{
"input": "5527 8154\n3974 3550 1639",
"output": "1.555031897139"
},
{
"input": "7220 8458\n2246 1326 6963",
"output": "0.788771617656"
},
{
"input": "8914 8762\n3749 1899 2287",
"output": "1.172208101814"
},
{
"input": "607 2714\n2021 1483 3963",
"output": "2.580499677039"
},
{
"input": "9788 8432\n2795 2025 3436",
"output": "0.863942827831"
},
{
"input": "26 12\n17 13 29",
"output": "1.647435897436"
},
{
"input": "12 42\n6 5 19",
"output": "1.000000000000"
},
{
"input": "50 22\n42 1 12",
"output": "2.129090909091"
},
{
"input": "38 3\n47 16 4",
"output": "15.706140350877"
},
{
"input": "24 33\n35 2 45",
"output": "1.748106060606"
},
{
"input": "11 13\n24 15 37",
"output": "2.437062937063"
},
{
"input": "49 43\n12 6 30",
"output": "0.699854212224"
},
{
"input": "35 23\n17 12 20",
"output": "1.078881987578"
},
{
"input": "23 4\n5 2 13",
"output": "1.336956521739"
},
{
"input": "8 28\n22 4 29",
"output": "2.345207879912"
},
{
"input": "38 35\n16 12 38",
"output": "0.917662935482"
},
{
"input": "21 41\n26 18 47",
"output": "1.573591584939"
},
{
"input": "2 50\n21 1 6",
"output": "4.582575694956"
},
{
"input": "32 7\n15 6 17",
"output": "2.252232142857"
},
{
"input": "15 13\n10 3 26",
"output": "1.202564102564"
},
{
"input": "46 20\n4 2 35",
"output": "0.417028828114"
},
{
"input": "26 28\n46 9 44",
"output": "2.181318681319"
},
{
"input": "9 35\n41 22 3",
"output": "4.577276992968"
},
{
"input": "39 42\n35 19 12",
"output": "1.803482716151"
},
{
"input": "28 24\n31 13 21",
"output": "1.733630952381"
}
] | 1,677,552,009 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | import math
# Ввод данных
a, v = map(int, input().split())
l, d, w = map(int, input().split())
# Расстояние, на котором нужно двигаться с ограничением скорости
x = d
# Расстояние, на котором можно двигаться с максимальной скоростью
y = l - d
# Время, потраченное на разгон автомобиля до максимальной скорости
t1 = v / a
# Расстояние, пройденное за время t1
s1 = 0.5 * a * t1 ** 2
# Время, потраченное на торможение автомобиля с максимальной скорости до скорости w
t2 = (v - w) / a
# Расстояние, пройденное за время t2
s2 = 0.5 * a * t2 ** 2
# Время, потраченное на движение со скоростью w на расстоянии x
t3 = (x - s1 - s2) / w
# Расстояние, пройденное за время t3
s3 = w * t3
# Время, потраченное на движение со скоростью v на расстоянии y
t4 = y / v
# Общее время
total_time = t1 + t2 + t3 + t4
# Вывод результата
print("{:.6f}".format(total_time))
| Title: Follow Traffic Rules
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Everybody knows that the capital of Berland is connected to Bercouver (the Olympic capital) by a direct road. To improve the road's traffic capacity, there was placed just one traffic sign, limiting the maximum speed. Traffic signs in Berland are a bit peculiar, because they limit the speed only at that point on the road where they are placed. Right after passing the sign it is allowed to drive at any speed.
It is known that the car of an average Berland citizen has the acceleration (deceleration) speed of *a* km/h2, and has maximum speed of *v* km/h. The road has the length of *l* km, and the speed sign, limiting the speed to *w* km/h, is placed *d* km (1<=≤<=*d*<=<<=*l*) away from the capital of Berland. The car has a zero speed at the beginning of the journey. Find the minimum time that an average Berland citizen will need to get from the capital to Bercouver, if he drives at the optimal speed.
The car can enter Bercouver at any speed.
Input Specification:
The first line of the input file contains two integer numbers *a* and *v* (1<=≤<=*a*,<=*v*<=≤<=10000). The second line contains three integer numbers *l*, *d* and *w* (2<=≤<=*l*<=≤<=10000; 1<=≤<=*d*<=<<=*l*; 1<=≤<=*w*<=≤<=10000).
Output Specification:
Print the answer with at least five digits after the decimal point.
Demo Input:
['1 1\n2 1 3\n', '5 70\n200 170 40\n']
Demo Output:
['2.500000000000\n', '8.965874696353\n']
Note:
none | ```python
import math
# Ввод данных
a, v = map(int, input().split())
l, d, w = map(int, input().split())
# Расстояние, на котором нужно двигаться с ограничением скорости
x = d
# Расстояние, на котором можно двигаться с максимальной скоростью
y = l - d
# Время, потраченное на разгон автомобиля до максимальной скорости
t1 = v / a
# Расстояние, пройденное за время t1
s1 = 0.5 * a * t1 ** 2
# Время, потраченное на торможение автомобиля с максимальной скорости до скорости w
t2 = (v - w) / a
# Расстояние, пройденное за время t2
s2 = 0.5 * a * t2 ** 2
# Время, потраченное на движение со скоростью w на расстоянии x
t3 = (x - s1 - s2) / w
# Расстояние, пройденное за время t3
s3 = w * t3
# Время, потраченное на движение со скоростью v на расстоянии y
t4 = y / v
# Общее время
total_time = t1 + t2 + t3 + t4
# Вывод результата
print("{:.6f}".format(total_time))
``` | 0 |
887 | A | Div. 64 | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills.
Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system. | In the only line given a non-empty binary string *s* with length up to 100. | Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise. | [
"100010001\n",
"100\n"
] | [
"yes",
"no"
] | In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system.
You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system) | 500 | [
{
"input": "100010001",
"output": "yes"
},
{
"input": "100",
"output": "no"
},
{
"input": "0000001000000",
"output": "yes"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "no"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111111111",
"output": "no"
},
{
"input": "0111111101111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "no"
},
{
"input": "1111011111111111111111111111110111110111111111111111111111011111111111111110111111111111111111111111",
"output": "no"
},
{
"input": "1111111111101111111111111111111111111011111111111111111111111101111011111101111111111101111111111111",
"output": "yes"
},
{
"input": "0110111111111111111111011111111110110111110111111111111111111111111111111111111110111111111111111111",
"output": "yes"
},
{
"input": "1100110001111011001101101000001110111110011110111110010100011000100101000010010111100000010001001101",
"output": "yes"
},
{
"input": "000000",
"output": "no"
},
{
"input": "0001000",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "1000000",
"output": "yes"
},
{
"input": "0",
"output": "no"
},
{
"input": "1",
"output": "no"
},
{
"input": "10000000000",
"output": "yes"
},
{
"input": "0000000000",
"output": "no"
},
{
"input": "0010000",
"output": "no"
},
{
"input": "000000011",
"output": "no"
},
{
"input": "000000000",
"output": "no"
},
{
"input": "00000000",
"output": "no"
},
{
"input": "000000000011",
"output": "no"
},
{
"input": "0000000",
"output": "no"
},
{
"input": "00000000011",
"output": "no"
},
{
"input": "000000001",
"output": "no"
},
{
"input": "000000000000000000000000000",
"output": "no"
},
{
"input": "0000001",
"output": "no"
},
{
"input": "00000001",
"output": "no"
},
{
"input": "00000000100",
"output": "no"
},
{
"input": "00000000000000000000",
"output": "no"
},
{
"input": "0000000000000000000",
"output": "no"
},
{
"input": "00001000",
"output": "no"
},
{
"input": "0000000000010",
"output": "no"
},
{
"input": "000000000010",
"output": "no"
},
{
"input": "000000000000010",
"output": "no"
},
{
"input": "0100000",
"output": "no"
},
{
"input": "00010000",
"output": "no"
},
{
"input": "00000000000000000",
"output": "no"
},
{
"input": "00000000000",
"output": "no"
},
{
"input": "000001000",
"output": "no"
},
{
"input": "000000000000",
"output": "no"
},
{
"input": "100000000000000",
"output": "yes"
},
{
"input": "000010000",
"output": "no"
},
{
"input": "00000100",
"output": "no"
},
{
"input": "0001100000",
"output": "no"
},
{
"input": "000000000000000000000000001",
"output": "no"
},
{
"input": "000000100",
"output": "no"
},
{
"input": "0000000000001111111111",
"output": "no"
},
{
"input": "00000010",
"output": "no"
},
{
"input": "0001110000",
"output": "no"
},
{
"input": "0000000000000000000000",
"output": "no"
},
{
"input": "000000010010",
"output": "no"
},
{
"input": "0000100",
"output": "no"
},
{
"input": "0000000001",
"output": "no"
},
{
"input": "000000111",
"output": "no"
},
{
"input": "0000000000000",
"output": "no"
},
{
"input": "000000000000000000",
"output": "no"
},
{
"input": "0000000000000000000000000",
"output": "no"
},
{
"input": "000000000000000",
"output": "no"
},
{
"input": "0010000000000100",
"output": "yes"
},
{
"input": "0000001000",
"output": "no"
},
{
"input": "00000000000000000001",
"output": "no"
},
{
"input": "100000000",
"output": "yes"
},
{
"input": "000000000001",
"output": "no"
},
{
"input": "0000011001",
"output": "no"
},
{
"input": "000",
"output": "no"
},
{
"input": "000000000000000000000",
"output": "no"
},
{
"input": "0000000000011",
"output": "no"
},
{
"input": "0000000000000000",
"output": "no"
},
{
"input": "00000000000000001",
"output": "no"
},
{
"input": "00000000000000",
"output": "no"
},
{
"input": "0000000000000000010",
"output": "no"
},
{
"input": "00000000000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "000011000",
"output": "no"
},
{
"input": "00000011",
"output": "no"
},
{
"input": "0000000000001100",
"output": "no"
},
{
"input": "00000",
"output": "no"
},
{
"input": "000000000000000000000000000111111111111111",
"output": "no"
},
{
"input": "000000010",
"output": "no"
},
{
"input": "00000000111",
"output": "no"
},
{
"input": "000000000000001",
"output": "no"
},
{
"input": "0000000000000011111111111111111",
"output": "no"
},
{
"input": "0000000010",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "00000000010",
"output": "no"
},
{
"input": "101000000000",
"output": "yes"
},
{
"input": "00100000",
"output": "no"
},
{
"input": "00000000000001",
"output": "no"
},
{
"input": "0000000000100",
"output": "no"
},
{
"input": "0000",
"output": "no"
},
{
"input": "00000000000111",
"output": "no"
},
{
"input": "0000000000000011",
"output": "no"
},
{
"input": "0000000000000000000000000000000000000000",
"output": "no"
},
{
"input": "0000000000000010",
"output": "no"
},
{
"input": "0010101010",
"output": "no"
},
{
"input": "0000000000000001",
"output": "no"
},
{
"input": "1010101",
"output": "no"
}
] | 1,509,793,830 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 10 | 61 | 0 | st = input()
ans = "no"
k_0 = 0
if int(st) < 1000000:
ans = "no"
for e in st:
if e == "0":
k_0+=1
if k_0 == 6:
ans = "yes"
break
print(ans) | Title: Div. 64
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Top-model Izabella participates in the competition. She wants to impress judges and show her mathematical skills.
Her problem is following: for given string, consisting of only 0 and 1, tell if it's possible to remove some digits in such a way, that remaining number is a representation of some positive integer, divisible by 64, in the binary numerical system.
Input Specification:
In the only line given a non-empty binary string *s* with length up to 100.
Output Specification:
Print «yes» (without quotes) if it's possible to remove digits required way and «no» otherwise.
Demo Input:
['100010001\n', '100\n']
Demo Output:
['yes', 'no']
Note:
In the first test case, you can get string 1 000 000 after removing two ones which is a representation of number 64 in the binary numerical system.
You can read more about binary numeral system representation here: [https://en.wikipedia.org/wiki/Binary_system](https://en.wikipedia.org/wiki/Binary_system) | ```python
st = input()
ans = "no"
k_0 = 0
if int(st) < 1000000:
ans = "no"
for e in st:
if e == "0":
k_0+=1
if k_0 == 6:
ans = "yes"
break
print(ans)
``` | 0 |
|
472 | A | Design Tutorial: Learn from Math | PROGRAMMING | 800 | [
"math",
"number theory"
] | null | null | One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers. | The only line contains an integer *n* (12<=≤<=*n*<=≤<=106). | Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them. | [
"12\n",
"15\n",
"23\n",
"1000000\n"
] | [
"4 8\n",
"6 9\n",
"8 15\n",
"500000 500000\n"
] | In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number. | 500 | [
{
"input": "12",
"output": "4 8"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "23",
"output": "8 15"
},
{
"input": "1000000",
"output": "500000 500000"
},
{
"input": "63874",
"output": "4 63870"
},
{
"input": "14568",
"output": "4 14564"
},
{
"input": "192",
"output": "4 188"
},
{
"input": "86",
"output": "4 82"
},
{
"input": "46220",
"output": "4 46216"
},
{
"input": "57114",
"output": "4 57110"
},
{
"input": "869",
"output": "4 865"
},
{
"input": "738457",
"output": "4 738453"
},
{
"input": "58113",
"output": "6 58107"
},
{
"input": "4864",
"output": "4 4860"
},
{
"input": "15",
"output": "6 9"
},
{
"input": "74752",
"output": "4 74748"
},
{
"input": "6073",
"output": "4 6069"
},
{
"input": "1289",
"output": "4 1285"
},
{
"input": "20",
"output": "4 16"
},
{
"input": "58134",
"output": "4 58130"
},
{
"input": "57756",
"output": "4 57752"
},
{
"input": "765",
"output": "6 759"
},
{
"input": "59",
"output": "4 55"
},
{
"input": "991666",
"output": "4 991662"
},
{
"input": "70761",
"output": "4 70757"
},
{
"input": "13",
"output": "4 9"
},
{
"input": "999999",
"output": "4 999995"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "21",
"output": "6 15"
},
{
"input": "19",
"output": "4 15"
},
{
"input": "100007",
"output": "6 100001"
},
{
"input": "999987",
"output": "6 999981"
},
{
"input": "22",
"output": "4 18"
}
] | 1,680,014,440 | 2,147,483,647 | Python 3 | OK | TESTS | 33 | 46 | 0 | #문제가 제대로 이해는 안됐지만.. 합성수로 나타내라는 조건하에
#8을 기준으로 잡는 풀이방법
x=int(input())
a=8+x%2
b=x-a
print(a,b)
| Title: Design Tutorial: Learn from Math
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One way to create a task is to learn from math. You can generate some random math statement or modify some theorems to get something new and build a new task from that.
For example, there is a statement called the "Goldbach's conjecture". It says: "each even number no less than four can be expressed as the sum of two primes". Let's modify it. How about a statement like that: "each integer no less than 12 can be expressed as the sum of two composite numbers." Not like the Goldbach's conjecture, I can prove this theorem.
You are given an integer *n* no less than 12, express it as a sum of two composite numbers.
Input Specification:
The only line contains an integer *n* (12<=≤<=*n*<=≤<=106).
Output Specification:
Output two composite integers *x* and *y* (1<=<<=*x*,<=*y*<=<<=*n*) such that *x*<=+<=*y*<==<=*n*. If there are multiple solutions, you can output any of them.
Demo Input:
['12\n', '15\n', '23\n', '1000000\n']
Demo Output:
['4 8\n', '6 9\n', '8 15\n', '500000 500000\n']
Note:
In the first example, 12 = 4 + 8 and both 4, 8 are composite numbers. You can output "6 6" or "8 4" as well.
In the second example, 15 = 6 + 9. Note that you can't output "1 14" because 1 is not a composite number. | ```python
#문제가 제대로 이해는 안됐지만.. 합성수로 나타내라는 조건하에
#8을 기준으로 잡는 풀이방법
x=int(input())
a=8+x%2
b=x-a
print(a,b)
``` | 3 |
|
667 | A | Pouring Rain | PROGRAMMING | 1,100 | [
"geometry",
"math"
] | null | null | A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter. | The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup. | If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104. | [
"1 2 3 100\n",
"1 1 1 1\n"
] | [
"NO\n",
"YES\n3.659792366325\n"
] | In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds. | 500 | [
{
"input": "1 2 3 100",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "YES\n3.659792366325"
},
{
"input": "48 7946 7992 72",
"output": "NO"
},
{
"input": "72 6791 8546 46",
"output": "NO"
},
{
"input": "100 5635 9099 23",
"output": "NO"
},
{
"input": "20 287 3845 5",
"output": "YES\n39.646277165210"
},
{
"input": "48 6428 9807 83",
"output": "NO"
},
{
"input": "72 5272 4552 64",
"output": "NO"
},
{
"input": "100 4117 5106 34",
"output": "NO"
},
{
"input": "20 2961 9852 15",
"output": "YES\n180.991437129723"
},
{
"input": "48 1805 3109 93",
"output": "NO"
},
{
"input": "72 8534 7042 65",
"output": "NO"
},
{
"input": "1 47 80 68",
"output": "YES\n1.388102806810"
},
{
"input": "4 495 8813 1",
"output": "YES\n0.706823517575"
},
{
"input": "5 2797 5925 9",
"output": "YES\n9.553973511669"
},
{
"input": "1 8324 4362 23",
"output": "YES\n1.505007106354"
},
{
"input": "6 1976 8455 3",
"output": "YES\n6.674898722265"
},
{
"input": "7 2644 8080 5",
"output": "YES\n12.900417790197"
},
{
"input": "3 4183 5491 98",
"output": "YES\n6.162185601824"
},
{
"input": "2 8591 320 101",
"output": "YES\n9999.259991757254"
},
{
"input": "10000 10000 10000 10000",
"output": "NO"
},
{
"input": "2 5000 12 3",
"output": "YES\n6099.653943875812"
},
{
"input": "10 1000 100 1",
"output": "YES\n3659.792366325487"
}
] | 1,671,287,217 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 23 | 46 | 0 | import math
d, h, v, e = map(int, input().split())
drink_s = (4 * v) / (math.pi * (d**2))
if drink_s > e:
print("YES")
result = (h / (drink_s - e))
print(round(result, 12))
else:
print("NO") | Title: Pouring Rain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter.
Input Specification:
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup.
Output Specification:
If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
Demo Input:
['1 2 3 100\n', '1 1 1 1\n']
Demo Output:
['NO\n', 'YES\n3.659792366325\n']
Note:
In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds. | ```python
import math
d, h, v, e = map(int, input().split())
drink_s = (4 * v) / (math.pi * (d**2))
if drink_s > e:
print("YES")
result = (h / (drink_s - e))
print(round(result, 12))
else:
print("NO")
``` | 3 |
|
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,669,116,016 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 92 | 0 | k=input()
cl=0
cu=0
for i in k:
if i.islower():
cl=cl+1
if i.isupper():
cu=cu+1
if cl>cu:
print(k.lower())
if cl<cu:
print(k.upper())
if cl==cu:
print(k.lower())
| Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
k=input()
cl=0
cu=0
for i in k:
if i.islower():
cl=cl+1
if i.isupper():
cu=cu+1
if cl>cu:
print(k.lower())
if cl<cu:
print(k.upper())
if cl==cu:
print(k.lower())
``` | 3.977 |
731 | A | Night at the Museum | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it. | The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters. | Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input. | [
"zeus\n",
"map\n",
"ares\n"
] | [
"18\n",
"35\n",
"34\n"
] | To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | 500 | [
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,683,672,028 | 2,147,483,647 | Python 3 | OK | TESTS | 44 | 46 | 0 | """
contest= https://codeforces.com/contest/731/problem/A
date= Thursday, May 11, 2023
Verdict =
"""
w='a'+input()
x=0
for i in range(len(w)-1):
tem_1= abs((ord(w[i])%ord('a') ) -(ord(w[i+1])%ord('a') ))
tem_2= abs(tem_1-26)
x+= min (tem_1 , tem_2 )
print(x) | Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | ```python
"""
contest= https://codeforces.com/contest/731/problem/A
date= Thursday, May 11, 2023
Verdict =
"""
w='a'+input()
x=0
for i in range(len(w)-1):
tem_1= abs((ord(w[i])%ord('a') ) -(ord(w[i+1])%ord('a') ))
tem_2= abs(tem_1-26)
x+= min (tem_1 , tem_2 )
print(x)
``` | 3 |
|
463 | B | Caisa and Pylons | PROGRAMMING | 1,100 | [
"brute force",
"implementation",
"math"
] | null | null | Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game? | The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons. | Print a single number representing the minimum number of dollars paid by Caisa. | [
"5\n3 4 3 2 4\n",
"3\n4 4 4\n"
] | [
"4\n",
"4\n"
] | In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon. | 1,000 | [
{
"input": "5\n3 4 3 2 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730",
"output": "4000"
},
{
"input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621",
"output": "3993"
},
{
"input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "30"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n69",
"output": "69"
}
] | 1,620,819,967 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 46 | 6,860,800 | n = int(input())
h = input().split(" ")
current_energy = 0
current_pylon = 0
money_paid = 0
for i in range(0,n-1):
diff = int(h[current_pylon]) - int(h[current_pylon + 1])
if diff >= 0:
current_energy += diff
current_pylon = current_pylon + 1
else: #diff < 0 : check if we're dead. pay money to prevent it
if(current_energy + diff >= 0):
#if we're still alive
current_energy += diff
current_pylon = current_pylon + 1
else: #pay money to prevent health from going to zero
current_energy = 0
money_paid -= diff
current_pylon = current_pylon + 1
print(money_paid)
| Title: Caisa and Pylons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
Output Specification:
Print a single number representing the minimum number of dollars paid by Caisa.
Demo Input:
['5\n3 4 3 2 4\n', '3\n4 4 4\n']
Demo Output:
['4\n', '4\n']
Note:
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon. | ```python
n = int(input())
h = input().split(" ")
current_energy = 0
current_pylon = 0
money_paid = 0
for i in range(0,n-1):
diff = int(h[current_pylon]) - int(h[current_pylon + 1])
if diff >= 0:
current_energy += diff
current_pylon = current_pylon + 1
else: #diff < 0 : check if we're dead. pay money to prevent it
if(current_energy + diff >= 0):
#if we're still alive
current_energy += diff
current_pylon = current_pylon + 1
else: #pay money to prevent health from going to zero
current_energy = 0
money_paid -= diff
current_pylon = current_pylon + 1
print(money_paid)
``` | 0 |
|
284 | A | Cows and Primitive Roots | PROGRAMMING | 1,400 | [
"implementation",
"math",
"number theory"
] | null | null | The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is.
Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots . | The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime. | Output on a single line the number of primitive roots . | [
"3\n",
"5\n"
] | [
"1\n",
"2\n"
] | The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3. | 500 | [
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "2"
},
{
"input": "7",
"output": "2"
},
{
"input": "11",
"output": "4"
},
{
"input": "17",
"output": "8"
},
{
"input": "19",
"output": "6"
},
{
"input": "1583",
"output": "672"
},
{
"input": "997",
"output": "328"
},
{
"input": "2",
"output": "1"
},
{
"input": "1987",
"output": "660"
},
{
"input": "1993",
"output": "656"
},
{
"input": "1997",
"output": "996"
},
{
"input": "1999",
"output": "648"
},
{
"input": "1297",
"output": "432"
},
{
"input": "163",
"output": "54"
},
{
"input": "1259",
"output": "576"
},
{
"input": "821",
"output": "320"
},
{
"input": "29",
"output": "12"
},
{
"input": "43",
"output": "12"
},
{
"input": "1949",
"output": "972"
},
{
"input": "1879",
"output": "624"
},
{
"input": "1759",
"output": "584"
},
{
"input": "1597",
"output": "432"
},
{
"input": "1619",
"output": "808"
},
{
"input": "1277",
"output": "560"
},
{
"input": "1097",
"output": "544"
},
{
"input": "953",
"output": "384"
},
{
"input": "751",
"output": "200"
},
{
"input": "607",
"output": "200"
},
{
"input": "509",
"output": "252"
},
{
"input": "431",
"output": "168"
},
{
"input": "317",
"output": "156"
},
{
"input": "211",
"output": "48"
},
{
"input": "127",
"output": "36"
},
{
"input": "101",
"output": "40"
},
{
"input": "31",
"output": "8"
}
] | 1,521,630,572 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 124 | 7,065,600 | n=int(input())
isPrime=[True for i in range(n+1)]
for i in range(2, n+1):
if isPrime[i]:
for j in range(2*i, n+1, i):
isPrime[j]=False
x=2
y=0
while x<n:
if isPrime[x]:
y+=1
x+=1
print(y)
| Title: Cows and Primitive Roots
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is.
Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots .
Input Specification:
The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime.
Output Specification:
Output on a single line the number of primitive roots .
Demo Input:
['3\n', '5\n']
Demo Output:
['1\n', '2\n']
Note:
The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3. | ```python
n=int(input())
isPrime=[True for i in range(n+1)]
for i in range(2, n+1):
if isPrime[i]:
for j in range(2*i, n+1, i):
isPrime[j]=False
x=2
y=0
while x<n:
if isPrime[x]:
y+=1
x+=1
print(y)
``` | 0 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
] | A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] | [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] | none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,529,478,596 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 77 | 0 | a,b=map(int,input().split())
x = a^b
n = ""
while x > 0:
y = str(x % 2)
n = y + n
x = int(x / 2)
print (n) | Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
a,b=map(int,input().split())
x = a^b
n = ""
while x > 0:
y = str(x % 2)
n = y + n
x = int(x / 2)
print (n)
``` | -1 |
0 | none | none | none | 0 | [
"none"
] | null | null | Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once. | The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters. | If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes. | [
"helloworld\nehoolwlroz\n",
"hastalavistababy\nhastalavistababy\n",
"merrychristmas\nchristmasmerry\n"
] | [
"3\nh e\nl o\nd z\n",
"0\n",
"-1\n"
] | none | 0 | [
{
"input": "helloworld\nehoolwlroz",
"output": "3\nh e\nl o\nd z"
},
{
"input": "hastalavistababy\nhastalavistababy",
"output": "0"
},
{
"input": "merrychristmas\nchristmasmerry",
"output": "-1"
},
{
"input": "kusyvdgccw\nkusyvdgccw",
"output": "0"
},
{
"input": "bbbbbabbab\naaaaabaaba",
"output": "1\nb a"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx",
"output": "-1"
},
{
"input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc",
"output": "1\nd b"
},
{
"input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd",
"output": "0"
},
{
"input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak",
"output": "5\ng f\nn i\nd h\ne o\nb k"
},
{
"input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc",
"output": "0"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "zz\nzy",
"output": "-1"
},
{
"input": "as\ndf",
"output": "2\na d\ns f"
},
{
"input": "abc\nbca",
"output": "-1"
},
{
"input": "rtfg\nrftg",
"output": "1\nt f"
},
{
"input": "y\ny",
"output": "0"
},
{
"input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz",
"output": "-1"
},
{
"input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm",
"output": "-1"
},
{
"input": "aaaaaa\nabcdef",
"output": "-1"
},
{
"input": "qwerty\nffffff",
"output": "-1"
},
{
"input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh",
"output": "0"
},
{
"input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe",
"output": "-1"
},
{
"input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba",
"output": "0"
},
{
"input": "dbadbddddb\nacbacaaaac",
"output": "-1"
},
{
"input": "dacbdbbbdd\nadbdadddaa",
"output": "-1"
},
{
"input": "bbbbcbcbbc\ndaddbabddb",
"output": "-1"
},
{
"input": "dddddbcdbd\nbcbbbdacdb",
"output": "-1"
},
{
"input": "cbadcbcdaa\nabbbababbb",
"output": "-1"
},
{
"input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk",
"output": "-1"
},
{
"input": "acbbccabaa\nabbbbbabaa",
"output": "-1"
},
{
"input": "ccccaccccc\naaaabaaaac",
"output": "-1"
},
{
"input": "acbacacbbb\nacbacacbbb",
"output": "0"
},
{
"input": "abbababbcc\nccccccccbb",
"output": "-1"
},
{
"input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh",
"output": "-1"
},
{
"input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage",
"output": "-1"
},
{
"input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai",
"output": "-1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "z\na",
"output": "1\nz a"
},
{
"input": "aa\nzz",
"output": "1\na z"
},
{
"input": "az\nza",
"output": "1\na z"
},
{
"input": "aa\nza",
"output": "-1"
},
{
"input": "za\nzz",
"output": "-1"
},
{
"input": "aa\nab",
"output": "-1"
},
{
"input": "hehe\nheeh",
"output": "-1"
},
{
"input": "bd\ncc",
"output": "-1"
},
{
"input": "he\nhh",
"output": "-1"
},
{
"input": "hee\nheh",
"output": "-1"
},
{
"input": "aa\nac",
"output": "-1"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "hello\nehlol",
"output": "-1"
},
{
"input": "ac\naa",
"output": "-1"
},
{
"input": "aaabbb\nbbbaab",
"output": "-1"
},
{
"input": "aa\nfa",
"output": "-1"
},
{
"input": "hg\nee",
"output": "-1"
},
{
"input": "helloworld\nehoolwlrow",
"output": "-1"
},
{
"input": "abb\nbab",
"output": "-1"
},
{
"input": "aaa\naae",
"output": "-1"
},
{
"input": "aba\nbaa",
"output": "-1"
},
{
"input": "aa\nba",
"output": "-1"
},
{
"input": "da\naa",
"output": "-1"
},
{
"input": "aaa\naab",
"output": "-1"
},
{
"input": "xy\nzz",
"output": "-1"
}
] | 1,482,697,114 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | from sys import *
s=input()
sf=input()
pair=dict()
abet="abcdefghijklmnopqrstuvwxyz"
for i range(len(s)):
if not pair.get(s[i]) and not pair.get(sf[i]):
pair[s[i]]=sf[i]
pair[sf[i]]=s[i]
else if pair[s[i]]!=sf[i] or pair[sf[i]]!=s[i]:
print(-1)
exit(0)
ans=[]
for i in abet:
if pair.get(i)<i:
ans+=(i,pair(i))
print(len(ans))
for i in ans:
print(i[0],i[1]) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
Input Specification:
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
Output Specification:
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
Demo Input:
['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n']
Demo Output:
['3\nh e\nl o\nd z\n', '0\n', '-1\n']
Note:
none | ```python
from sys import *
s=input()
sf=input()
pair=dict()
abet="abcdefghijklmnopqrstuvwxyz"
for i range(len(s)):
if not pair.get(s[i]) and not pair.get(sf[i]):
pair[s[i]]=sf[i]
pair[sf[i]]=s[i]
else if pair[s[i]]!=sf[i] or pair[sf[i]]!=s[i]:
print(-1)
exit(0)
ans=[]
for i in abet:
if pair.get(i)<i:
ans+=(i,pair(i))
print(len(ans))
for i in ans:
print(i[0],i[1])
``` | -1 |
|
922 | A | Cloning Toys | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | Imp likes his plush toy a lot.
Recently, he found a machine that can clone plush toys. Imp knows that if he applies the machine to an original toy, he additionally gets one more original toy and one copy, and if he applies the machine to a copied toy, he gets two additional copies.
Initially, Imp has only one original toy. He wants to know if it is possible to use machine to get exactly *x* copied toys and *y* original toys? He can't throw toys away, and he can't apply the machine to a copy if he doesn't currently have any copies. | The only line contains two integers *x* and *y* (0<=≤<=*x*,<=*y*<=≤<=109) — the number of copies and the number of original toys Imp wants to get (including the initial one). | Print "Yes", if the desired configuration is possible, and "No" otherwise.
You can print each letter in arbitrary case (upper or lower). | [
"6 3\n",
"4 2\n",
"1000 1001\n"
] | [
"Yes\n",
"No\n",
"Yes\n"
] | In the first example, Imp has to apply the machine twice to original toys and then twice to copies. | 500 | [
{
"input": "6 3",
"output": "Yes"
},
{
"input": "4 2",
"output": "No"
},
{
"input": "1000 1001",
"output": "Yes"
},
{
"input": "1000000000 999999999",
"output": "Yes"
},
{
"input": "81452244 81452247",
"output": "No"
},
{
"input": "188032448 86524683",
"output": "Yes"
},
{
"input": "365289629 223844571",
"output": "No"
},
{
"input": "247579518 361164458",
"output": "No"
},
{
"input": "424836699 793451637",
"output": "No"
},
{
"input": "602093880 930771525",
"output": "No"
},
{
"input": "779351061 773124120",
"output": "Yes"
},
{
"input": "661640950 836815080",
"output": "No"
},
{
"input": "543930839 974134967",
"output": "No"
},
{
"input": "16155311 406422145",
"output": "No"
},
{
"input": "81601559 445618240",
"output": "No"
},
{
"input": "963891449 582938127",
"output": "No"
},
{
"input": "141148629 351661795",
"output": "No"
},
{
"input": "318405810 783948974",
"output": "No"
},
{
"input": "495662991 921268861",
"output": "No"
},
{
"input": "1 0",
"output": "No"
},
{
"input": "0 1",
"output": "Yes"
},
{
"input": "0 0",
"output": "No"
},
{
"input": "453462237 167520068",
"output": "Yes"
},
{
"input": "630719418 9872663",
"output": "Yes"
},
{
"input": "807976599 442159843",
"output": "No"
},
{
"input": "690266488 579479730",
"output": "No"
},
{
"input": "771581370 589752968",
"output": "No"
},
{
"input": "948838551 727072855",
"output": "No"
},
{
"input": "831128440 790763814",
"output": "No"
},
{
"input": "303352912 928083702",
"output": "No"
},
{
"input": "185642801 65403588",
"output": "Yes"
},
{
"input": "67932690 202723476",
"output": "No"
},
{
"input": "540157163 340043363",
"output": "No"
},
{
"input": "422447052 772330542",
"output": "No"
},
{
"input": "599704233 541054210",
"output": "Yes"
},
{
"input": "481994122 678374097",
"output": "No"
},
{
"input": "48564714 743566477",
"output": "No"
},
{
"input": "225821895 880886365",
"output": "No"
},
{
"input": "403079076 313173543",
"output": "Yes"
},
{
"input": "1000000000 1000000000",
"output": "No"
},
{
"input": "1 1",
"output": "No"
},
{
"input": "1 2",
"output": "Yes"
},
{
"input": "2 1",
"output": "No"
},
{
"input": "2 2",
"output": "No"
},
{
"input": "2 0",
"output": "No"
},
{
"input": "0 2",
"output": "No"
},
{
"input": "1000000000 1",
"output": "No"
},
{
"input": "777777 0",
"output": "No"
},
{
"input": "10 1",
"output": "No"
},
{
"input": "7 0",
"output": "No"
},
{
"input": "3 0",
"output": "No"
},
{
"input": "3 2",
"output": "Yes"
}
] | 1,589,968,385 | 2,147,483,647 | PyPy 3 | OK | TESTS | 52 | 140 | 0 | n, m = map(int, input().split())
if m < 1:
print('No')
elif m == 1:
if n == 0: print('YES')
else: print('No')
else:
n -= m-1
#print(n)
if n >= 0 and n%2 == 0:
print('Yes')
else:
print('No') | Title: Cloning Toys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imp likes his plush toy a lot.
Recently, he found a machine that can clone plush toys. Imp knows that if he applies the machine to an original toy, he additionally gets one more original toy and one copy, and if he applies the machine to a copied toy, he gets two additional copies.
Initially, Imp has only one original toy. He wants to know if it is possible to use machine to get exactly *x* copied toys and *y* original toys? He can't throw toys away, and he can't apply the machine to a copy if he doesn't currently have any copies.
Input Specification:
The only line contains two integers *x* and *y* (0<=≤<=*x*,<=*y*<=≤<=109) — the number of copies and the number of original toys Imp wants to get (including the initial one).
Output Specification:
Print "Yes", if the desired configuration is possible, and "No" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['6 3\n', '4 2\n', '1000 1001\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n']
Note:
In the first example, Imp has to apply the machine twice to original toys and then twice to copies. | ```python
n, m = map(int, input().split())
if m < 1:
print('No')
elif m == 1:
if n == 0: print('YES')
else: print('No')
else:
n -= m-1
#print(n)
if n >= 0 and n%2 == 0:
print('Yes')
else:
print('No')
``` | 3 |
|
49 | A | Sleuth | PROGRAMMING | 800 | [
"implementation"
] | A. Sleuth | 2 | 256 | Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z | The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter. | Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters. | [
"Is it a melon?\n",
"Is it an apple?\n",
"Is it a banana ?\n",
"Is it an apple and a banana simultaneouSLY?\n"
] | [
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] | none | 500 | [
{
"input": "Is it a melon?",
"output": "NO"
},
{
"input": "Is it an apple?",
"output": "YES"
},
{
"input": " Is it a banana ?",
"output": "YES"
},
{
"input": "Is it an apple and a banana simultaneouSLY?",
"output": "YES"
},
{
"input": "oHtSbDwzHb?",
"output": "NO"
},
{
"input": "sZecYdUvZHrXx?",
"output": "NO"
},
{
"input": "uMtXK?",
"output": "NO"
},
{
"input": "U?",
"output": "YES"
},
{
"input": "aqFDkCUKeHMyvZFcAyWlMUSQTFomtaWjoKLVyxLCw vcufPBFbaljOuHWiDCROYTcmbgzbaqHXKPOYEbuEtRqqoxBbOETCsQzhw?",
"output": "NO"
},
{
"input": "dJcNqQiFXzcbsj fItCpBLyXOnrSBPebwyFHlxUJHqCUzzCmcAvMiKL NunwOXnKeIxUZmBVwiCUfPkjRAkTPbkYCmwRRnDSLaz?",
"output": "NO"
},
{
"input": "gxzXbdcAQMuFKuuiPohtMgeypr wpDIoDSyOYTdvylcg SoEBZjnMHHYZGEqKgCgBeTbyTwyGuPZxkxsnSczotBdYyfcQsOVDVC?",
"output": "NO"
},
{
"input": "FQXBisXaJFMiHFQlXjixBDMaQuIbyqSBKGsBfTmBKCjszlGVZxEOqYYqRTUkGpSDDAoOXyXcQbHcPaegeOUBNeSD JiKOdECPOF?",
"output": "NO"
},
{
"input": "YhCuZnrWUBEed?",
"output": "NO"
},
{
"input": "hh?",
"output": "NO"
},
{
"input": "whU?",
"output": "YES"
},
{
"input": "fgwg?",
"output": "NO"
},
{
"input": "GlEmEPKrYcOnBNJUIFjszWUyVdvWw DGDjoCMtRJUburkPToCyDrOtMr?",
"output": "NO"
},
{
"input": "n?",
"output": "NO"
},
{
"input": "BueDOlxgzeNlxrzRrMbKiQdmGujEKmGxclvaPpTuHmTqBp?",
"output": "NO"
},
{
"input": "iehvZNQXDGCuVmJPOEysLyUryTdfaIxIuTzTadDbqRQGoCLXkxnyfWSGoLXebNnQQNTqAQJebbyYvHOfpUnXeWdjx?",
"output": "NO"
},
{
"input": " J ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " o ?",
"output": "YES"
},
{
"input": " T ?",
"output": "NO"
},
{
"input": " q ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " c ?",
"output": "NO"
},
{
"input": " B ?",
"output": "NO"
},
{
"input": "LuhxDHVwMPTtUIUMIQTuQETgXCOQPsfdFlyHvpfOVedjUTpGLAZGOHloIjJJtOLAlHPivzA?",
"output": "YES"
},
{
"input": "wmztmzFfwbGyOmNHENUFMTsFEMWYA?",
"output": "YES"
},
{
"input": "wGsfZCSwN PEUhNUrLfABrxA?",
"output": "YES"
},
{
"input": "mCDHENXjYbgMdBimAdPnewaHfpGWowjWrVAdvWczjw iDcUbyzMsmsnwbviiKiAyGVA?",
"output": "YES"
},
{
"input": "ARIWnwqFqxsQXsXXzHqvFjxOCttAGPUzDtWzsenPYdNXuFOIUGYZsLLK IaoxiyjBBRThoelwdPTkuCQfcBLUEJpCPIrVZlvUWA?",
"output": "YES"
},
{
"input": " PslvVpgpN BXkMFBEVXsyZFIQbBEFxGkYTeXKrOdcmhbiTUatYRUoYAayrchqbksswIlfIjerZPqptvCGnMUhyrQSvwltRhFzA?",
"output": "YES"
},
{
"input": "HpBkttwSjBXDmyleGiRWNUMPaAIE uzTrp KJDzaUiCdsMYOoWKHoUhWUoecCPmACymMUUbGav UMRpCytPETwNFAObZJA?",
"output": "YES"
}
] | 1,626,638,321 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 92 | 6,656,000 | q = input()
for i in range(len(q), -1, -1):
if q[i].isalpha():
print("YES" if q[i] in ("A", "I", "E", "O", "U", "Y") else "NO")
break | Title: Sleuth
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
Input Specification:
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
Output Specification:
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
Demo Input:
['Is it a melon?\n', 'Is it an apple?\n', 'Is it a banana ?\n', 'Is it an apple and a banana simultaneouSLY?\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
none | ```python
q = input()
for i in range(len(q), -1, -1):
if q[i].isalpha():
print("YES" if q[i] in ("A", "I", "E", "O", "U", "Y") else "NO")
break
``` | -1 |
25 | A | IQ test | PROGRAMMING | 1,300 | [
"brute force"
] | A. IQ test | 2 | 256 | Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. | Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. | [
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] | [
"3\n",
"2\n"
] | none | 0 | [
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,586,781,575 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 218 | 307,200 | n=int(input())
a=list(map(int,input().split()))
b=[]
c=[]
e=o=0
for i in range(0,n):
if(a[i]%2==0):
b.append(a[i])
e+=1
else:
c.append(a[i])
o+=1
if(o==1):
print(a.index(c[0])+1)
else:
print(a.index(b[0])+1) | Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
n=int(input())
a=list(map(int,input().split()))
b=[]
c=[]
e=o=0
for i in range(0,n):
if(a[i]%2==0):
b.append(a[i])
e+=1
else:
c.append(a[i])
o+=1
if(o==1):
print(a.index(c[0])+1)
else:
print(a.index(b[0])+1)
``` | 3.944928 |
656 | G | You're a Professional | PROGRAMMING | 1,900 | [
"*special"
] | null | null | A simple recommendation system would recommend a user things liked by a certain number of their friends. In this problem you will implement part of such a system.
You are given user's friends' opinions about a list of items. You are also given a threshold *T* — the minimal number of "likes" necessary for an item to be recommended to the user.
Output the number of items in the list liked by at least *T* of user's friends. | The first line of the input will contain three space-separated integers: the number of friends *F* (1<=≤<=*F*<=≤<=10), the number of items *I* (1<=≤<=*I*<=≤<=10) and the threshold *T* (1<=≤<=*T*<=≤<=*F*).
The following *F* lines of input contain user's friends' opinions. *j*-th character of *i*-th line is 'Y' if *i*-th friend likes *j*-th item, and 'N' otherwise. | Output an integer — the number of items liked by at least *T* of user's friends. | [
"3 3 2\nYYY\nNNN\nYNY\n",
"4 4 1\nNNNY\nNNYN\nNYNN\nYNNN\n"
] | [
"2\n",
"4\n"
] | none | 0 | [
{
"input": "3 3 2\nYYY\nNNN\nYNY",
"output": "2"
},
{
"input": "4 4 1\nNNNY\nNNYN\nNYNN\nYNNN",
"output": "4"
},
{
"input": "3 5 2\nNYNNY\nYNNNN\nNNYYN",
"output": "0"
},
{
"input": "1 10 1\nYYYNYNNYNN",
"output": "5"
},
{
"input": "10 1 5\nY\nN\nN\nN\nY\nN\nN\nY\nN\nN",
"output": "0"
},
{
"input": "10 10 1\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN",
"output": "0"
},
{
"input": "10 10 10\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY",
"output": "10"
},
{
"input": "8 9 1\nNYNNYYYYN\nNNNYNYNNY\nYYNYNYNNN\nNYYYNYNNN\nYNYNYNYYN\nYYNNYYYYY\nYYYYNYNYY\nNYYNNYYYY",
"output": "9"
},
{
"input": "5 2 3\nNN\nNY\nYY\nNN\nNY",
"output": "1"
},
{
"input": "6 4 5\nYNNY\nNYYY\nNNNY\nYNYN\nYYYN\nYNNY",
"output": "0"
},
{
"input": "6 1 3\nY\nY\nY\nY\nY\nN",
"output": "1"
},
{
"input": "6 2 2\nYN\nNN\nYN\nNN\nYN\nNN",
"output": "1"
},
{
"input": "2 4 2\nNYNY\nNYNY",
"output": "2"
},
{
"input": "9 6 3\nNYYYYN\nNNNYYN\nYYYYYY\nNYNNNN\nYNNYNY\nNNNNNY\nYNNYNN\nYYYYNY\nNNYYYY",
"output": "6"
},
{
"input": "6 9 6\nYYYYNYNNN\nYNNYNNNYN\nNYYYNNNYY\nNYYYNNNNY\nYYNYNNNYY\nYYYNYYNNN",
"output": "0"
},
{
"input": "9 7 8\nYNNNNYN\nNNNYYNN\nNNYYYNY\nNYYNYYY\nNNYYNYN\nNYYYNNY\nYYNYNYY\nNYYYYYY\nNNYYNYN",
"output": "0"
},
{
"input": "9 1 6\nN\nN\nY\nN\nY\nY\nY\nY\nY",
"output": "1"
},
{
"input": "7 7 2\nNNYNNYN\nNNNYYNY\nNNNYYNY\nYNNNNNY\nNNYNYYY\nYYNNYYN\nNNYYYNY",
"output": "6"
},
{
"input": "8 4 2\nYNYY\nYNYY\nYNNN\nNNNN\nNYNN\nYNNN\nNNYN\nNYNN",
"output": "4"
},
{
"input": "9 10 7\nNNYNNYYYYY\nYNYYNYYNYN\nNYNYYNNNNY\nYYYYYYYYYN\nYYNYNYYNNN\nYYYNNYYYYY\nNYYYYYNNNN\nNYNNYYYYNN\nYYYYYNNYYY",
"output": "2"
},
{
"input": "6 4 2\nNNNN\nNYYY\nNYNN\nNYNN\nYNNY\nNNNN",
"output": "2"
},
{
"input": "3 1 1\nN\nY\nN",
"output": "1"
},
{
"input": "7 1 3\nY\nY\nY\nN\nY\nY\nY",
"output": "1"
},
{
"input": "9 8 7\nNYYNNNYY\nYYYNYNNN\nYNYNYNNY\nNYYYNNNY\nNYYYYNYN\nNNNNYYNN\nYNYYYYYY\nNNYNYNYY\nNYYNNYYY",
"output": "1"
},
{
"input": "9 5 9\nYYYYN\nYYYNN\nNNYNN\nNNYYY\nYNNNN\nNYNNN\nYYYYN\nYNYYN\nNNNYN",
"output": "0"
},
{
"input": "8 4 1\nYYYN\nNNNN\nNYNY\nYNNY\nYNYY\nYNYN\nYNNY\nNNYN",
"output": "4"
},
{
"input": "7 9 5\nYNNYYYYNN\nYNYYYNNYY\nYNYYYYYNN\nYYNYYNYYN\nNNYYNNNYY\nYYNYNYYNN\nYYNNYYNYN",
"output": "3"
},
{
"input": "5 8 3\nNYYYNNNN\nYNNNNNYY\nYNYYYNYY\nNNNNNYNN\nYYYYYYYY",
"output": "5"
},
{
"input": "5 10 4\nYYYYNNNNYN\nYYYNYYYNNY\nNNNYNYNYNY\nYNYNNNNNNY\nNNYNYNYNYY",
"output": "2"
},
{
"input": "6 9 6\nNYYNNYNYN\nYNYNYNNNN\nNNYNNYYYY\nNNYNNNYNY\nNYYYNNYNY\nNNYYNNNYN",
"output": "1"
},
{
"input": "4 4 1\nYNYY\nNNNY\nYNNN\nNNYN",
"output": "3"
},
{
"input": "1 3 1\nYYN",
"output": "2"
},
{
"input": "10 4 5\nNNYN\nYYNY\nYYNY\nNYYN\nYNYY\nYNYY\nYYNN\nYNYN\nYYYY\nYYNY",
"output": "4"
}
] | 1,509,690,684 | 2,147,483,647 | Python 3 | OK | TESTS | 33 | 62 | 0 | n,m,k=map(int,input().split())
c=[0]*m
for i in range(n):
a=input()
for j in range(m):
c[j]+=a[j]=='Y'
print(sum(c[i]>=k for i in range(m)))#kitten | Title: You're a Professional
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A simple recommendation system would recommend a user things liked by a certain number of their friends. In this problem you will implement part of such a system.
You are given user's friends' opinions about a list of items. You are also given a threshold *T* — the minimal number of "likes" necessary for an item to be recommended to the user.
Output the number of items in the list liked by at least *T* of user's friends.
Input Specification:
The first line of the input will contain three space-separated integers: the number of friends *F* (1<=≤<=*F*<=≤<=10), the number of items *I* (1<=≤<=*I*<=≤<=10) and the threshold *T* (1<=≤<=*T*<=≤<=*F*).
The following *F* lines of input contain user's friends' opinions. *j*-th character of *i*-th line is 'Y' if *i*-th friend likes *j*-th item, and 'N' otherwise.
Output Specification:
Output an integer — the number of items liked by at least *T* of user's friends.
Demo Input:
['3 3 2\nYYY\nNNN\nYNY\n', '4 4 1\nNNNY\nNNYN\nNYNN\nYNNN\n']
Demo Output:
['2\n', '4\n']
Note:
none | ```python
n,m,k=map(int,input().split())
c=[0]*m
for i in range(n):
a=input()
for j in range(m):
c[j]+=a[j]=='Y'
print(sum(c[i]>=k for i in range(m)))#kitten
``` | 3 |
|
550 | C | Divisibility by Eight | PROGRAMMING | 1,500 | [
"brute force",
"dp",
"math"
] | null | null | You are given a non-negative integer *n*, its decimal representation consists of at most 100 digits and doesn't contain leading zeroes.
Your task is to determine if it is possible in this case to remove some of the digits (possibly not remove any digit at all) so that the result contains at least one digit, forms a non-negative integer, doesn't have leading zeroes and is divisible by 8. After the removing, it is forbidden to rearrange the digits.
If a solution exists, you should print it. | The single line of the input contains a non-negative integer *n*. The representation of number *n* doesn't contain any leading zeroes and its length doesn't exceed 100 digits. | Print "NO" (without quotes), if there is no such way to remove some digits from number *n*.
Otherwise, print "YES" in the first line and the resulting number after removing digits from number *n* in the second line. The printed number must be divisible by 8.
If there are multiple possible answers, you may print any of them. | [
"3454\n",
"10\n",
"111111\n"
] | [
"YES\n344\n",
"YES\n0\n",
"NO\n"
] | none | 1,000 | [
{
"input": "3454",
"output": "YES\n344"
},
{
"input": "10",
"output": "YES\n0"
},
{
"input": "111111",
"output": "NO"
},
{
"input": "8996988892",
"output": "YES\n8"
},
{
"input": "5555555555",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "8147522776919916277306861346922924221557534659480258977017038624458370459299847590937757625791239188",
"output": "YES\n8"
},
{
"input": "8",
"output": "YES\n8"
},
{
"input": "14",
"output": "NO"
},
{
"input": "2363",
"output": "NO"
},
{
"input": "3554",
"output": "NO"
},
{
"input": "312",
"output": "YES\n32"
},
{
"input": "7674",
"output": "YES\n64"
},
{
"input": "126",
"output": "YES\n16"
},
{
"input": "344",
"output": "YES\n344"
},
{
"input": "976",
"output": "YES\n96"
},
{
"input": "3144",
"output": "YES\n344"
},
{
"input": "1492",
"output": "YES\n192"
},
{
"input": "1000",
"output": "YES\n0"
},
{
"input": "303",
"output": "YES\n0"
},
{
"input": "111111111111111111111171111111111111111111111111111112",
"output": "YES\n72"
},
{
"input": "3111111111111111111111411111111111111111111141111111441",
"output": "YES\n344"
},
{
"input": "7486897358699809313898215064443112428113331907121460549315254356705507612143346801724124391167293733",
"output": "YES\n8"
},
{
"input": "1787075866",
"output": "YES\n8"
},
{
"input": "836501278190105055089734832290981",
"output": "YES\n8"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "NO"
},
{
"input": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222",
"output": "NO"
},
{
"input": "3333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333",
"output": "NO"
},
{
"input": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "YES\n0"
},
{
"input": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555",
"output": "NO"
},
{
"input": "66666666666666666666666666666666666666666666666666666666666666666666666666666",
"output": "NO"
},
{
"input": "88888888888888888888888888888888888888888888888888888888888888888888888888888888",
"output": "YES\n8"
},
{
"input": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999",
"output": "NO"
},
{
"input": "353",
"output": "NO"
},
{
"input": "39",
"output": "NO"
},
{
"input": "3697519",
"output": "NO"
},
{
"input": "6673177113",
"output": "NO"
},
{
"input": "6666351371557713735",
"output": "NO"
},
{
"input": "17943911115335733153157373517",
"output": "NO"
},
{
"input": "619715515939999957957971971757533319177373",
"output": "NO"
},
{
"input": "4655797151375799393395377959959573533195153397997597195199777159133",
"output": "NO"
},
{
"input": "5531399953495399131957773999751571911139197159755793777773799119333593915333593153173775755771193715",
"output": "NO"
},
{
"input": "1319571733331774579193199551977735199771153997797535591739153377377111795579371959933533573517995559",
"output": "NO"
},
{
"input": "3313393139519343957311771319713797711159791515393917539133957799131393735795317131513557337319131993",
"output": "NO"
},
{
"input": "526",
"output": "YES\n56"
},
{
"input": "513",
"output": "NO"
},
{
"input": "674",
"output": "YES\n64"
},
{
"input": "8353",
"output": "YES\n8"
},
{
"input": "3957",
"output": "NO"
},
{
"input": "4426155776626276881222352363321488266188669874572115686737742545442766138617391954346963915982759371",
"output": "YES\n8"
},
{
"input": "9592419524227735697379444145348135927975358347769514686865768941989693174565893724972575152874281772",
"output": "YES\n8"
},
{
"input": "94552498866729239313265973246288189853135485783461",
"output": "YES\n8"
},
{
"input": "647934465937812",
"output": "YES\n8"
},
{
"input": "1327917795375366484539554526312125336",
"output": "YES\n8"
},
{
"input": "295971811535848297878828225646878276486982655866912496735794542",
"output": "YES\n8"
},
{
"input": "7217495392264549817889283233368819844137671271383133997418139697797385729777632527678136",
"output": "YES\n8"
},
{
"input": "11111111111111111111112111111111",
"output": "YES\n112"
},
{
"input": "262626262626262626262626262626262626",
"output": "NO"
},
{
"input": "1000000000000000000000000000000000000",
"output": "YES\n0"
},
{
"input": "9969929446",
"output": "YES\n96"
},
{
"input": "43523522125549722432232256557771715456345544922144",
"output": "YES\n32"
},
{
"input": "9344661521956564755454992376342544254667536539463277572111263273131199437332443253296774957",
"output": "YES\n96"
},
{
"input": "1946374341357914632311595531429723377642197432217137651552992479954116463332543456759911377223599715",
"output": "YES\n16"
},
{
"input": "461259",
"output": "NO"
},
{
"input": "461592",
"output": "YES\n152"
},
{
"input": "46159237",
"output": "YES\n152"
},
{
"input": "42367",
"output": "NO"
},
{
"input": "42376",
"output": "YES\n376"
},
{
"input": "42376159",
"output": "YES\n376"
},
{
"input": "444444444444444444444444444444666666666666666666666666666666222222222222222222222222222222",
"output": "NO"
},
{
"input": "0",
"output": "YES\n0"
},
{
"input": "33332",
"output": "YES\n32"
},
{
"input": "6499999999",
"output": "YES\n64"
}
] | 1,697,739,747 | 2,147,483,647 | Python 3 | OK | TESTS | 73 | 93 | 0 | s = input()
if s.count('0') > 0:
print('YES')
print(0)
exit(0)
if s.count('8') > 0:
print('YES')
print(8)
exit(0)
for i in range(len(s)):
for j in range(i + 1, len(s)):
for k in range(j + 1, len(s)):
x = int(s[i] + s[j] + s[k])
if x % 8 == 0:
print('YES')
print(x)
exit(0)
for i in range(len(s)):
for j in range(i + 1, len(s)):
x = int(s[i] + s[j])
if x % 8 == 0:
print('YES')
print(x)
exit(0)
print('NO') | Title: Divisibility by Eight
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a non-negative integer *n*, its decimal representation consists of at most 100 digits and doesn't contain leading zeroes.
Your task is to determine if it is possible in this case to remove some of the digits (possibly not remove any digit at all) so that the result contains at least one digit, forms a non-negative integer, doesn't have leading zeroes and is divisible by 8. After the removing, it is forbidden to rearrange the digits.
If a solution exists, you should print it.
Input Specification:
The single line of the input contains a non-negative integer *n*. The representation of number *n* doesn't contain any leading zeroes and its length doesn't exceed 100 digits.
Output Specification:
Print "NO" (without quotes), if there is no such way to remove some digits from number *n*.
Otherwise, print "YES" in the first line and the resulting number after removing digits from number *n* in the second line. The printed number must be divisible by 8.
If there are multiple possible answers, you may print any of them.
Demo Input:
['3454\n', '10\n', '111111\n']
Demo Output:
['YES\n344\n', 'YES\n0\n', 'NO\n']
Note:
none | ```python
s = input()
if s.count('0') > 0:
print('YES')
print(0)
exit(0)
if s.count('8') > 0:
print('YES')
print(8)
exit(0)
for i in range(len(s)):
for j in range(i + 1, len(s)):
for k in range(j + 1, len(s)):
x = int(s[i] + s[j] + s[k])
if x % 8 == 0:
print('YES')
print(x)
exit(0)
for i in range(len(s)):
for j in range(i + 1, len(s)):
x = int(s[i] + s[j])
if x % 8 == 0:
print('YES')
print(x)
exit(0)
print('NO')
``` | 3 |
|
26 | A | Almost Prime | PROGRAMMING | 900 | [
"number theory"
] | A. Almost Prime | 2 | 256 | A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive. | Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000). | Output the amount of almost prime numbers between 1 and *n*, inclusive. | [
"10\n",
"21\n"
] | [
"2\n",
"8\n"
] | none | 500 | [
{
"input": "10",
"output": "2"
},
{
"input": "21",
"output": "8"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "19",
"output": "6"
},
{
"input": "40",
"output": "19"
},
{
"input": "77",
"output": "41"
},
{
"input": "222",
"output": "125"
},
{
"input": "987",
"output": "501"
},
{
"input": "1000",
"output": "508"
},
{
"input": "2000",
"output": "958"
},
{
"input": "3000",
"output": "1375"
},
{
"input": "2999",
"output": "1375"
},
{
"input": "2998",
"output": "1375"
},
{
"input": "2997",
"output": "1374"
},
{
"input": "1429",
"output": "706"
},
{
"input": "1673",
"output": "808"
},
{
"input": "1500",
"output": "732"
},
{
"input": "500",
"output": "266"
},
{
"input": "856",
"output": "439"
}
] | 1,583,296,564 | 2,147,483,647 | Python 3 | OK | TESTS | 23 | 1,964 | 307,200 | n=int(input())
cnt=0
x=0
for r in range(4,n+1):
v=r
cnt=0
for i in range(2,v-1):
if(v%i==0):
k=0
for j in range(2,i-1):
if(i%j==0):
k+=1
if(k==0):
cnt+=1
if(cnt==2):
x+=1
print(x)
| Title: Almost Prime
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input Specification:
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
Output Specification:
Output the amount of almost prime numbers between 1 and *n*, inclusive.
Demo Input:
['10\n', '21\n']
Demo Output:
['2\n', '8\n']
Note:
none | ```python
n=int(input())
cnt=0
x=0
for r in range(4,n+1):
v=r
cnt=0
for i in range(2,v-1):
if(v%i==0):
k=0
for j in range(2,i-1):
if(i%j==0):
k+=1
if(k==0):
cnt+=1
if(cnt==2):
x+=1
print(x)
``` | 3.508428 |
1,009 | B | Minimum Ternary String | PROGRAMMING | 1,400 | [
"greedy",
"implementation"
] | null | null | You are given a ternary string (it is a string which consists only of characters '0', '1' and '2').
You can swap any two adjacent (consecutive) characters '0' and '1' (i.e. replace "01" with "10" or vice versa) or any two adjacent (consecutive) characters '1' and '2' (i.e. replace "12" with "21" or vice versa).
For example, for string "010210" we can perform the following moves:
- "010210" $\rightarrow$ "100210"; - "010210" $\rightarrow$ "001210"; - "010210" $\rightarrow$ "010120"; - "010210" $\rightarrow$ "010201".
Note than you cannot swap "02" $\rightarrow$ "20" and vice versa. You cannot perform any other operations with the given string excluding described above.
You task is to obtain the minimum possible (lexicographically) string by using these swaps arbitrary number of times (possibly, zero).
String $a$ is lexicographically less than string $b$ (if strings $a$ and $b$ have the same length) if there exists some position $i$ ($1 \le i \le |a|$, where $|s|$ is the length of the string $s$) such that for every $j < i$ holds $a_j = b_j$, and $a_i < b_i$. | The first line of the input contains the string $s$ consisting only of characters '0', '1' and '2', its length is between $1$ and $10^5$ (inclusive). | Print a single string — the minimum possible (lexicographically) string you can obtain by using the swaps described above arbitrary number of times (possibly, zero). | [
"100210\n",
"11222121\n",
"20\n"
] | [
"001120\n",
"11112222\n",
"20\n"
] | none | 0 | [
{
"input": "100210",
"output": "001120"
},
{
"input": "11222121",
"output": "11112222"
},
{
"input": "20",
"output": "20"
},
{
"input": "1002",
"output": "0012"
},
{
"input": "10",
"output": "01"
},
{
"input": "000021",
"output": "000012"
},
{
"input": "021",
"output": "012"
},
{
"input": "2",
"output": "2"
},
{
"input": "201",
"output": "120"
},
{
"input": "2112120",
"output": "1112220"
},
{
"input": "102",
"output": "012"
},
{
"input": "202",
"output": "202"
},
{
"input": "220201",
"output": "122020"
},
{
"input": "12",
"output": "12"
},
{
"input": "100022202",
"output": "000122202"
},
{
"input": "01",
"output": "01"
},
{
"input": "1",
"output": "1"
}
] | 1,617,375,746 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 140 | 2,867,200 | s=input()[::-1]
while '12' in s:
s1=s.replace('12','21')
s=s1[:]
while '01' in s:
s1=s.replace('01','10')
s=s1[:]
print(s[::-1])
| Title: Minimum Ternary String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a ternary string (it is a string which consists only of characters '0', '1' and '2').
You can swap any two adjacent (consecutive) characters '0' and '1' (i.e. replace "01" with "10" or vice versa) or any two adjacent (consecutive) characters '1' and '2' (i.e. replace "12" with "21" or vice versa).
For example, for string "010210" we can perform the following moves:
- "010210" $\rightarrow$ "100210"; - "010210" $\rightarrow$ "001210"; - "010210" $\rightarrow$ "010120"; - "010210" $\rightarrow$ "010201".
Note than you cannot swap "02" $\rightarrow$ "20" and vice versa. You cannot perform any other operations with the given string excluding described above.
You task is to obtain the minimum possible (lexicographically) string by using these swaps arbitrary number of times (possibly, zero).
String $a$ is lexicographically less than string $b$ (if strings $a$ and $b$ have the same length) if there exists some position $i$ ($1 \le i \le |a|$, where $|s|$ is the length of the string $s$) such that for every $j < i$ holds $a_j = b_j$, and $a_i < b_i$.
Input Specification:
The first line of the input contains the string $s$ consisting only of characters '0', '1' and '2', its length is between $1$ and $10^5$ (inclusive).
Output Specification:
Print a single string — the minimum possible (lexicographically) string you can obtain by using the swaps described above arbitrary number of times (possibly, zero).
Demo Input:
['100210\n', '11222121\n', '20\n']
Demo Output:
['001120\n', '11112222\n', '20\n']
Note:
none | ```python
s=input()[::-1]
while '12' in s:
s1=s.replace('12','21')
s=s1[:]
while '01' in s:
s1=s.replace('01','10')
s=s1[:]
print(s[::-1])
``` | 0 |
|
762 | A | k-th divisor | PROGRAMMING | 1,400 | [
"math",
"number theory"
] | null | null | You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist.
Divisor of *n* is any such natural number, that *n* can be divided by it without remainder. | The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109). | If *n* has less than *k* divisors, output -1.
Otherwise, output the *k*-th smallest divisor of *n*. | [
"4 2\n",
"5 3\n",
"12 5\n"
] | [
"2\n",
"-1\n",
"6\n"
] | In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2.
In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1. | 0 | [
{
"input": "4 2",
"output": "2"
},
{
"input": "5 3",
"output": "-1"
},
{
"input": "12 5",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "866421317361600 26880",
"output": "866421317361600"
},
{
"input": "866421317361600 26881",
"output": "-1"
},
{
"input": "1000000000000000 1000000000",
"output": "-1"
},
{
"input": "1000000000000000 100",
"output": "1953125"
},
{
"input": "1 2",
"output": "-1"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "9 3",
"output": "9"
},
{
"input": "21 3",
"output": "7"
},
{
"input": "67280421310721 1",
"output": "1"
},
{
"input": "6 3",
"output": "3"
},
{
"input": "3 3",
"output": "-1"
},
{
"input": "16 3",
"output": "4"
},
{
"input": "1 1000",
"output": "-1"
},
{
"input": "16 4",
"output": "8"
},
{
"input": "36 8",
"output": "18"
},
{
"input": "49 4",
"output": "-1"
},
{
"input": "9 4",
"output": "-1"
},
{
"input": "16 1",
"output": "1"
},
{
"input": "16 6",
"output": "-1"
},
{
"input": "16 5",
"output": "16"
},
{
"input": "25 4",
"output": "-1"
},
{
"input": "4010815561 2",
"output": "63331"
},
{
"input": "49 3",
"output": "49"
},
{
"input": "36 6",
"output": "9"
},
{
"input": "36 10",
"output": "-1"
},
{
"input": "25 3",
"output": "25"
},
{
"input": "22876792454961 28",
"output": "7625597484987"
},
{
"input": "1234 2",
"output": "2"
},
{
"input": "179458711 2",
"output": "179458711"
},
{
"input": "900104343024121 100000",
"output": "-1"
},
{
"input": "8 3",
"output": "4"
},
{
"input": "100 6",
"output": "20"
},
{
"input": "15500 26",
"output": "-1"
},
{
"input": "111111 1",
"output": "1"
},
{
"input": "100000000000000 200",
"output": "160000000000"
},
{
"input": "1000000000000 100",
"output": "6400000"
},
{
"input": "100 10",
"output": "-1"
},
{
"input": "1000000000039 2",
"output": "1000000000039"
},
{
"input": "64 5",
"output": "16"
},
{
"input": "999999961946176 33",
"output": "63245552"
},
{
"input": "376219076689 3",
"output": "376219076689"
},
{
"input": "999999961946176 63",
"output": "999999961946176"
},
{
"input": "1048576 12",
"output": "2048"
},
{
"input": "745 21",
"output": "-1"
},
{
"input": "748 6",
"output": "22"
},
{
"input": "999999961946176 50",
"output": "161082468097"
},
{
"input": "10 3",
"output": "5"
},
{
"input": "1099511627776 22",
"output": "2097152"
},
{
"input": "1000000007 100010",
"output": "-1"
},
{
"input": "3 1",
"output": "1"
},
{
"input": "100 8",
"output": "50"
},
{
"input": "100 7",
"output": "25"
},
{
"input": "7 2",
"output": "7"
},
{
"input": "999999961946176 64",
"output": "-1"
},
{
"input": "20 5",
"output": "10"
},
{
"input": "999999999999989 2",
"output": "999999999999989"
},
{
"input": "100000000000000 114",
"output": "10240000"
},
{
"input": "99999640000243 3",
"output": "9999991"
},
{
"input": "999998000001 566",
"output": "333332666667"
},
{
"input": "99999820000081 2",
"output": "9999991"
},
{
"input": "49000042000009 3",
"output": "49000042000009"
},
{
"input": "151491429961 4",
"output": "-1"
},
{
"input": "32416190071 2",
"output": "32416190071"
},
{
"input": "1000 8",
"output": "25"
},
{
"input": "1999967841 15",
"output": "1999967841"
},
{
"input": "26880 26880",
"output": "-1"
},
{
"input": "151491429961 3",
"output": "151491429961"
},
{
"input": "90000000000 300",
"output": "100000000"
},
{
"input": "98765004361 10",
"output": "-1"
},
{
"input": "15 2",
"output": "3"
},
{
"input": "16 2",
"output": "2"
},
{
"input": "1996 2",
"output": "2"
},
{
"input": "1997 2",
"output": "1997"
},
{
"input": "1999 2",
"output": "1999"
},
{
"input": "1998 2",
"output": "2"
},
{
"input": "1998 1",
"output": "1"
},
{
"input": "1998 7",
"output": "27"
},
{
"input": "1998 8",
"output": "37"
},
{
"input": "100000380000361 2",
"output": "10000019"
},
{
"input": "15 1",
"output": "1"
},
{
"input": "100000000000000 226",
"output": "-1"
},
{
"input": "844030857550613 517",
"output": "-1"
},
{
"input": "4567890 14",
"output": "430"
},
{
"input": "123123123 123123123",
"output": "-1"
},
{
"input": "24 4",
"output": "4"
},
{
"input": "999999993568952 17",
"output": "31622777"
},
{
"input": "99999999994190 9",
"output": "241656799"
},
{
"input": "999997874844049 4",
"output": "-1"
},
{
"input": "99999999999931 2",
"output": "99999999999931"
},
{
"input": "2 3",
"output": "-1"
},
{
"input": "67280421310721 2",
"output": "67280421310721"
}
] | 1,570,089,940 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 1 | 124 | 0 | from math import sqrt
n,k=map(int,input().split())
x=[]
y=[]
for i in range(1,int(sqrt(n))+1):
if n%i==0 and n//i!=i:
x.append(i)
y.append(n//i)
y.sort()
k-=1
if k>=len(x)+len(y):
print(-1)
elif k<len(x):
print(x[k])
else:
print(y[k-len(x)]) | Title: k-th divisor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two integers *n* and *k*. Find *k*-th smallest divisor of *n*, or report that it doesn't exist.
Divisor of *n* is any such natural number, that *n* can be divided by it without remainder.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=1015, 1<=≤<=*k*<=≤<=109).
Output Specification:
If *n* has less than *k* divisors, output -1.
Otherwise, output the *k*-th smallest divisor of *n*.
Demo Input:
['4 2\n', '5 3\n', '12 5\n']
Demo Output:
['2\n', '-1\n', '6\n']
Note:
In the first example, number 4 has three divisors: 1, 2 and 4. The second one is 2.
In the second example, number 5 has only two divisors: 1 and 5. The third divisor doesn't exist, so the answer is -1. | ```python
from math import sqrt
n,k=map(int,input().split())
x=[]
y=[]
for i in range(1,int(sqrt(n))+1):
if n%i==0 and n//i!=i:
x.append(i)
y.append(n//i)
y.sort()
k-=1
if k>=len(x)+len(y):
print(-1)
elif k<len(x):
print(x[k])
else:
print(y[k-len(x)])
``` | 0 |
|
552 | B | Vanya and Books | PROGRAMMING | 1,200 | [
"implementation",
"math"
] | null | null | Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books. | The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library. | Print the number of digits needed to number all the books. | [
"13\n",
"4\n"
] | [
"17\n",
"4\n"
] | Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits. | 1,000 | [
{
"input": "13",
"output": "17"
},
{
"input": "4",
"output": "4"
},
{
"input": "100",
"output": "192"
},
{
"input": "99",
"output": "189"
},
{
"input": "1000000000",
"output": "8888888899"
},
{
"input": "1000000",
"output": "5888896"
},
{
"input": "999",
"output": "2889"
},
{
"input": "55",
"output": "101"
},
{
"input": "222222222",
"output": "1888888896"
},
{
"input": "8",
"output": "8"
},
{
"input": "13",
"output": "17"
},
{
"input": "313",
"output": "831"
},
{
"input": "1342",
"output": "4261"
},
{
"input": "30140",
"output": "139594"
},
{
"input": "290092",
"output": "1629447"
},
{
"input": "2156660",
"output": "13985516"
},
{
"input": "96482216",
"output": "760746625"
},
{
"input": "943006819",
"output": "8375950269"
},
{
"input": "1",
"output": "1"
},
{
"input": "7",
"output": "7"
},
{
"input": "35",
"output": "61"
},
{
"input": "996",
"output": "2880"
},
{
"input": "6120",
"output": "23373"
},
{
"input": "30660",
"output": "142194"
},
{
"input": "349463",
"output": "1985673"
},
{
"input": "8171970",
"output": "56092686"
},
{
"input": "36123011",
"output": "277872985"
},
{
"input": "986747865",
"output": "8769619683"
},
{
"input": "9",
"output": "9"
},
{
"input": "10",
"output": "11"
},
{
"input": "11",
"output": "13"
},
{
"input": "101",
"output": "195"
},
{
"input": "1000",
"output": "2893"
},
{
"input": "1001",
"output": "2897"
},
{
"input": "9999",
"output": "38889"
},
{
"input": "10000",
"output": "38894"
},
{
"input": "10001",
"output": "38899"
},
{
"input": "99999",
"output": "488889"
},
{
"input": "100000",
"output": "488895"
},
{
"input": "100001",
"output": "488901"
},
{
"input": "999999",
"output": "5888889"
},
{
"input": "1000001",
"output": "5888903"
},
{
"input": "9999999",
"output": "68888889"
},
{
"input": "10000000",
"output": "68888897"
},
{
"input": "10000001",
"output": "68888905"
},
{
"input": "99999999",
"output": "788888889"
},
{
"input": "100000000",
"output": "788888898"
},
{
"input": "100000001",
"output": "788888907"
},
{
"input": "999999999",
"output": "8888888889"
},
{
"input": "95",
"output": "181"
},
{
"input": "995",
"output": "2877"
},
{
"input": "9995",
"output": "38873"
},
{
"input": "99995",
"output": "488869"
},
{
"input": "999999995",
"output": "8888888853"
},
{
"input": "999999998",
"output": "8888888880"
}
] | 1,589,370,317 | 2,147,483,647 | PyPy 3 | OK | TESTS | 55 | 156 | 20,172,800 | a=int(input())
p=0
for j in range(len(str(a)),1,-1):
if j==len(str(a)):
p+= (a-int((j-1)*'9'))*j
else:
p+= (int('9'*j)-int('9'*(j-1)))*j
if a>9:
print(p+9)
else:
print(a)
| Title: Vanya and Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
Output Specification:
Print the number of digits needed to number all the books.
Demo Input:
['13\n', '4\n']
Demo Output:
['17\n', '4\n']
Note:
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits. | ```python
a=int(input())
p=0
for j in range(len(str(a)),1,-1):
if j==len(str(a)):
p+= (a-int((j-1)*'9'))*j
else:
p+= (int('9'*j)-int('9'*(j-1)))*j
if a>9:
print(p+9)
else:
print(a)
``` | 3 |
|
377 | A | Maze | PROGRAMMING | 1,600 | [
"dfs and similar"
] | null | null | Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him. | The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall. | Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them. | [
"3 4 2\n#..#\n..#.\n#...\n",
"5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n"
] | [
"#.X#\nX.#.\n#...\n",
"#XXX\n#X#.\nX#..\n...#\n.#.#\n"
] | none | 500 | [
{
"input": "5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#",
"output": "#XXX\n#X#.\nX#..\n...#\n.#.#"
},
{
"input": "3 3 2\n#.#\n...\n#.#",
"output": "#X#\nX..\n#.#"
},
{
"input": "7 7 18\n#.....#\n..#.#..\n.#...#.\n...#...\n.#...#.\n..#.#..\n#.....#",
"output": "#XXXXX#\nXX#X#X.\nX#XXX#.\nXXX#...\nX#...#.\nX.#.#..\n#.....#"
},
{
"input": "1 1 0\n.",
"output": "."
},
{
"input": "2 3 1\n..#\n#..",
"output": "X.#\n#.."
},
{
"input": "2 3 1\n#..\n..#",
"output": "#.X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n..#",
"output": "...\n.#X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n#..",
"output": "...\nX#.\n#.."
},
{
"input": "5 4 4\n#..#\n....\n.##.\n....\n#..#",
"output": "#XX#\nXX..\n.##.\n....\n#..#"
},
{
"input": "5 5 2\n.#..#\n..#.#\n#....\n##.#.\n###..",
"output": "X#..#\nX.#.#\n#....\n##.#.\n###.."
},
{
"input": "4 6 3\n#.....\n#.#.#.\n.#...#\n...#.#",
"output": "#.....\n#X#.#X\nX#...#\n...#.#"
},
{
"input": "7 5 4\n.....\n.#.#.\n#...#\n.#.#.\n.#...\n..#..\n....#",
"output": "X...X\nX#.#X\n#...#\n.#.#.\n.#...\n..#..\n....#"
},
{
"input": "16 14 19\n##############\n..############\n#.############\n#..###########\n....##########\n..############\n.#############\n.#.###########\n....##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###....#......\n#...#...##.###",
"output": "##############\nXX############\n#X############\n#XX###########\nXXXX##########\nXX############\nX#############\nX#.###########\nX...##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###...X#......\n#X..#XXX##.###"
},
{
"input": "10 17 32\n######.##########\n####.#.##########\n...#....#########\n.........########\n##.......########\n........#########\n#.....###########\n#################\n#################\n#################",
"output": "######X##########\n####X#X##########\nXXX#XXXX#########\nXXXXXXXXX########\n##XXX.XXX########\nXXXX...X#########\n#XX...###########\n#################\n#################\n#################"
},
{
"input": "16 10 38\n##########\n##########\n##########\n..########\n...#######\n...#######\n...#######\n....######\n.....####.\n......###.\n......##..\n.......#..\n.........#\n.........#\n.........#\n.........#",
"output": "##########\n##########\n##########\nXX########\nXXX#######\nXXX#######\nXXX#######\nXXXX######\nXXXXX####.\nXXXXX.###.\nXXXX..##..\nXXX....#..\nXXX......#\nXX.......#\nX........#\n.........#"
},
{
"input": "15 16 19\n########.....###\n########.....###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n.....#####.#..##\n................\n.#...........###\n###.########.###\n###.########.###",
"output": "########XXXXX###\n########XXXXX###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\nXXXX.#####.#..##\nXXX.............\nX#...........###\n###.########.###\n###X########.###"
},
{
"input": "12 19 42\n.........##########\n...................\n.##.##############.\n..################.\n..#################\n..#################\n..#################\n..#################\n..#################\n..#################\n..##########.######\n.............######",
"output": "XXXXXXXXX##########\nXXXXXXXXXXXXXXXXXXX\nX##X##############X\nXX################X\nXX#################\nXX#################\nXX#################\nX.#################\nX.#################\n..#################\n..##########.######\n.............######"
},
{
"input": "3 5 1\n#...#\n..#..\n..#..",
"output": "#...#\n..#..\nX.#.."
},
{
"input": "4 5 10\n.....\n.....\n..#..\n..#..",
"output": "XXX..\nXXX..\nXX#..\nXX#.."
},
{
"input": "3 5 3\n.....\n..#..\n..#..",
"output": ".....\nX.#..\nXX#.."
},
{
"input": "3 5 1\n#....\n..#..\n..###",
"output": "#....\n..#.X\n..###"
},
{
"input": "4 5 1\n.....\n.##..\n..#..\n..###",
"output": ".....\n.##..\n..#.X\n..###"
},
{
"input": "3 5 2\n..#..\n..#..\n....#",
"output": "X.#..\nX.#..\n....#"
},
{
"input": "10 10 1\n##########\n##......##\n#..#..#..#\n#..####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########",
"output": "##########\n##......##\n#..#..#..#\n#X.####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########"
},
{
"input": "10 10 3\n..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######..\n.#######..\n.####..###\n.......###",
"output": "..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######X.\n.#######XX\n.####..###\n.......###"
},
{
"input": "5 7 10\n..#....\n..#.#..\n.##.#..\n..#.#..\n....#..",
"output": "XX#....\nXX#.#..\nX##.#..\nXX#.#..\nXXX.#.."
},
{
"input": "5 7 10\n..#....\n..#.##.\n.##.##.\n..#.#..\n....#..",
"output": "XX#....\nXX#.##.\nX##.##.\nXX#.#..\nXXX.#.."
},
{
"input": "10 10 1\n##########\n##..##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########",
"output": "##########\n##.X##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########"
},
{
"input": "4 5 1\n.....\n.###.\n..#..\n..#..",
"output": ".....\n.###.\n..#..\n.X#.."
},
{
"input": "2 5 2\n###..\n###..",
"output": "###X.\n###X."
},
{
"input": "2 5 3\n.....\n..#..",
"output": "X....\nXX#.."
},
{
"input": "12 12 3\n############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######..#\n#.#######..#\n#.####..####\n#.......####\n############",
"output": "############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######X.#\n#.#######XX#\n#.####..####\n#.......####\n############"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n#####",
"output": ".....\n.##.X\n..###\n..###\n#####"
},
{
"input": "4 4 1\n....\n.#..\n..##\n..##",
"output": "....\n.#.X\n..##\n..##"
},
{
"input": "5 5 1\n....#\n.##..\n.##..\n...##\n...##",
"output": "....#\n.##..\n.##.X\n...##\n...##"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n..###",
"output": ".....\n.##.X\n..###\n..###\n..###"
},
{
"input": "4 5 1\n#....\n#.#..\n..###\n..###",
"output": "#....\n#.#.X\n..###\n..###"
},
{
"input": "4 4 3\n....\n.#..\n..##\n..##",
"output": "...X\n.#XX\n..##\n..##"
},
{
"input": "4 7 6\n.......\n....#..\n.##.#..\n....#..",
"output": "X......\nX...#..\nX##.#..\nXXX.#.."
},
{
"input": "8 8 7\n........\n.##.....\n.#######\n..######\n..######\n..######\n..######\n..######",
"output": ".....XXX\n.##.XXXX\n.#######\n..######\n..######\n..######\n..######\n..######"
}
] | 1,623,913,931 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 6 | 202 | 11,980,800 | dx = [-1,0,0,1,-1,-1,1,1]
dy = [0,-1,1,0,-1,1,-1,1]
k = 0
def check(arr,visited, x, y):
if x < 0 or y < 0 or y >= m or x >= n: return False
if arr[x][y] == "#": return False
if visited[x][y]: return False
return True
def dfs(arr, visited, x, y, path):
visited[x][y] = True
if arr[x][y] == ".":
path.append((x,y))
for i in range(4):
x1 = x + dx[i]
y1 = y + dy[i]
if check(arr, visited, x1, y1):
visited[x1][y1] = True
dfs(arr, visited, x1, y1,path)
if __name__ == "__main__":
n,m,k = map(int, input().split())
arr = [[] for _ in range(n)]
for i in range(n):
arr[i] = list(input())
visited = [[False for _ in range(m)] for _ in range(n)]
path = []
dfs(arr, visited, 0,0, path)
for i in range(len(path)-1, len(path)-k-1, -1):
x,y = path[i]
arr[x][y] = "X"
for i in range(n):
print("".join(x for x in arr[i])) | Title: Maze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall.
Output Specification:
Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them.
Demo Input:
['3 4 2\n#..#\n..#.\n#...\n', '5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n']
Demo Output:
['#.X#\nX.#.\n#...\n', '#XXX\n#X#.\nX#..\n...#\n.#.#\n']
Note:
none | ```python
dx = [-1,0,0,1,-1,-1,1,1]
dy = [0,-1,1,0,-1,1,-1,1]
k = 0
def check(arr,visited, x, y):
if x < 0 or y < 0 or y >= m or x >= n: return False
if arr[x][y] == "#": return False
if visited[x][y]: return False
return True
def dfs(arr, visited, x, y, path):
visited[x][y] = True
if arr[x][y] == ".":
path.append((x,y))
for i in range(4):
x1 = x + dx[i]
y1 = y + dy[i]
if check(arr, visited, x1, y1):
visited[x1][y1] = True
dfs(arr, visited, x1, y1,path)
if __name__ == "__main__":
n,m,k = map(int, input().split())
arr = [[] for _ in range(n)]
for i in range(n):
arr[i] = list(input())
visited = [[False for _ in range(m)] for _ in range(n)]
path = []
dfs(arr, visited, 0,0, path)
for i in range(len(path)-1, len(path)-k-1, -1):
x,y = path[i]
arr[x][y] = "X"
for i in range(n):
print("".join(x for x in arr[i]))
``` | -1 |
|
401 | C | Team | PROGRAMMING | 1,400 | [
"constructive algorithms",
"greedy",
"implementation"
] | null | null | Now it's time of Olympiads. Vanya and Egor decided to make his own team to take part in a programming Olympiad. They've been best friends ever since primary school and hopefully, that can somehow help them in teamwork.
For each team Olympiad, Vanya takes his play cards with numbers. He takes only the cards containing numbers 1 and 0. The boys are very superstitious. They think that they can do well at the Olympiad if they begin with laying all the cards in a row so that:
- there wouldn't be a pair of any side-adjacent cards with zeroes in a row; - there wouldn't be a group of three consecutive cards containing numbers one.
Today Vanya brought *n* cards with zeroes and *m* cards with numbers one. The number of cards was so much that the friends do not know how to put all those cards in the described way. Help them find the required arrangement of the cards or else tell the guys that it is impossible to arrange cards in such a way. | The first line contains two integers: *n* (1<=≤<=*n*<=≤<=106) — the number of cards containing number 0; *m* (1<=≤<=*m*<=≤<=106) — the number of cards containing number 1. | In a single line print the required sequence of zeroes and ones without any spaces. If such sequence is impossible to obtain, print -1. | [
"1 2\n",
"4 8\n",
"4 10\n",
"1 5\n"
] | [
"101\n",
"110110110101\n",
"11011011011011\n",
"-1\n"
] | none | 1,500 | [
{
"input": "1 2",
"output": "101"
},
{
"input": "4 8",
"output": "110110110101"
},
{
"input": "4 10",
"output": "11011011011011"
},
{
"input": "1 5",
"output": "-1"
},
{
"input": "3 4",
"output": "1010101"
},
{
"input": "3 10",
"output": "-1"
},
{
"input": "74 99",
"output": "11011011011011011011011011011011011011011011011011011011011011011011011010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101"
},
{
"input": "19 30",
"output": "1101101101101101101101101101101010101010101010101"
},
{
"input": "33 77",
"output": "-1"
},
{
"input": "3830 6966",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "1000000 1000000",
"output": "1010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101..."
},
{
"input": "1027 2030",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "4610 4609",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "3342 3339",
"output": "-1"
},
{
"input": "7757 7755",
"output": "-1"
},
{
"input": "10 8",
"output": "-1"
},
{
"input": "4247 8495",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "7101 14204",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "9801 19605",
"output": "-1"
},
{
"input": "4025 6858",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "7129 13245",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "8826 12432",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "6322 9256",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "8097 14682",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "6196 6197",
"output": "1010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101..."
},
{
"input": "1709 2902",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "455 512",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101..."
},
{
"input": "1781 1272",
"output": "-1"
},
{
"input": "3383 5670",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "954 1788",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "9481 15554",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "9079 100096",
"output": "-1"
},
{
"input": "481533 676709",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "423472 564888",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "227774 373297",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "42346 51898",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "739107 1000000",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "455043 798612",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "801460 801459",
"output": "0101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010101010..."
},
{
"input": "303498 503791",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "518822 597833",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "32342 64687",
"output": "-1"
},
{
"input": "873192 873189",
"output": "-1"
},
{
"input": "384870 450227",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "201106 208474",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "775338 980888",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "263338 393171",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "241043 330384",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "307203 614408",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "379310 417986",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "661101 785111",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "284634 319008",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "500000 1000000",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "499999 1000000",
"output": "1101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101101..."
},
{
"input": "3 1",
"output": "-1"
},
{
"input": "14124 242112",
"output": "-1"
},
{
"input": "2 1",
"output": "010"
},
{
"input": "2 3",
"output": "10101"
},
{
"input": "1 4",
"output": "11011"
},
{
"input": "2 6",
"output": "11011011"
},
{
"input": "2 5",
"output": "1101101"
},
{
"input": "2 4",
"output": "110101"
},
{
"input": "2 3",
"output": "10101"
},
{
"input": "2 2",
"output": "1010"
},
{
"input": "2 1",
"output": "010"
},
{
"input": "1 1",
"output": "10"
},
{
"input": "1 3",
"output": "1101"
},
{
"input": "3 2",
"output": "01010"
},
{
"input": "5 4",
"output": "010101010"
},
{
"input": "4 3",
"output": "0101010"
},
{
"input": "11 10",
"output": "010101010101010101010"
},
{
"input": "8 7",
"output": "010101010101010"
},
{
"input": "4 2",
"output": "-1"
},
{
"input": "6 5",
"output": "01010101010"
},
{
"input": "3 7",
"output": "1101101101"
},
{
"input": "5 1",
"output": "-1"
},
{
"input": "10 1",
"output": "-1"
},
{
"input": "4 9",
"output": "1101101101101"
},
{
"input": "6 4",
"output": "-1"
},
{
"input": "12 10",
"output": "-1"
},
{
"input": "4 100",
"output": "-1"
}
] | 1,659,454,036 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 4 | 62 | 0 | n1,n2=map(int,input().split())
l1=[0]*n1;l2=[1]*n2
if n1-n2>1 or n2>n1*2+2:
print (-1);exit()
if n2>n1*2:print(('110'*n1)+'1'*((n2-n1*2)));exit()
if n2==n1*2:print(('110'*n1)+'1'*((n2-n1)-n1));exit()
if n1==n2:print('10'*n1);exit()
| Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Now it's time of Olympiads. Vanya and Egor decided to make his own team to take part in a programming Olympiad. They've been best friends ever since primary school and hopefully, that can somehow help them in teamwork.
For each team Olympiad, Vanya takes his play cards with numbers. He takes only the cards containing numbers 1 and 0. The boys are very superstitious. They think that they can do well at the Olympiad if they begin with laying all the cards in a row so that:
- there wouldn't be a pair of any side-adjacent cards with zeroes in a row; - there wouldn't be a group of three consecutive cards containing numbers one.
Today Vanya brought *n* cards with zeroes and *m* cards with numbers one. The number of cards was so much that the friends do not know how to put all those cards in the described way. Help them find the required arrangement of the cards or else tell the guys that it is impossible to arrange cards in such a way.
Input Specification:
The first line contains two integers: *n* (1<=≤<=*n*<=≤<=106) — the number of cards containing number 0; *m* (1<=≤<=*m*<=≤<=106) — the number of cards containing number 1.
Output Specification:
In a single line print the required sequence of zeroes and ones without any spaces. If such sequence is impossible to obtain, print -1.
Demo Input:
['1 2\n', '4 8\n', '4 10\n', '1 5\n']
Demo Output:
['101\n', '110110110101\n', '11011011011011\n', '-1\n']
Note:
none | ```python
n1,n2=map(int,input().split())
l1=[0]*n1;l2=[1]*n2
if n1-n2>1 or n2>n1*2+2:
print (-1);exit()
if n2>n1*2:print(('110'*n1)+'1'*((n2-n1*2)));exit()
if n2==n1*2:print(('110'*n1)+'1'*((n2-n1)-n1));exit()
if n1==n2:print('10'*n1);exit()
``` | 0 |
|
641 | F | Little Artem and 2-SAT | PROGRAMMING | 3,000 | [] | null | null | Little Artem is a very smart programmer. He knows many different difficult algorithms. Recently he has mastered in 2-SAT one.
In computer science, 2-satisfiability (abbreviated as 2-SAT) is the special case of the problem of determining whether a conjunction (logical AND) of disjunctions (logical OR) have a solution, in which all disjunctions consist of no more than two arguments (variables). For the purpose of this problem we consider only 2-SAT formulas where each disjunction consists of exactly two arguments.
Consider the following 2-SAT problem as an example: . Note that there might be negations in 2-SAT formula (like for *x*1 and for *x*4).
Artem now tries to solve as many problems with 2-SAT as possible. He found a very interesting one, which he can not solve yet. Of course, he asks you to help him.
The problem is: given two 2-SAT formulas *f* and *g*, determine whether their sets of possible solutions are the same. Otherwise, find any variables assignment *x* such that *f*(*x*)<=≠<=*g*(*x*). | The first line of the input contains three integers *n*, *m*1 and *m*2 (1<=≤<=*n*<=≤<=1000, 1<=≤<=*m*1,<=*m*2<=≤<=*n*2) — the number of variables, the number of disjunctions in the first formula and the number of disjunctions in the second formula, respectively.
Next *m*1 lines contains the description of 2-SAT formula *f*. The description consists of exactly *m*1 pairs of integers *x**i* (<=-<=*n*<=≤<=*x**i*<=≤<=*n*,<=*x**i*<=≠<=0) each on separate line, where *x**i*<=><=0 corresponds to the variable without negation, while *x**i*<=<<=0 corresponds to the variable with negation. Each pair gives a single disjunction. Next *m*2 lines contains formula *g* in the similar format. | If both formulas share the same set of solutions, output a single word "SIMILAR" (without quotes). Otherwise output exactly *n* integers *x**i* () — any set of values *x* such that *f*(*x*)<=≠<=*g*(*x*). | [
"2 1 1\n1 2\n1 2\n",
"2 1 1\n1 2\n1 -2\n"
] | [
"SIMILAR\n",
"0 0 \n"
] | First sample has two equal formulas, so they are similar by definition.
In second sample if we compute first function with *x*<sub class="lower-index">1</sub> = 0 and *x*<sub class="lower-index">2</sub> = 0 we get the result 0, because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/82cbca427149bc7516804c97b5963cbfddd08900.png" style="max-width: 100.0%;max-height: 100.0%;"/>. But the second formula is 1, because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c8a53f3cfcb77e8a34515ff1420d44e5e2c3db0b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 3,000 | [] | 1,689,420,975 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 46 | 0 | print("_RANDOM_GUESS_1689420975.2080457")# 1689420975.2080696 | Title: Little Artem and 2-SAT
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Artem is a very smart programmer. He knows many different difficult algorithms. Recently he has mastered in 2-SAT one.
In computer science, 2-satisfiability (abbreviated as 2-SAT) is the special case of the problem of determining whether a conjunction (logical AND) of disjunctions (logical OR) have a solution, in which all disjunctions consist of no more than two arguments (variables). For the purpose of this problem we consider only 2-SAT formulas where each disjunction consists of exactly two arguments.
Consider the following 2-SAT problem as an example: . Note that there might be negations in 2-SAT formula (like for *x*1 and for *x*4).
Artem now tries to solve as many problems with 2-SAT as possible. He found a very interesting one, which he can not solve yet. Of course, he asks you to help him.
The problem is: given two 2-SAT formulas *f* and *g*, determine whether their sets of possible solutions are the same. Otherwise, find any variables assignment *x* such that *f*(*x*)<=≠<=*g*(*x*).
Input Specification:
The first line of the input contains three integers *n*, *m*1 and *m*2 (1<=≤<=*n*<=≤<=1000, 1<=≤<=*m*1,<=*m*2<=≤<=*n*2) — the number of variables, the number of disjunctions in the first formula and the number of disjunctions in the second formula, respectively.
Next *m*1 lines contains the description of 2-SAT formula *f*. The description consists of exactly *m*1 pairs of integers *x**i* (<=-<=*n*<=≤<=*x**i*<=≤<=*n*,<=*x**i*<=≠<=0) each on separate line, where *x**i*<=><=0 corresponds to the variable without negation, while *x**i*<=<<=0 corresponds to the variable with negation. Each pair gives a single disjunction. Next *m*2 lines contains formula *g* in the similar format.
Output Specification:
If both formulas share the same set of solutions, output a single word "SIMILAR" (without quotes). Otherwise output exactly *n* integers *x**i* () — any set of values *x* such that *f*(*x*)<=≠<=*g*(*x*).
Demo Input:
['2 1 1\n1 2\n1 2\n', '2 1 1\n1 2\n1 -2\n']
Demo Output:
['SIMILAR\n', '0 0 \n']
Note:
First sample has two equal formulas, so they are similar by definition.
In second sample if we compute first function with *x*<sub class="lower-index">1</sub> = 0 and *x*<sub class="lower-index">2</sub> = 0 we get the result 0, because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/82cbca427149bc7516804c97b5963cbfddd08900.png" style="max-width: 100.0%;max-height: 100.0%;"/>. But the second formula is 1, because <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c8a53f3cfcb77e8a34515ff1420d44e5e2c3db0b.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
print("_RANDOM_GUESS_1689420975.2080457")# 1689420975.2080696
``` | 0 |
|
385 | B | Bear and Strings | PROGRAMMING | 1,200 | [
"brute force",
"greedy",
"implementation",
"math",
"strings"
] | null | null | The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem. | The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters. | Print a single number — the answer to the problem. | [
"bearbtear\n",
"bearaabearc\n"
] | [
"6\n",
"20\n"
] | In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | 1,000 | [
{
"input": "bearbtear",
"output": "6"
},
{
"input": "bearaabearc",
"output": "20"
},
{
"input": "pbearbearhbearzqbearjkterasjhy",
"output": "291"
},
{
"input": "pbearjbearbebearnbabcffbearbearwubearjezpiorrbearbearjbdlbearbearqbearjbearwipmsbearoaftrsebearzsnqb",
"output": "4419"
},
{
"input": "bear",
"output": "1"
},
{
"input": "a",
"output": "0"
},
{
"input": "be",
"output": "0"
}
] | 1,590,474,434 | 2,147,483,647 | Python 3 | OK | TESTS | 43 | 124 | 0 | s=input()
if len(s) < 4: print(0)
else:
a=0
for i in range(len(s)):
d=s.find("bear", i)
if d>=0: a+=len(s)-d-3
print(a) | Title: Bear and Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
Input Specification:
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['bearbtear\n', 'bearaabearc\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | ```python
s=input()
if len(s) < 4: print(0)
else:
a=0
for i in range(len(s)):
d=s.find("bear", i)
if d>=0: a+=len(s)-d-3
print(a)
``` | 3 |
|
495 | B | Modular Equations | PROGRAMMING | 1,600 | [
"math",
"number theory"
] | null | null | Last week, Hamed learned about a new type of equations in his math class called Modular Equations. Lets define *i* modulo *j* as the remainder of division of *i* by *j* and denote it by . A Modular Equation, as Hamed's teacher described, is an equation of the form in which *a* and *b* are two non-negative integers and *x* is a variable. We call a positive integer *x* for which a solution of our equation.
Hamed didn't pay much attention to the class since he was watching a movie. He only managed to understand the definitions of these equations.
Now he wants to write his math exercises but since he has no idea how to do that, he asked you for help. He has told you all he knows about Modular Equations and asked you to write a program which given two numbers *a* and *b* determines how many answers the Modular Equation has. | In the only line of the input two space-separated integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=109) are given. | If there is an infinite number of answers to our equation, print "infinity" (without the quotes). Otherwise print the number of solutions of the Modular Equation . | [
"21 5\n",
"9435152 272\n",
"10 10\n"
] | [
"2\n",
"282\n",
"infinity\n"
] | In the first sample the answers of the Modular Equation are 8 and 16 since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6f5ff39ebd209bf990adaf91f4b82f9687097224.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 1,000 | [
{
"input": "21 5",
"output": "2"
},
{
"input": "9435152 272",
"output": "282"
},
{
"input": "10 10",
"output": "infinity"
},
{
"input": "0 1000000000",
"output": "0"
},
{
"input": "11 2",
"output": "2"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "0 0",
"output": "infinity"
},
{
"input": "121 0",
"output": "3"
},
{
"input": "772930485 686893955",
"output": "0"
},
{
"input": "257424 24",
"output": "127"
},
{
"input": "295138437 589952171",
"output": "0"
},
{
"input": "223093836 966",
"output": "399"
},
{
"input": "233758336 10665466",
"output": "13"
},
{
"input": "223092887 17",
"output": "500"
},
{
"input": "223094728 1858",
"output": "371"
},
{
"input": "223092899 29",
"output": "495"
},
{
"input": "997920 0",
"output": "240"
},
{
"input": "887043 3",
"output": "213"
},
{
"input": "124 24",
"output": "3"
},
{
"input": "982901 101",
"output": "193"
},
{
"input": "357987 35",
"output": "45"
},
{
"input": "954374 1030",
"output": "32"
},
{
"input": "49106 46",
"output": "15"
},
{
"input": "325508499 119510657",
"output": "1"
},
{
"input": "89768760 885778845",
"output": "0"
},
{
"input": "944387968 700818251",
"output": "0"
},
{
"input": "12 3",
"output": "1"
},
{
"input": "1000000000 1",
"output": "19"
},
{
"input": "923456789 3",
"output": "14"
},
{
"input": "1000000000 6",
"output": "6"
},
{
"input": "1000000000 333333300",
"output": "2"
},
{
"input": "5 2",
"output": "1"
},
{
"input": "1 10",
"output": "0"
},
{
"input": "15 3",
"output": "3"
},
{
"input": "2 0",
"output": "2"
},
{
"input": "77 75",
"output": "0"
},
{
"input": "1000000000 1000000000",
"output": "infinity"
}
] | 1,614,867,906 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 3 | 78 | 2,150,400 | import math
def printDivisors(n):
i = 1
l=[]
c=0
while i <= math.sqrt(n):
if (n % i == 0):
if (n / i == i):
l.append(i)
c+=1
else:
l.append(i)
l.append(n//i)
c+=2
i = i + 1
return l,c
a,b=map(int,input().split())
if a==b:
print('infinity')
else:
l,c=printDivisors(a-b)
ans=0
for p in l:
if p<b:
ans+=1
print(c-ans)
| Title: Modular Equations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Last week, Hamed learned about a new type of equations in his math class called Modular Equations. Lets define *i* modulo *j* as the remainder of division of *i* by *j* and denote it by . A Modular Equation, as Hamed's teacher described, is an equation of the form in which *a* and *b* are two non-negative integers and *x* is a variable. We call a positive integer *x* for which a solution of our equation.
Hamed didn't pay much attention to the class since he was watching a movie. He only managed to understand the definitions of these equations.
Now he wants to write his math exercises but since he has no idea how to do that, he asked you for help. He has told you all he knows about Modular Equations and asked you to write a program which given two numbers *a* and *b* determines how many answers the Modular Equation has.
Input Specification:
In the only line of the input two space-separated integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=109) are given.
Output Specification:
If there is an infinite number of answers to our equation, print "infinity" (without the quotes). Otherwise print the number of solutions of the Modular Equation .
Demo Input:
['21 5\n', '9435152 272\n', '10 10\n']
Demo Output:
['2\n', '282\n', 'infinity\n']
Note:
In the first sample the answers of the Modular Equation are 8 and 16 since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6f5ff39ebd209bf990adaf91f4b82f9687097224.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
import math
def printDivisors(n):
i = 1
l=[]
c=0
while i <= math.sqrt(n):
if (n % i == 0):
if (n / i == i):
l.append(i)
c+=1
else:
l.append(i)
l.append(n//i)
c+=2
i = i + 1
return l,c
a,b=map(int,input().split())
if a==b:
print('infinity')
else:
l,c=printDivisors(a-b)
ans=0
for p in l:
if p<b:
ans+=1
print(c-ans)
``` | -1 |
|
659 | C | Tanya and Toys | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | null | null | In Berland recently a new collection of toys went on sale. This collection consists of 109 types of toys, numbered with integers from 1 to 109. A toy from the new collection of the *i*-th type costs *i* bourles.
Tania has managed to collect *n* different types of toys *a*1,<=*a*2,<=...,<=*a**n* from the new collection. Today is Tanya's birthday, and her mother decided to spend no more than *m* bourles on the gift to the daughter. Tanya will choose several different types of toys from the new collection as a gift. Of course, she does not want to get a type of toy which she already has.
Tanya wants to have as many distinct types of toys in her collection as possible as the result. The new collection is too diverse, and Tanya is too little, so she asks you to help her in this. | The first line contains two integers *n* (1<=≤<=*n*<=≤<=100<=000) and *m* (1<=≤<=*m*<=≤<=109) — the number of types of toys that Tanya already has and the number of bourles that her mom is willing to spend on buying new toys.
The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the types of toys that Tanya already has. | In the first line print a single integer *k* — the number of different types of toys that Tanya should choose so that the number of different types of toys in her collection is maximum possible. Of course, the total cost of the selected toys should not exceed *m*.
In the second line print *k* distinct space-separated integers *t*1,<=*t*2,<=...,<=*t**k* (1<=≤<=*t**i*<=≤<=109) — the types of toys that Tanya should choose.
If there are multiple answers, you may print any of them. Values of *t**i* can be printed in any order. | [
"3 7\n1 3 4\n",
"4 14\n4 6 12 8\n"
] | [
"2\n2 5 \n",
"4\n7 2 3 1\n"
] | In the first sample mom should buy two toys: one toy of the 2-nd type and one toy of the 5-th type. At any other purchase for 7 bourles (assuming that the toys of types 1, 3 and 4 have already been bought), it is impossible to buy two and more toys. | 1,000 | [
{
"input": "3 7\n1 3 4",
"output": "2\n2 5 "
},
{
"input": "4 14\n4 6 12 8",
"output": "4\n1 2 3 5 "
},
{
"input": "5 6\n97746 64770 31551 96547 65684",
"output": "3\n1 2 3 "
},
{
"input": "10 10\n94125 56116 29758 94024 29289 31663 99794 35076 25328 58656",
"output": "4\n1 2 3 4 "
},
{
"input": "30 38\n9560 64176 75619 53112 54160 68775 12655 13118 99502 89757 78434 42521 19210 1927 34097 5416 56110 44786 59126 44266 79240 65567 54602 25325 37171 2879 89291 89121 39568 28162",
"output": "8\n1 2 3 4 5 6 7 8 "
},
{
"input": "1 999999298\n85187",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 999999119\n34421",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n1",
"output": "44719\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "1 1000000000\n44720",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n44719",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "1 1000000000\n44721",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "3 1000000000\n123456789 234567891 345678912",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "2 5\n999999999 1000000000",
"output": "2\n1 2 "
},
{
"input": "2 1000000000\n1 1000000000",
"output": "44719\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "3 100000\n1000000000 100000000 1",
"output": "445\n2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 ..."
},
{
"input": "5 5\n100000000 200000000 300000000 400000000 1000000000",
"output": "2\n1 2 "
},
{
"input": "6 3\n1 2 3 4 5 6",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "1 1000000000\n1000000000",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "5 1000000\n1000000000 100000000 10000000 99999999 123456789",
"output": "1413\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "2 10000000\n1234567 123456",
"output": "4471\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "1 1\n1000000000",
"output": "1\n1 "
},
{
"input": "1 1000000000\n9999999",
"output": "44720\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 ..."
},
{
"input": "5 10000\n1000000000 888888888 777777777 666666666 959595959",
"output": "140\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 "
},
{
"input": "3 1\n1000000000 999999999 999999998",
"output": "1\n1 "
},
{
"input": "5 100000000\n100000000 999999999 1 2 3",
"output": "14138\n4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 15..."
},
{
"input": "3 55\n100000000 1000000000 999999999",
"output": "10\n1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "2 10\n5 10000009",
"output": "4\n1 2 3 4 "
},
{
"input": "3 10000000\n999999999 999999998 999999997",
"output": "4471\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "1 1100\n1000000000",
"output": "46\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 "
},
{
"input": "1 40\n1000000000",
"output": "8\n1 2 3 4 5 6 7 8 "
}
] | 1,687,956,061 | 2,147,483,647 | Python 3 | OK | TESTS | 61 | 140 | 18,534,400 | n, m = map(int, input().split())
a = set(map(int, input().split()))
types = set()
curr_type= 1
while m > 0 and curr_type < 10 ** 9:
if curr_type not in a:
if m - curr_type >= 0:
m = m - curr_type
types.add(curr_type)
else:
break
curr_type += 1
print(len(types))
print(*types) | Title: Tanya and Toys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland recently a new collection of toys went on sale. This collection consists of 109 types of toys, numbered with integers from 1 to 109. A toy from the new collection of the *i*-th type costs *i* bourles.
Tania has managed to collect *n* different types of toys *a*1,<=*a*2,<=...,<=*a**n* from the new collection. Today is Tanya's birthday, and her mother decided to spend no more than *m* bourles on the gift to the daughter. Tanya will choose several different types of toys from the new collection as a gift. Of course, she does not want to get a type of toy which she already has.
Tanya wants to have as many distinct types of toys in her collection as possible as the result. The new collection is too diverse, and Tanya is too little, so she asks you to help her in this.
Input Specification:
The first line contains two integers *n* (1<=≤<=*n*<=≤<=100<=000) and *m* (1<=≤<=*m*<=≤<=109) — the number of types of toys that Tanya already has and the number of bourles that her mom is willing to spend on buying new toys.
The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the types of toys that Tanya already has.
Output Specification:
In the first line print a single integer *k* — the number of different types of toys that Tanya should choose so that the number of different types of toys in her collection is maximum possible. Of course, the total cost of the selected toys should not exceed *m*.
In the second line print *k* distinct space-separated integers *t*1,<=*t*2,<=...,<=*t**k* (1<=≤<=*t**i*<=≤<=109) — the types of toys that Tanya should choose.
If there are multiple answers, you may print any of them. Values of *t**i* can be printed in any order.
Demo Input:
['3 7\n1 3 4\n', '4 14\n4 6 12 8\n']
Demo Output:
['2\n2 5 \n', '4\n7 2 3 1\n']
Note:
In the first sample mom should buy two toys: one toy of the 2-nd type and one toy of the 5-th type. At any other purchase for 7 bourles (assuming that the toys of types 1, 3 and 4 have already been bought), it is impossible to buy two and more toys. | ```python
n, m = map(int, input().split())
a = set(map(int, input().split()))
types = set()
curr_type= 1
while m > 0 and curr_type < 10 ** 9:
if curr_type not in a:
if m - curr_type >= 0:
m = m - curr_type
types.add(curr_type)
else:
break
curr_type += 1
print(len(types))
print(*types)
``` | 3 |
|
80 | A | Panoramix's Prediction | PROGRAMMING | 800 | [
"brute force"
] | A. Panoramix's Prediction | 2 | 256 | A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix? | The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4. | Print YES, if *m* is the next prime number after *n*, or NO otherwise. | [
"3 5\n",
"7 11\n",
"7 9\n"
] | [
"YES",
"YES",
"NO"
] | none | 500 | [
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,623,177,629 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 39 | 310 | 0 | n,m = map(int,input().split())
arr=[2,3,5,7,11,13,17,19,23,29,31,37,41,43,47]
for i in range(len(arr)):
if arr[i]>n:
if arr[i]==m:
# print(arr[i])
print("YES")
break
else:
print("NO")
break | Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none | ```python
n,m = map(int,input().split())
arr=[2,3,5,7,11,13,17,19,23,29,31,37,41,43,47]
for i in range(len(arr)):
if arr[i]>n:
if arr[i]==m:
# print(arr[i])
print("YES")
break
else:
print("NO")
break
``` | 0 |
716 | A | Crazy Computer | PROGRAMMING | 800 | [
"implementation"
] | null | null | ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. | The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. | Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. | [
"6 5\n1 3 8 14 19 20\n",
"6 1\n1 3 5 7 9 10\n"
] | [
"3",
"2"
] | The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1. | 500 | [
{
"input": "6 5\n1 3 8 14 19 20",
"output": "3"
},
{
"input": "6 1\n1 3 5 7 9 10",
"output": "2"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 7 12 13 14",
"output": "4"
},
{
"input": "2 1000000000\n1 1000000000",
"output": "2"
},
{
"input": "3 5\n1 10 20",
"output": "1"
},
{
"input": "3 10\n1 2 3",
"output": "3"
},
{
"input": "2 1\n1 100",
"output": "1"
},
{
"input": "3 1\n1 2 10",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
}
] | 1,641,299,375 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 46 | 0 | ''' #1
n = int(input())
lst = [int(i) for i in input().split()]
max_res = lst[0]
min_res = lst[0]
k = 0
for i in range(len(lst)):
if lst[i] > max_res:
k += 1
max_res = lst[i]
if lst[i] < min_res:
k += 1
min_res = lst[i]
print(k)
#2
n = int(input())
lst = [int(i) for i in input().split()]
max_res = max(lst)
kol = 0
for i in range(len(lst)):
kol += max_res - lst[i]
print(kol)
'''
n, c = map(int, input().split())
lst = [int(i) for i in input().split()]
k = 0
for i in range(1, len(lst)):
if lst[i] - lst[i - 1] <= c:
k += 1
elif lst[i] - lst[i - 1] > c:
k = 1
print(k)
| Title: Crazy Computer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Output Specification:
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
Demo Input:
['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n']
Demo Output:
['3', '2']
Note:
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1. | ```python
''' #1
n = int(input())
lst = [int(i) for i in input().split()]
max_res = lst[0]
min_res = lst[0]
k = 0
for i in range(len(lst)):
if lst[i] > max_res:
k += 1
max_res = lst[i]
if lst[i] < min_res:
k += 1
min_res = lst[i]
print(k)
#2
n = int(input())
lst = [int(i) for i in input().split()]
max_res = max(lst)
kol = 0
for i in range(len(lst)):
kol += max_res - lst[i]
print(kol)
'''
n, c = map(int, input().split())
lst = [int(i) for i in input().split()]
k = 0
for i in range(1, len(lst)):
if lst[i] - lst[i - 1] <= c:
k += 1
elif lst[i] - lst[i - 1] > c:
k = 1
print(k)
``` | 0 |
|
320 | A | Magic Numbers | PROGRAMMING | 900 | [
"brute force",
"greedy"
] | null | null | A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not. | The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros. | Print "YES" if *n* is a magic number or print "NO" if it's not. | [
"114114\n",
"1111\n",
"441231\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "114114",
"output": "YES"
},
{
"input": "1111",
"output": "YES"
},
{
"input": "441231",
"output": "NO"
},
{
"input": "1",
"output": "YES"
},
{
"input": "14",
"output": "YES"
},
{
"input": "114",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "414",
"output": "NO"
},
{
"input": "1000000000",
"output": "NO"
},
{
"input": "144144144",
"output": "YES"
},
{
"input": "1444",
"output": "NO"
},
{
"input": "11",
"output": "YES"
},
{
"input": "141414141",
"output": "YES"
},
{
"input": "11110111",
"output": "NO"
},
{
"input": "114114144",
"output": "YES"
},
{
"input": "444",
"output": "NO"
},
{
"input": "9999",
"output": "NO"
},
{
"input": "111444",
"output": "NO"
},
{
"input": "11114",
"output": "YES"
},
{
"input": "41111",
"output": "NO"
},
{
"input": "114414441",
"output": "NO"
},
{
"input": "144414441",
"output": "NO"
},
{
"input": "144244144",
"output": "NO"
},
{
"input": "111111111",
"output": "YES"
},
{
"input": "144444444",
"output": "NO"
},
{
"input": "444444444",
"output": "NO"
},
{
"input": "141441441",
"output": "YES"
},
{
"input": "441",
"output": "NO"
},
{
"input": "15",
"output": "NO"
},
{
"input": "14444",
"output": "NO"
},
{
"input": "11444",
"output": "NO"
},
{
"input": "144",
"output": "YES"
},
{
"input": "1414414",
"output": "YES"
},
{
"input": "141444",
"output": "NO"
},
{
"input": "14144",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "1144",
"output": "YES"
},
{
"input": "141111444",
"output": "NO"
},
{
"input": "14414414",
"output": "YES"
},
{
"input": "141414144",
"output": "YES"
},
{
"input": "1414",
"output": "YES"
},
{
"input": "1441",
"output": "YES"
},
{
"input": "12",
"output": "NO"
},
{
"input": "144144141",
"output": "YES"
},
{
"input": "144144",
"output": "YES"
},
{
"input": "14414411",
"output": "YES"
},
{
"input": "14414",
"output": "YES"
}
] | 1,667,597,257 | 2,147,483,647 | PyPy 3-64 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <iostream>
#include <vector>
using namespace std;
int main() {
string v;
cin >> v;
for (int i=0; i<v.size() ; i++){
// cout << "i="<<i<< endl;
// cout << v[i] << endl;
// cout << v[i+1] << endl;
// cout << v[i+2] << endl;
if (v[i]=='1'){
//cout << "inside if"<<endl;
if (v[i+1]=='4' && v[i+2]=='4'){
i+=2;
}
else if (v[i+1]=='4'){
//cout << "before i="<<i<< endl;
i++;
//cout << "after i="<<i<< endl;
}
}
else{
cout << "NO";
return 0;
}
}
cout << "YES";
return 0;
} | Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
Input Specification:
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Output Specification:
Print "YES" if *n* is a magic number or print "NO" if it's not.
Demo Input:
['114114\n', '1111\n', '441231\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none | ```python
#include <iostream>
#include <vector>
using namespace std;
int main() {
string v;
cin >> v;
for (int i=0; i<v.size() ; i++){
// cout << "i="<<i<< endl;
// cout << v[i] << endl;
// cout << v[i+1] << endl;
// cout << v[i+2] << endl;
if (v[i]=='1'){
//cout << "inside if"<<endl;
if (v[i+1]=='4' && v[i+2]=='4'){
i+=2;
}
else if (v[i+1]=='4'){
//cout << "before i="<<i<< endl;
i++;
//cout << "after i="<<i<< endl;
}
}
else{
cout << "NO";
return 0;
}
}
cout << "YES";
return 0;
}
``` | -1 |
|
270 | A | Fancy Fence | PROGRAMMING | 1,100 | [
"geometry",
"implementation",
"math"
] | null | null | Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? | The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees. | For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. | [
"3\n30\n60\n90\n"
] | [
"NO\nYES\nYES\n"
] | In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | 500 | [
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,632,813,106 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 92 | 6,963,200 | t = int(input())
ans = []
ret = 0
for i in range(t):
a = int(input())
for j in range(int(2 / (180 / a - 1) - 1), int(2 / (180 / a - 1) + 2), 1):
if 180 * j / (j + 2) == a:
ret = 1
if ret == 1:
ans.append("YES")
else:
ans.append("NO")
for i in ans:
print(i)
| Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | ```python
t = int(input())
ans = []
ret = 0
for i in range(t):
a = int(input())
for j in range(int(2 / (180 / a - 1) - 1), int(2 / (180 / a - 1) + 2), 1):
if 180 * j / (j + 2) == a:
ret = 1
if ret == 1:
ans.append("YES")
else:
ans.append("NO")
for i in ans:
print(i)
``` | 0 |
|
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
] | A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
] | [
"4\n"
] | none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,660,399,738 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 30 | 0 | n,m,a=list(map(int,input().strip().split()))
count=0
if n%a==0:
count=count+n//a
else:
count=count+n//a+1
if m%a==0:
count=count+m//a
else:
count=count+m//a+1
print(count)
| Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
n,m,a=list(map(int,input().strip().split()))
count=0
if n%a==0:
count=count+n//a
else:
count=count+n//a+1
if m%a==0:
count=count+m//a
else:
count=count+m//a+1
print(count)
``` | 0 |
459 | B | Pashmak and Flowers | PROGRAMMING | 1,300 | [
"combinatorics",
"implementation",
"sortings"
] | null | null | Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way. | The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109). | The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively. | [
"2\n1 2\n",
"3\n1 4 5\n",
"5\n3 1 2 3 1\n"
] | [
"1 1",
"4 1",
"2 4"
] | In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers. | 500 | [
{
"input": "2\n1 2",
"output": "1 1"
},
{
"input": "3\n1 4 5",
"output": "4 1"
},
{
"input": "5\n3 1 2 3 1",
"output": "2 4"
},
{
"input": "2\n1 1",
"output": "0 1"
},
{
"input": "3\n1 1 1",
"output": "0 3"
},
{
"input": "4\n1 1 1 1",
"output": "0 6"
},
{
"input": "5\n1 1 1 1 1",
"output": "0 10"
},
{
"input": "5\n2 2 2 2 2",
"output": "0 10"
},
{
"input": "10\n2 2 2 2 2 2 2 2 2 2",
"output": "0 45"
},
{
"input": "3\n2 2 2",
"output": "0 3"
},
{
"input": "3\n3 3 3",
"output": "0 3"
},
{
"input": "2\n10000000 100000000",
"output": "90000000 1"
},
{
"input": "5\n5 5 5 5 5",
"output": "0 10"
},
{
"input": "5\n3 3 3 3 3",
"output": "0 10"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "0 15"
},
{
"input": "2\n5 6",
"output": "1 1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0 45"
},
{
"input": "10\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "0 45"
},
{
"input": "4\n4 4 4 4",
"output": "0 6"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "0 21"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 1 1",
"output": "0 55"
},
{
"input": "8\n8 8 8 8 8 8 8 8",
"output": "0 28"
},
{
"input": "2\n3 2",
"output": "1 1"
}
] | 1,674,659,978 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 3 | 1,000 | 9,830,400 | n=int(input())
l1=[int(i)for i in input().split()]
b=max(l1)-min(l1)
c=0
for i in range(len(l1)):
for j in range(i+1,len(l1)):
if(abs(l1[i]-l1[j])==b):
c+=1
print(b,c) | Title: Pashmak and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way.
Input Specification:
The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109).
Output Specification:
The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively.
Demo Input:
['2\n1 2\n', '3\n1 4 5\n', '5\n3 1 2 3 1\n']
Demo Output:
['1 1', '4 1', '2 4']
Note:
In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers. | ```python
n=int(input())
l1=[int(i)for i in input().split()]
b=max(l1)-min(l1)
c=0
for i in range(len(l1)):
for j in range(i+1,len(l1)):
if(abs(l1[i]-l1[j])==b):
c+=1
print(b,c)
``` | 0 |
|
807 | A | Is it rated? | PROGRAMMING | 900 | [
"implementation",
"sortings"
] | null | null | Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings. | If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe". | [
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] | [
"rated\n",
"unrated\n",
"maybe\n"
] | In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | 500 | [
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,564,040,065 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 108 | 0 | n = int(input())
t = []
for i in range(n):
a, b = map(int, input().split())
if a - b != 0:
print('rated')
exit()
else:
t.append(a)
if min(t) != a:
print('unrated')
exit()
print('maybe')
# CodeForcesian
# ♥
# سرمایه گذاری بر روی دانش بیشترین بهره را دارد
| Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | ```python
n = int(input())
t = []
for i in range(n):
a, b = map(int, input().split())
if a - b != 0:
print('rated')
exit()
else:
t.append(a)
if min(t) != a:
print('unrated')
exit()
print('maybe')
# CodeForcesian
# ♥
# سرمایه گذاری بر روی دانش بیشترین بهره را دارد
``` | 0 |
|
592 | C | The Big Race | PROGRAMMING | 1,800 | [
"math"
] | null | null | Vector Willman and Array Bolt are the two most famous athletes of Byteforces. They are going to compete in a race with a distance of *L* meters today.
Willman and Bolt have exactly the same speed, so when they compete the result is always a tie. That is a problem for the organizers because they want a winner.
While watching previous races the organizers have noticed that Willman can perform only steps of length equal to *w* meters, and Bolt can perform only steps of length equal to *b* meters. Organizers decided to slightly change the rules of the race. Now, at the end of the racetrack there will be an abyss, and the winner will be declared the athlete, who manages to run farther from the starting point of the the racetrack (which is not the subject to change by any of the athletes).
Note that none of the athletes can run infinitely far, as they both will at some moment of time face the point, such that only one step further will cause them to fall in the abyss. In other words, the athlete will not fall into the abyss if the total length of all his steps will be less or equal to the chosen distance *L*.
Since the organizers are very fair, the are going to set the length of the racetrack as an integer chosen randomly and uniformly in range from 1 to *t* (both are included). What is the probability that Willman and Bolt tie again today? | The first line of the input contains three integers *t*, *w* and *b* (1<=≤<=*t*,<=*w*,<=*b*<=≤<=5·1018) — the maximum possible length of the racetrack, the length of Willman's steps and the length of Bolt's steps respectively. | Print the answer to the problem as an irreducible fraction . Follow the format of the samples output.
The fraction (*p* and *q* are integers, and both *p*<=≥<=0 and *q*<=><=0 holds) is called irreducible, if there is no such integer *d*<=><=1, that both *p* and *q* are divisible by *d*. | [
"10 3 2\n",
"7 1 2\n"
] | [
"3/10\n",
"3/7\n"
] | In the first sample Willman and Bolt will tie in case 1, 6 or 7 are chosen as the length of the racetrack. | 1,500 | [
{
"input": "10 3 2",
"output": "3/10"
},
{
"input": "7 1 2",
"output": "3/7"
},
{
"input": "1 1 1",
"output": "1/1"
},
{
"input": "5814 31 7",
"output": "94/2907"
},
{
"input": "94268 813 766",
"output": "765/94268"
},
{
"input": "262610 5583 4717",
"output": "2358/131305"
},
{
"input": "3898439 96326 71937",
"output": "71936/3898439"
},
{
"input": "257593781689876390 32561717 4411677",
"output": "7914548537/257593781689876390"
},
{
"input": "111319886766128339 7862842484895022 3003994959686829",
"output": "3003994959686828/111319886766128339"
},
{
"input": "413850294331656955 570110918058849723 409853735661743839",
"output": "409853735661743838/413850294331656955"
},
{
"input": "3000000000000000000 2999999999999999873 2999999999999999977",
"output": "23437499999999999/23437500000000000"
},
{
"input": "9 6 1",
"output": "1/9"
},
{
"input": "32 9 2",
"output": "3/32"
},
{
"input": "976 5 6",
"output": "41/244"
},
{
"input": "5814 31 7",
"output": "94/2907"
},
{
"input": "94268 714 345",
"output": "689/94268"
},
{
"input": "262610 5583 4717",
"output": "2358/131305"
},
{
"input": "3898439 96326 71937",
"output": "71936/3898439"
},
{
"input": "54682301 778668 253103",
"output": "253102/54682301"
},
{
"input": "329245015 1173508 8918834",
"output": "1173507/329245015"
},
{
"input": "321076647734423976 7 7",
"output": "1/1"
},
{
"input": "455227494055672047 92 28",
"output": "19792499741550983/455227494055672047"
},
{
"input": "595779167455745259 6954 8697",
"output": "205511958419723/595779167455745259"
},
{
"input": "1000000000000000000 1000000000 2000000000",
"output": "1/2"
},
{
"input": "462643382718281828 462643382718281507 462643382718281701",
"output": "33045955908448679/33045955908448702"
},
{
"input": "4000000000000000000 9999999999999997 99999999999999999",
"output": "2499999999999999/1000000000000000000"
},
{
"input": "4003000100004000000 9999999099999999 99999999999999999",
"output": "4999999549999999/2001500050002000000"
},
{
"input": "4903000100004000000 58997960959949999 99933992929999999",
"output": "29498980479974999/2451500050002000000"
},
{
"input": "257593781689876390 32561717 4411677",
"output": "7914548537/257593781689876390"
},
{
"input": "111319886766128339 7862842484895022 3003994959686829",
"output": "3003994959686828/111319886766128339"
},
{
"input": "413850294331656955 570110918058849723 409853735661743839",
"output": "409853735661743838/413850294331656955"
},
{
"input": "232 17 83",
"output": "2/29"
},
{
"input": "5496272 63 200",
"output": "13765/2748136"
},
{
"input": "180 174 53",
"output": "13/45"
},
{
"input": "1954 190 537",
"output": "189/1954"
},
{
"input": "146752429 510 514",
"output": "571199/146752429"
},
{
"input": "579312860 55 70",
"output": "10344881/144828215"
},
{
"input": "1 9 9",
"output": "1/1"
},
{
"input": "95 19 19",
"output": "1/1"
},
{
"input": "404 63 441",
"output": "31/202"
},
{
"input": "5566 4798 4798",
"output": "1/1"
},
{
"input": "118289676 570846883 570846883",
"output": "1/1"
},
{
"input": "763 358 358",
"output": "1/1"
},
{
"input": "85356138 7223 482120804",
"output": "3611/42678069"
},
{
"input": "674664088 435395270 5",
"output": "9/674664088"
},
{
"input": "762200126044291557 370330636048898430 6",
"output": "17/762200126044291557"
},
{
"input": "917148533938841535 47 344459175789842163",
"output": "28/183429706787768307"
},
{
"input": "360212127113008697 877228952036215545 5259",
"output": "5258/360212127113008697"
},
{
"input": "683705963104411677 89876390 116741460012229240",
"output": "539258339/683705963104411677"
},
{
"input": "573003994959686829 275856334120822851 1319886766128339",
"output": "3959660298385016/573003994959686829"
},
{
"input": "409853735661743839 413850294331656955 413850294331656955",
"output": "1/1"
},
{
"input": "19 1 19",
"output": "1/19"
},
{
"input": "576 18 32",
"output": "1/16"
},
{
"input": "9540 10 954",
"output": "1/477"
},
{
"input": "101997840 6 16999640",
"output": "1/8499820"
},
{
"input": "955944 1278 748",
"output": "1/639"
},
{
"input": "482120804 66748 7223",
"output": "1/66748"
},
{
"input": "370330636048898430 61721772674816405 6",
"output": "1/61721772674816405"
},
{
"input": "344459175789842163 7328918633826429 47",
"output": "1/7328918633826429"
},
{
"input": "877228952036215545 166805277055755 5259",
"output": "1/55601759018585"
},
{
"input": "116741460012229240 1298911316 89876390",
"output": "1/649455658"
},
{
"input": "275856334120822851 209 1319886766128339",
"output": "1/1319886766128339"
},
{
"input": "413850294331656955 1 413850294331656955",
"output": "1/413850294331656955"
},
{
"input": "54682301 778668 253103",
"output": "253102/54682301"
},
{
"input": "329245015 3931027 6443236",
"output": "357366/29931365"
},
{
"input": "321076647734423976 7 8",
"output": "1672274206950125/13378193655600999"
},
{
"input": "455227494055672047 71 60",
"output": "6411654845854559/455227494055672047"
},
{
"input": "595779167455745259 9741 9331",
"output": "61162012885196/595779167455745259"
},
{
"input": "6470 80 160",
"output": "327/647"
},
{
"input": "686325 828 1656",
"output": "114511/228775"
},
{
"input": "4535304 2129 4258",
"output": "755973/1511768"
},
{
"input": "40525189 6365 12730",
"output": "20265394/40525189"
},
{
"input": "675297075 25986 51972",
"output": "112553659/225099025"
},
{
"input": "5681598412 75376 226128",
"output": "1893897375/5681598412"
},
{
"input": "384118571739435733 619773000 1859319000",
"output": "128039524053435733/384118571739435733"
},
{
"input": "391554751752251913 625743359 1877230077",
"output": "130518250652782079/391554751752251913"
},
{
"input": "390728504279201198 625082797 1250165594",
"output": "195364252413988195/390728504279201198"
},
{
"input": "389902265396085075 624421544 1248843088",
"output": "64983710976697837/129967421798695025"
},
{
"input": "734812071040507372 857211800 2571635400",
"output": "61234339274051543/183703017760126843"
},
{
"input": "1 1 2",
"output": "0/1"
},
{
"input": "3 1 4",
"output": "0/1"
},
{
"input": "8 2 3",
"output": "3/8"
},
{
"input": "64 32 16",
"output": "1/2"
},
{
"input": "1 1 1000000000",
"output": "0/1"
},
{
"input": "1000000000 1 1",
"output": "1/1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1/1"
},
{
"input": "1000000000 2 4",
"output": "1/2"
},
{
"input": "1000000000 123 456",
"output": "6579023/1000000000"
},
{
"input": "1000000000 123123 654",
"output": "24851/1000000000"
},
{
"input": "123456 123 456",
"output": "215/30864"
},
{
"input": "123456 1234567 123",
"output": "61/61728"
},
{
"input": "314159265 271 8281",
"output": "37939/314159265"
},
{
"input": "11071994 4231 1324",
"output": "2647/11071994"
},
{
"input": "961748927 961748941 982451653",
"output": "1/1"
},
{
"input": "15485221 1259 90863",
"output": "1258/15485221"
},
{
"input": "5000000000000000000 4999999999999999837 4999999999999999963",
"output": "1249999999999999959/1250000000000000000"
},
{
"input": "4000000000000000000 3999999999999999691 3999999999999999887",
"output": "399999999999999969/400000000000000000"
},
{
"input": "999999999999999999 999999999999999709 999999999999999737",
"output": "333333333333333236/333333333333333333"
},
{
"input": "799999999999999999 799999999999999969 799999999999999991",
"output": "799999999999999968/799999999999999999"
},
{
"input": "812312312312312222 812312312312311897 812312312312312029",
"output": "406156156156155948/406156156156156111"
},
{
"input": "500000000000000000 499999999999999927 499999999999999931",
"output": "249999999999999963/250000000000000000"
},
{
"input": "555555555555555555 555555555555555083 555555555555555229",
"output": "50505050505050462/50505050505050505"
},
{
"input": "199419941994199419 199419941994199369 199419941994199391",
"output": "66473313998066456/66473313998066473"
},
{
"input": "145685485411238588 145685485411238483 145685485411238573",
"output": "72842742705619241/72842742705619294"
},
{
"input": "314159265358979323 314159265358979167 314159265358979213",
"output": "314159265358979166/314159265358979323"
},
{
"input": "10 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "5 100000000000000000 99999999999999999",
"output": "1/1"
},
{
"input": "5 1000000000000 1000000000001",
"output": "1/1"
},
{
"input": "5 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "2 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "2 10 11",
"output": "1/1"
},
{
"input": "10 123456789123456789 723456789123456781",
"output": "1/1"
},
{
"input": "12345678910 123456789101112131 123456789101112132",
"output": "1/1"
},
{
"input": "5 499999999999999999 499999999999999998",
"output": "1/1"
}
] | 1,526,108,783 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 9 | 78 | 7,065,600 | '''input
370330636048898430 61721772674816405 6
'''
def gcd(a, b):
if(a%b==0):
return b
else:
return gcd(b, a%b)
t, w, b = map(int, input().split())
mini = min(w, b)
g = gcd(b, w)
lcm = (w*b)/g
cnt = t//lcm
n = mini*cnt
last = lcm*cnt
n += min(mini, t-last+1)
n -= 1
p = int(n)
q = int(t)
g = gcd(p, q)
p//=g;
q//=g;
print(int(p),'/',int(q), sep = '') | Title: The Big Race
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vector Willman and Array Bolt are the two most famous athletes of Byteforces. They are going to compete in a race with a distance of *L* meters today.
Willman and Bolt have exactly the same speed, so when they compete the result is always a tie. That is a problem for the organizers because they want a winner.
While watching previous races the organizers have noticed that Willman can perform only steps of length equal to *w* meters, and Bolt can perform only steps of length equal to *b* meters. Organizers decided to slightly change the rules of the race. Now, at the end of the racetrack there will be an abyss, and the winner will be declared the athlete, who manages to run farther from the starting point of the the racetrack (which is not the subject to change by any of the athletes).
Note that none of the athletes can run infinitely far, as they both will at some moment of time face the point, such that only one step further will cause them to fall in the abyss. In other words, the athlete will not fall into the abyss if the total length of all his steps will be less or equal to the chosen distance *L*.
Since the organizers are very fair, the are going to set the length of the racetrack as an integer chosen randomly and uniformly in range from 1 to *t* (both are included). What is the probability that Willman and Bolt tie again today?
Input Specification:
The first line of the input contains three integers *t*, *w* and *b* (1<=≤<=*t*,<=*w*,<=*b*<=≤<=5·1018) — the maximum possible length of the racetrack, the length of Willman's steps and the length of Bolt's steps respectively.
Output Specification:
Print the answer to the problem as an irreducible fraction . Follow the format of the samples output.
The fraction (*p* and *q* are integers, and both *p*<=≥<=0 and *q*<=><=0 holds) is called irreducible, if there is no such integer *d*<=><=1, that both *p* and *q* are divisible by *d*.
Demo Input:
['10 3 2\n', '7 1 2\n']
Demo Output:
['3/10\n', '3/7\n']
Note:
In the first sample Willman and Bolt will tie in case 1, 6 or 7 are chosen as the length of the racetrack. | ```python
'''input
370330636048898430 61721772674816405 6
'''
def gcd(a, b):
if(a%b==0):
return b
else:
return gcd(b, a%b)
t, w, b = map(int, input().split())
mini = min(w, b)
g = gcd(b, w)
lcm = (w*b)/g
cnt = t//lcm
n = mini*cnt
last = lcm*cnt
n += min(mini, t-last+1)
n -= 1
p = int(n)
q = int(t)
g = gcd(p, q)
p//=g;
q//=g;
print(int(p),'/',int(q), sep = '')
``` | 0 |
|
658 | A | Bear and Reverse Radewoosh | PROGRAMMING | 800 | [
"implementation"
] | null | null | Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems. | The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem. | Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points. | [
"3 2\n50 85 250\n10 15 25\n",
"3 6\n50 85 250\n10 15 25\n",
"8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n"
] | [
"Limak\n",
"Radewoosh\n",
"Tie\n"
] | In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4. | 500 | [
{
"input": "3 2\n50 85 250\n10 15 25",
"output": "Limak"
},
{
"input": "3 6\n50 85 250\n10 15 25",
"output": "Radewoosh"
},
{
"input": "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76",
"output": "Tie"
},
{
"input": "4 1\n3 5 6 9\n1 2 4 8",
"output": "Limak"
},
{
"input": "4 1\n1 3 6 10\n1 5 7 8",
"output": "Radewoosh"
},
{
"input": "4 1\n2 4 5 10\n2 3 9 10",
"output": "Tie"
},
{
"input": "18 4\n68 97 121 132 146 277 312 395 407 431 458 461 595 634 751 855 871 994\n1 2 3 4 9 10 13 21 22 29 31 34 37 38 39 41 48 49",
"output": "Radewoosh"
},
{
"input": "50 1\n5 14 18 73 137 187 195 197 212 226 235 251 262 278 287 304 310 322 342 379 393 420 442 444 448 472 483 485 508 515 517 523 559 585 618 627 636 646 666 682 703 707 780 853 937 951 959 989 991 992\n30 84 113 173 199 220 235 261 266 277 300 306 310 312 347 356 394 396 397 409 414 424 446 462 468 487 507 517 537 566 594 643 656 660 662 668 706 708 773 774 779 805 820 827 868 896 929 942 961 995",
"output": "Tie"
},
{
"input": "4 1\n4 6 9 10\n2 3 4 5",
"output": "Radewoosh"
},
{
"input": "4 1\n4 6 9 10\n3 4 5 7",
"output": "Radewoosh"
},
{
"input": "4 1\n1 6 7 10\n2 7 8 10",
"output": "Tie"
},
{
"input": "4 1\n4 5 7 9\n1 4 5 8",
"output": "Limak"
},
{
"input": "50 1\n6 17 44 82 94 127 134 156 187 211 212 252 256 292 294 303 352 355 379 380 398 409 424 434 480 524 584 594 631 714 745 756 777 778 789 793 799 821 841 849 859 878 879 895 925 932 944 952 958 990\n15 16 40 42 45 71 99 100 117 120 174 181 186 204 221 268 289 332 376 394 403 409 411 444 471 487 499 539 541 551 567 589 619 623 639 669 689 722 735 776 794 822 830 840 847 907 917 927 936 988",
"output": "Radewoosh"
},
{
"input": "50 10\n25 49 52 73 104 117 127 136 149 164 171 184 226 251 257 258 286 324 337 341 386 390 428 453 464 470 492 517 543 565 609 634 636 660 678 693 710 714 729 736 739 749 781 836 866 875 956 960 977 979\n2 4 7 10 11 22 24 26 27 28 31 35 37 38 42 44 45 46 52 53 55 56 57 59 60 61 64 66 67 68 69 71 75 76 77 78 79 81 83 85 86 87 89 90 92 93 94 98 99 100",
"output": "Limak"
},
{
"input": "50 10\n11 15 25 71 77 83 95 108 143 150 182 183 198 203 213 223 279 280 346 348 350 355 375 376 412 413 415 432 470 545 553 562 589 595 607 633 635 637 688 719 747 767 771 799 842 883 905 924 942 944\n1 3 5 6 7 10 11 12 13 14 15 16 19 20 21 23 25 32 35 36 37 38 40 41 42 43 47 50 51 54 55 56 57 58 59 60 62 63 64 65 66 68 69 70 71 72 73 75 78 80",
"output": "Radewoosh"
},
{
"input": "32 6\n25 77 141 148 157 159 192 196 198 244 245 255 332 392 414 457 466 524 575 603 629 700 738 782 838 841 845 847 870 945 984 985\n1 2 4 5 8 9 10 12 13 14 15 16 17 18 20 21 22 23 24 26 28 31 38 39 40 41 42 43 45 47 48 49",
"output": "Radewoosh"
},
{
"input": "5 1\n256 275 469 671 842\n7 9 14 17 26",
"output": "Limak"
},
{
"input": "2 1000\n1 2\n1 2",
"output": "Tie"
},
{
"input": "3 1\n1 50 809\n2 8 800",
"output": "Limak"
},
{
"input": "1 13\n866\n10",
"output": "Tie"
},
{
"input": "15 1\n9 11 66 128 199 323 376 386 393 555 585 718 935 960 971\n3 11 14 19 20 21 24 26 32 38 40 42 44 47 50",
"output": "Limak"
},
{
"input": "1 10\n546\n45",
"output": "Tie"
},
{
"input": "50 20\n21 43 51 99 117 119 158 167 175 190 196 244 250 316 335 375 391 403 423 428 451 457 460 480 487 522 539 559 566 584 598 602 604 616 626 666 675 730 771 787 828 841 861 867 886 889 898 970 986 991\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
},
{
"input": "50 21\n13 20 22 38 62 84 118 135 141 152 170 175 194 218 227 229 232 253 260 263 278 313 329 357 396 402 422 452 454 533 575 576 580 594 624 644 653 671 676 759 789 811 816 823 831 833 856 924 933 987\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "1 36\n312\n42",
"output": "Tie"
},
{
"input": "1 1000\n1\n1000",
"output": "Tie"
},
{
"input": "1 1\n1000\n1",
"output": "Tie"
},
{
"input": "50 35\n9 17 28 107 136 152 169 174 186 188 201 262 291 312 324 330 341 358 385 386 393 397 425 431 479 498 502 523 530 540 542 554 578 588 622 623 684 696 709 722 784 819 836 845 850 932 945 969 983 984\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "50 20\n12 113 116 120 138 156 167 183 185 194 211 228 234 261 278 287 310 317 346 361 364 397 424 470 496 522 527 536 611 648 668 704 707 712 717 752 761 766 815 828 832 864 872 885 889 901 904 929 982 993\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
}
] | 1,594,316,280 | 2,147,483,647 | Python 3 | OK | TESTS | 29 | 108 | 6,963,200 | a,b=map(int,input().split())
n=list(map(int,input().split()))
m=list(map(int,input().split()))
l,y=[],[]
x,q,w,o= 0,0,0,0
for e in m :
x = x+e
l.append(x)
for i in range(len(l)):
q = q+max(0,n[i]-b*l[i])
n=n[::-1]
m=m[::-1]
for p in m :
w=w+p
y.append(w)
for r in range(len(y)):
o = o+max(0,n[r]-b*y[r])
if q>o:
print("Limak")
elif q == o:
print("Tie")
else:
print("Radewoosh")
| Title: Bear and Reverse Radewoosh
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
Output Specification:
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
Demo Input:
['3 2\n50 85 250\n10 15 25\n', '3 6\n50 85 250\n10 15 25\n', '8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n']
Demo Output:
['Limak\n', 'Radewoosh\n', 'Tie\n']
Note:
In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4. | ```python
a,b=map(int,input().split())
n=list(map(int,input().split()))
m=list(map(int,input().split()))
l,y=[],[]
x,q,w,o= 0,0,0,0
for e in m :
x = x+e
l.append(x)
for i in range(len(l)):
q = q+max(0,n[i]-b*l[i])
n=n[::-1]
m=m[::-1]
for p in m :
w=w+p
y.append(w)
for r in range(len(y)):
o = o+max(0,n[r]-b*y[r])
if q>o:
print("Limak")
elif q == o:
print("Tie")
else:
print("Radewoosh")
``` | 3 |
|
1,009 | A | Game Shopping | PROGRAMMING | 800 | [
"implementation"
] | null | null | Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy. | The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet. | Print a single integer — the number of games Maxim will buy. | [
"5 4\n2 4 5 2 4\n5 3 4 6\n",
"5 2\n20 40 50 20 40\n19 20\n",
"6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n"
] | [
"3\n",
"0\n",
"4\n"
] | The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet. | 0 | [
{
"input": "5 4\n2 4 5 2 4\n5 3 4 6",
"output": "3"
},
{
"input": "5 2\n20 40 50 20 40\n19 20",
"output": "0"
},
{
"input": "6 4\n4 8 15 16 23 42\n1000 1000 1000 1000",
"output": "4"
},
{
"input": "5 1\n1 1 1 1 1\n5",
"output": "1"
},
{
"input": "5 1\n10 1 1 1 1\n1000",
"output": "1"
},
{
"input": "5 1\n100 100 100 100 100\n100",
"output": "1"
},
{
"input": "2 1\n2 1\n1",
"output": "1"
},
{
"input": "2 3\n3 1\n2 4 2",
"output": "1"
},
{
"input": "1 5\n4\n1 4 3 3 2",
"output": "0"
},
{
"input": "5 3\n4 2 3 1 1\n2 1 3",
"output": "3"
},
{
"input": "3 5\n5 2 5\n1 4 1 4 2",
"output": "0"
},
{
"input": "7 3\n9 7 10 2 1 1 1\n8 9 6",
"output": "3"
},
{
"input": "5 3\n2 5 3 3 2\n2 5 3",
"output": "3"
}
] | 1,557,326,258 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 2 | 78 | 0 | n,m = map(int, input().split())
mat = list(map(int, input().split()))
sat = list(map(int, input().split()))
i,j = 0,0
res = 0
while i<n:
if mat[i]<=sat[j]:
res+=1
j+=1
i+=1
print(res)
| Title: Game Shopping
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
Input Specification:
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
Output Specification:
Print a single integer — the number of games Maxim will buy.
Demo Input:
['5 4\n2 4 5 2 4\n5 3 4 6\n', '5 2\n20 40 50 20 40\n19 20\n', '6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n']
Demo Output:
['3\n', '0\n', '4\n']
Note:
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet. | ```python
n,m = map(int, input().split())
mat = list(map(int, input().split()))
sat = list(map(int, input().split()))
i,j = 0,0
res = 0
while i<n:
if mat[i]<=sat[j]:
res+=1
j+=1
i+=1
print(res)
``` | -1 |
|
11 | C | How Many Squares? | PROGRAMMING | 2,200 | [
"implementation"
] | C. How Many Squares? | 2 | 64 | You are given a 0-1 rectangular matrix. What is the number of squares in it? A square is a solid square frame (border) with linewidth equal to 1. A square should be at least 2<=×<=2. We are only interested in two types of squares:
1. squares with each side parallel to a side of the matrix; 1. squares with each side parallel to a diagonal of the matrix.
Regardless of type, a square must contain at least one 1 and can't touch (by side or corner) any foreign 1. Of course, the lengths of the sides of each square should be equal.
How many squares are in the given matrix? | The first line contains integer *t* (1<=≤<=*t*<=≤<=10000), where *t* is the number of test cases in the input. Then test cases follow. Each case starts with a line containing integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=250), where *n* is the number of rows and *m* is the number of columns. The following *n* lines contain *m* characters each (0 or 1).
The total number of characters in all test cases doesn't exceed 106 for any input file. | You should output exactly *t* lines, with the answer to the *i*-th test case on the *i*-th line. | [
"2\n8 8\n00010001\n00101000\n01000100\n10000010\n01000100\n00101000\n11010011\n11000011\n10 10\n1111111000\n1000001000\n1011001000\n1011001010\n1000001101\n1001001010\n1010101000\n1001001000\n1000001000\n1111111000\n",
"1\n12 11\n11111111111\n10000000001\n10111111101\n10100000101\n10101100101\n10101100101\n10100000101\n10100000101\n10111111101\n10000000001\n11111111111\n00000000000\n"
] | [
"1\n2\n",
"3\n"
] | none | 0 | [
{
"input": "2\n8 8\n00010001\n00101000\n01000100\n10000010\n01000100\n00101000\n11010011\n11000011\n10 10\n1111111000\n1000001000\n1011001000\n1011001010\n1000001101\n1001001010\n1010101000\n1001001000\n1000001000\n1111111000",
"output": "1\n2"
},
{
"input": "1\n12 11\n11111111111\n10000000001\n10111111101\n10100000101\n10101100101\n10101100101\n10100000101\n10100000101\n10111111101\n10000000001\n11111111111\n00000000000",
"output": "3"
}
] | 1,557,378,806 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 216 | 0 | print('I have no idea...') | Title: How Many Squares?
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
You are given a 0-1 rectangular matrix. What is the number of squares in it? A square is a solid square frame (border) with linewidth equal to 1. A square should be at least 2<=×<=2. We are only interested in two types of squares:
1. squares with each side parallel to a side of the matrix; 1. squares with each side parallel to a diagonal of the matrix.
Regardless of type, a square must contain at least one 1 and can't touch (by side or corner) any foreign 1. Of course, the lengths of the sides of each square should be equal.
How many squares are in the given matrix?
Input Specification:
The first line contains integer *t* (1<=≤<=*t*<=≤<=10000), where *t* is the number of test cases in the input. Then test cases follow. Each case starts with a line containing integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=250), where *n* is the number of rows and *m* is the number of columns. The following *n* lines contain *m* characters each (0 or 1).
The total number of characters in all test cases doesn't exceed 106 for any input file.
Output Specification:
You should output exactly *t* lines, with the answer to the *i*-th test case on the *i*-th line.
Demo Input:
['2\n8 8\n00010001\n00101000\n01000100\n10000010\n01000100\n00101000\n11010011\n11000011\n10 10\n1111111000\n1000001000\n1011001000\n1011001010\n1000001101\n1001001010\n1010101000\n1001001000\n1000001000\n1111111000\n', '1\n12 11\n11111111111\n10000000001\n10111111101\n10100000101\n10101100101\n10101100101\n10100000101\n10100000101\n10111111101\n10000000001\n11111111111\n00000000000\n']
Demo Output:
['1\n2\n', '3\n']
Note:
none | ```python
print('I have no idea...')
``` | 0 |
456 | A | Laptops | PROGRAMMING | 1,100 | [
"sortings"
] | null | null | One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct. | If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes). | [
"2\n1 2\n2 1\n"
] | [
"Happy Alex\n"
] | none | 500 | [
{
"input": "2\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "2\n1 1\n2 2",
"output": "Poor Alex"
},
{
"input": "3\n2 2\n3 3\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n3 3\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "1\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n2 3\n1 1\n3 2",
"output": "Happy Alex"
},
{
"input": "4\n4 1\n3 2\n2 3\n1 4",
"output": "Happy Alex"
},
{
"input": "2\n2 1\n1 2",
"output": "Happy Alex"
},
{
"input": "3\n3 2\n1 1\n2 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 1\n3 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
}
] | 1,698,496,217 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | n=int(input())
array=[]
for i in range(n):
array1=list(map(int,input().split(" ",1)))
array.append(array1)
array=sorted(array,key=lambda x:x[0])
m=0
for m in range(n-1):
if array[m][1]<array[m+1][1]:
m=1
print('Happy Alex')
break
if m==0:
print('Poor Alex') | Title: Laptops
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct.
Output Specification:
If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes).
Demo Input:
['2\n1 2\n2 1\n']
Demo Output:
['Happy Alex\n']
Note:
none | ```python
n=int(input())
array=[]
for i in range(n):
array1=list(map(int,input().split(" ",1)))
array.append(array1)
array=sorted(array,key=lambda x:x[0])
m=0
for m in range(n-1):
if array[m][1]<array[m+1][1]:
m=1
print('Happy Alex')
break
if m==0:
print('Poor Alex')
``` | 0 |
|
306 | A | Candies | PROGRAMMING | 800 | [
"implementation"
] | null | null | Polycarpus has got *n* candies and *m* friends (*n*<=≥<=*m*). He wants to make a New Year present with candies to each friend. Polycarpus is planning to present all candies and he wants to do this in the fairest (that is, most equal) manner. He wants to choose such *a**i*, where *a**i* is the number of candies in the *i*-th friend's present, that the maximum *a**i* differs from the least *a**i* as little as possible.
For example, if *n* is divisible by *m*, then he is going to present the same number of candies to all his friends, that is, the maximum *a**i* won't differ from the minimum one. | The single line of the input contains a pair of space-separated positive integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100;*n*<=≥<=*m*) — the number of candies and the number of Polycarpus's friends. | Print the required sequence *a*1,<=*a*2,<=...,<=*a**m*, where *a**i* is the number of candies in the *i*-th friend's present. All numbers *a**i* must be positive integers, total up to *n*, the maximum one should differ from the minimum one by the smallest possible value. | [
"12 3\n",
"15 4\n",
"18 7\n"
] | [
"4 4 4 ",
"3 4 4 4 ",
"2 2 2 3 3 3 3 "
] | Print *a*<sub class="lower-index">*i*</sub> in any order, separate the numbers by spaces. | 500 | [
{
"input": "12 4",
"output": "3 3 3 3 "
},
{
"input": "15 6",
"output": "2 2 2 3 3 3 "
},
{
"input": "18 8",
"output": "2 2 2 2 2 2 3 3 "
},
{
"input": "1 1",
"output": "1 "
},
{
"input": "2 1",
"output": "2 "
},
{
"input": "100 1",
"output": "100 "
},
{
"input": "100 100",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "100 10",
"output": "10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "64 8",
"output": "8 8 8 8 8 8 8 8 "
},
{
"input": "81 27",
"output": "3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "100 99",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 "
},
{
"input": "100 51",
"output": "1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100 49",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 "
},
{
"input": "100 13",
"output": "7 7 7 7 8 8 8 8 8 8 8 8 8 "
},
{
"input": "97 11",
"output": "8 8 9 9 9 9 9 9 9 9 9 "
},
{
"input": "19 3",
"output": "6 6 7 "
},
{
"input": "99 10",
"output": "9 10 10 10 10 10 10 10 10 10 "
},
{
"input": "88 5",
"output": "17 17 18 18 18 "
},
{
"input": "87 34",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "97 55",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
}
] | 1,602,620,461 | 2,147,483,647 | PyPy 3 | OK | TESTS | 20 | 280 | 0 |
s = input()
s2 = s.split(' ')
n = int(s2[0])
m = int(s2[1])
lst = []
f = n // m
for i in range(m):
lst.append(f)
k = 0
for i in lst:
k += i
while k < n:
for j in range(len(lst)):
lst[j] += 1
k += 1
if not k < n:
break
for item in lst[::-1]:
print(item, end = ' ') | Title: Candies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has got *n* candies and *m* friends (*n*<=≥<=*m*). He wants to make a New Year present with candies to each friend. Polycarpus is planning to present all candies and he wants to do this in the fairest (that is, most equal) manner. He wants to choose such *a**i*, where *a**i* is the number of candies in the *i*-th friend's present, that the maximum *a**i* differs from the least *a**i* as little as possible.
For example, if *n* is divisible by *m*, then he is going to present the same number of candies to all his friends, that is, the maximum *a**i* won't differ from the minimum one.
Input Specification:
The single line of the input contains a pair of space-separated positive integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100;*n*<=≥<=*m*) — the number of candies and the number of Polycarpus's friends.
Output Specification:
Print the required sequence *a*1,<=*a*2,<=...,<=*a**m*, where *a**i* is the number of candies in the *i*-th friend's present. All numbers *a**i* must be positive integers, total up to *n*, the maximum one should differ from the minimum one by the smallest possible value.
Demo Input:
['12 3\n', '15 4\n', '18 7\n']
Demo Output:
['4 4 4 ', '3 4 4 4 ', '2 2 2 3 3 3 3 ']
Note:
Print *a*<sub class="lower-index">*i*</sub> in any order, separate the numbers by spaces. | ```python
s = input()
s2 = s.split(' ')
n = int(s2[0])
m = int(s2[1])
lst = []
f = n // m
for i in range(m):
lst.append(f)
k = 0
for i in lst:
k += i
while k < n:
for j in range(len(lst)):
lst[j] += 1
k += 1
if not k < n:
break
for item in lst[::-1]:
print(item, end = ' ')
``` | 3 |
|
884 | A | Book Reading | PROGRAMMING | 800 | [
"implementation"
] | null | null | Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can.
But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading.
Help Luba to determine the minimum number of day when she finishes reading.
It is guaranteed that the answer doesn't exceed *n*.
Remember that there are 86400 seconds in a day. | The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=100, 1<=≤<=*t*<=≤<=106) — the number of days and the time required to read the book.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=86400) — the time Luba has to spend on her work during *i*-th day. | Print the minimum day Luba can finish reading the book.
It is guaranteed that answer doesn't exceed *n*. | [
"2 2\n86400 86398\n",
"2 86400\n0 86400\n"
] | [
"2\n",
"1\n"
] | none | 0 | [
{
"input": "2 2\n86400 86398",
"output": "2"
},
{
"input": "2 86400\n0 86400",
"output": "1"
},
{
"input": "2 86400\n1 86399",
"output": "2"
},
{
"input": "100 1000000\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "12"
},
{
"input": "1 1\n86399",
"output": "1"
},
{
"input": "6 1200\n86400 86400 86000 86000 86000 86400",
"output": "5"
},
{
"input": "6 1200\n86400 86400 86000 86000 86001 86399",
"output": "6"
},
{
"input": "4 172799\n1 1 86400 0",
"output": "4"
},
{
"input": "4 172799\n0 86400 86399 0",
"output": "4"
},
{
"input": "6 1\n1 1 86400 1 86399 1",
"output": "1"
},
{
"input": "4 1\n86400 86399 86400 86400",
"output": "2"
},
{
"input": "4 1\n86400 86400 0 86400",
"output": "3"
}
] | 1,509,463,440 | 2,147,483,647 | Python 3 | OK | TESTS | 16 | 46 | 0 | from sys import stdin, stdout
def main():
sec_day = 86400
n, t = map(int, stdin.readline().split())
cnt = 0
for cur in stdin.readline().split():
cur = int(cur)
t -= sec_day - cur
cnt += 1
if t <= 0:
stdout.write(str(cnt))
break
if __name__ == '__main__':
main() | Title: Book Reading
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can.
But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading.
Help Luba to determine the minimum number of day when she finishes reading.
It is guaranteed that the answer doesn't exceed *n*.
Remember that there are 86400 seconds in a day.
Input Specification:
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=100, 1<=≤<=*t*<=≤<=106) — the number of days and the time required to read the book.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=86400) — the time Luba has to spend on her work during *i*-th day.
Output Specification:
Print the minimum day Luba can finish reading the book.
It is guaranteed that answer doesn't exceed *n*.
Demo Input:
['2 2\n86400 86398\n', '2 86400\n0 86400\n']
Demo Output:
['2\n', '1\n']
Note:
none | ```python
from sys import stdin, stdout
def main():
sec_day = 86400
n, t = map(int, stdin.readline().split())
cnt = 0
for cur in stdin.readline().split():
cur = int(cur)
t -= sec_day - cur
cnt += 1
if t <= 0:
stdout.write(str(cnt))
break
if __name__ == '__main__':
main()
``` | 3 |
|
399 | A | Pages | PROGRAMMING | 0 | [
"implementation"
] | null | null | User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this:
When someone clicks the button "<<" he is redirected to page 1, and when someone clicks the button ">>" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page.
There are some conditions in the navigation:
- If page 1 is in the navigation, the button "<<" must not be printed. - If page *n* is in the navigation, the button ">>" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed.
You can see some examples of the navigations. Make a program that prints the navigation. | The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*) | Print the proper navigation. Follow the format of the output from the test samples. | [
"17 5 2\n",
"6 5 2\n",
"6 1 2\n",
"6 2 2\n",
"9 6 3\n",
"10 6 3\n",
"8 5 4\n"
] | [
"<< 3 4 (5) 6 7 >> ",
"<< 3 4 (5) 6 ",
"(1) 2 3 >> ",
"1 (2) 3 4 >>",
"<< 3 4 5 (6) 7 8 9",
"<< 3 4 5 (6) 7 8 9 >>",
"1 2 3 4 (5) 6 7 8 "
] | none | 500 | [
{
"input": "17 5 2",
"output": "<< 3 4 (5) 6 7 >> "
},
{
"input": "6 5 2",
"output": "<< 3 4 (5) 6 "
},
{
"input": "6 1 2",
"output": "(1) 2 3 >> "
},
{
"input": "6 2 2",
"output": "1 (2) 3 4 >> "
},
{
"input": "9 6 3",
"output": "<< 3 4 5 (6) 7 8 9 "
},
{
"input": "10 6 3",
"output": "<< 3 4 5 (6) 7 8 9 >> "
},
{
"input": "8 5 4",
"output": "1 2 3 4 (5) 6 7 8 "
},
{
"input": "100 10 20",
"output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 >> "
},
{
"input": "100 25 11",
"output": "<< 14 15 16 17 18 19 20 21 22 23 24 (25) 26 27 28 29 30 31 32 33 34 35 36 >> "
},
{
"input": "5 2 1",
"output": "1 (2) 3 >> "
},
{
"input": "5 3 1",
"output": "<< 2 (3) 4 >> "
},
{
"input": "79 35 12",
"output": "<< 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 >> "
},
{
"input": "100 99 5",
"output": "<< 94 95 96 97 98 (99) 100 "
},
{
"input": "100 99 15",
"output": "<< 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 (99) 100 "
},
{
"input": "100 100 17",
"output": "<< 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 (100) "
},
{
"input": "100 35 28",
"output": "<< 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 (35) 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 >> "
},
{
"input": "100 46 38",
"output": "<< 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 >> "
},
{
"input": "100 46 48",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 (46) 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 >> "
},
{
"input": "100 10 100",
"output": "1 2 3 4 5 6 7 8 9 (10) 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "3 1 1",
"output": "(1) 2 >> "
},
{
"input": "3 2 1",
"output": "1 (2) 3 "
},
{
"input": "17 5 3",
"output": "<< 2 3 4 (5) 6 7 8 >> "
},
{
"input": "3 1 3",
"output": "(1) 2 3 "
},
{
"input": "7 5 1",
"output": "<< 4 (5) 6 >> "
},
{
"input": "5 5 5",
"output": "1 2 3 4 (5) "
},
{
"input": "5 3 5",
"output": "1 2 (3) 4 5 "
}
] | 1,531,908,967 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 109 | 0 | n, p, k = list(map(int,input().split()))
if(p - k > 1):
print("<< ",end="")
for i in range(k):
if(p - k + i >= 1):
print(p - k + i,end=" ")
print("(",end="")
print(p,end=") ")
for i in range(k):
if(p + i + 1 <= n):
print(p + i + 1,end=" ")
if(p + k + 1 < n):
print(">>")
| Title: Pages
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
User ainta is making a web site. This time he is going to make a navigation of the pages. In his site, there are *n* pages numbered by integers from 1 to *n*. Assume that somebody is on the *p*-th page now. The navigation will look like this:
When someone clicks the button "<<" he is redirected to page 1, and when someone clicks the button ">>" he is redirected to page *n*. Of course if someone clicks on a number, he is redirected to the corresponding page.
There are some conditions in the navigation:
- If page 1 is in the navigation, the button "<<" must not be printed. - If page *n* is in the navigation, the button ">>" must not be printed. - If the page number is smaller than 1 or greater than *n*, it must not be printed.
You can see some examples of the navigations. Make a program that prints the navigation.
Input Specification:
The first and the only line contains three integers *n*, *p*, *k* (3<=≤<=*n*<=≤<=100; 1<=≤<=*p*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*)
Output Specification:
Print the proper navigation. Follow the format of the output from the test samples.
Demo Input:
['17 5 2\n', '6 5 2\n', '6 1 2\n', '6 2 2\n', '9 6 3\n', '10 6 3\n', '8 5 4\n']
Demo Output:
['<< 3 4 (5) 6 7 >> ', '<< 3 4 (5) 6 ', '(1) 2 3 >> ', '1 (2) 3 4 >>', '<< 3 4 5 (6) 7 8 9', '<< 3 4 5 (6) 7 8 9 >>', '1 2 3 4 (5) 6 7 8 ']
Note:
none | ```python
n, p, k = list(map(int,input().split()))
if(p - k > 1):
print("<< ",end="")
for i in range(k):
if(p - k + i >= 1):
print(p - k + i,end=" ")
print("(",end="")
print(p,end=") ")
for i in range(k):
if(p + i + 1 <= n):
print(p + i + 1,end=" ")
if(p + k + 1 < n):
print(">>")
``` | 0 |
|
999 | D | Equalize the Remainders | PROGRAMMING | 1,900 | [
"data structures",
"greedy",
"implementation"
] | null | null | You are given an array consisting of $n$ integers $a_1, a_2, \dots, a_n$, and a positive integer $m$. It is guaranteed that $m$ is a divisor of $n$.
In a single move, you can choose any position $i$ between $1$ and $n$ and increase $a_i$ by $1$.
Let's calculate $c_r$ ($0 \le r \le m-1)$ — the number of elements having remainder $r$ when divided by $m$. In other words, for each remainder, let's find the number of corresponding elements in $a$ with that remainder.
Your task is to change the array in such a way that $c_0 = c_1 = \dots = c_{m-1} = \frac{n}{m}$.
Find the minimum number of moves to satisfy the above requirement. | The first line of input contains two integers $n$ and $m$ ($1 \le n \le 2 \cdot 10^5, 1 \le m \le n$). It is guaranteed that $m$ is a divisor of $n$.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($0 \le a_i \le 10^9$), the elements of the array. | In the first line, print a single integer — the minimum number of moves required to satisfy the following condition: for each remainder from $0$ to $m - 1$, the number of elements of the array having this remainder equals $\frac{n}{m}$.
In the second line, print any array satisfying the condition and can be obtained from the given array with the minimum number of moves. The values of the elements of the resulting array must not exceed $10^{18}$. | [
"6 3\n3 2 0 6 10 12\n",
"4 2\n0 1 2 3\n"
] | [
"3\n3 2 0 7 10 14 \n",
"0\n0 1 2 3 \n"
] | none | 0 | [
{
"input": "6 3\n3 2 0 6 10 12",
"output": "3\n3 2 0 7 10 14 "
},
{
"input": "4 2\n0 1 2 3",
"output": "0\n0 1 2 3 "
},
{
"input": "1 1\n1000000000",
"output": "0\n1000000000 "
},
{
"input": "6 3\n3 2 0 6 10 11",
"output": "1\n3 2 0 7 10 11 "
},
{
"input": "100 25\n6745 2075 7499 7517 1776 5164 2335 2745 4465 1457 7565 2232 2486 9025 8059 9646 8017 7662 9690 3352 2306 366 7422 1073 7169 8966 4506 8225 5614 8628 2908 7452 9625 9332 7097 353 1043 8118 5794 4486 626 971 6731 6618 887 6354 4814 7307 7681 6160 9351 2579 411 3436 5570 2812 2726 4433 3220 577 5891 3861 528 2183 127 5579 6979 4005 9953 5038 9937 4792 3003 9417 8796 1565 11 2596 2486 3494 4464 9568 5512 5565 9822 9820 4848 2889 9527 2249 9860 8236 256 8434 8038 6407 5570 5922 7435 2815",
"output": "88\n6745 2075 7499 7517 1776 5164 2335 2745 4465 1457 7565 2232 2486 9025 8059 9646 8017 7662 9690 3352 2306 366 7422 1073 7169 8966 4506 8225 5614 8628 2908 7452 9625 9332 7097 353 1043 8118 5794 4486 626 971 6731 6618 887 6354 4814 7307 7681 6160 9351 2579 411 3436 5570 2812 2726 4433 3220 577 5891 3863 528 2183 127 5579 6979 4005 9953 5038 9937 4792 3005 9417 8796 1565 24 2596 2505 3494 4464 9568 5513 5566 9822 9823 4848 2899 9530 2249 9860 8259 259 8434 8038 6408 5573 5922 7435 2819 "
}
] | 1,643,081,442 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 4 | 3,000 | 28,569,600 | """
-*- coding: utf-8 -*-
Created on Sat Jan 22 18:33:32 2022
@author: Tausif Khan Arnob
"""
n, m = map(int, input().split())
a = [*map(int, input().split())]
li = [[] for i in range(m)]
k, s = n//m, 0
for i, val in enumerate(a):
li[val%m].append(i)
for i in range(2*m):
if len(li[i%m]) > k:
li[i%m + 1].extend(li[i%m][k:])
li[i%m] = li[i%m][:k]
for i in range(m):
for j in range(k):
d = a[li[i][j]]
if d%m != i:
d = (d//m)*m + i
s += d - a[li[i][j]]
a[li[i][j]] = d
print(s)
print(*a) | Title: Equalize the Remainders
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array consisting of $n$ integers $a_1, a_2, \dots, a_n$, and a positive integer $m$. It is guaranteed that $m$ is a divisor of $n$.
In a single move, you can choose any position $i$ between $1$ and $n$ and increase $a_i$ by $1$.
Let's calculate $c_r$ ($0 \le r \le m-1)$ — the number of elements having remainder $r$ when divided by $m$. In other words, for each remainder, let's find the number of corresponding elements in $a$ with that remainder.
Your task is to change the array in such a way that $c_0 = c_1 = \dots = c_{m-1} = \frac{n}{m}$.
Find the minimum number of moves to satisfy the above requirement.
Input Specification:
The first line of input contains two integers $n$ and $m$ ($1 \le n \le 2 \cdot 10^5, 1 \le m \le n$). It is guaranteed that $m$ is a divisor of $n$.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($0 \le a_i \le 10^9$), the elements of the array.
Output Specification:
In the first line, print a single integer — the minimum number of moves required to satisfy the following condition: for each remainder from $0$ to $m - 1$, the number of elements of the array having this remainder equals $\frac{n}{m}$.
In the second line, print any array satisfying the condition and can be obtained from the given array with the minimum number of moves. The values of the elements of the resulting array must not exceed $10^{18}$.
Demo Input:
['6 3\n3 2 0 6 10 12\n', '4 2\n0 1 2 3\n']
Demo Output:
['3\n3 2 0 7 10 14 \n', '0\n0 1 2 3 \n']
Note:
none | ```python
"""
-*- coding: utf-8 -*-
Created on Sat Jan 22 18:33:32 2022
@author: Tausif Khan Arnob
"""
n, m = map(int, input().split())
a = [*map(int, input().split())]
li = [[] for i in range(m)]
k, s = n//m, 0
for i, val in enumerate(a):
li[val%m].append(i)
for i in range(2*m):
if len(li[i%m]) > k:
li[i%m + 1].extend(li[i%m][k:])
li[i%m] = li[i%m][:k]
for i in range(m):
for j in range(k):
d = a[li[i][j]]
if d%m != i:
d = (d//m)*m + i
s += d - a[li[i][j]]
a[li[i][j]] = d
print(s)
print(*a)
``` | 0 |
|
832 | A | Sasha and Sticks | PROGRAMMING | 800 | [
"games",
"math"
] | null | null | It's one more school day now. Sasha doesn't like classes and is always bored at them. So, each day he invents some game and plays in it alone or with friends.
Today he invented one simple game to play with Lena, with whom he shares a desk. The rules are simple. Sasha draws *n* sticks in a row. After that the players take turns crossing out exactly *k* sticks from left or right in each turn. Sasha moves first, because he is the inventor of the game. If there are less than *k* sticks on the paper before some turn, the game ends. Sasha wins if he makes strictly more moves than Lena. Sasha wants to know the result of the game before playing, you are to help him. | The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1018, *k*<=≤<=*n*) — the number of sticks drawn by Sasha and the number *k* — the number of sticks to be crossed out on each turn. | If Sasha wins, print "YES" (without quotes), otherwise print "NO" (without quotes).
You can print each letter in arbitrary case (upper of lower). | [
"1 1\n",
"10 4\n"
] | [
"YES\n",
"NO\n"
] | In the first example Sasha crosses out 1 stick, and then there are no sticks. So Lena can't make a move, and Sasha wins.
In the second example Sasha crosses out 4 sticks, then Lena crosses out 4 sticks, and after that there are only 2 sticks left. Sasha can't make a move. The players make equal number of moves, so Sasha doesn't win. | 500 | [
{
"input": "1 1",
"output": "YES"
},
{
"input": "10 4",
"output": "NO"
},
{
"input": "251656215122324104 164397544865601257",
"output": "YES"
},
{
"input": "963577813436662285 206326039287271924",
"output": "NO"
},
{
"input": "1000000000000000000 1",
"output": "NO"
},
{
"input": "253308697183523656 25332878317796706",
"output": "YES"
},
{
"input": "669038685745448997 501718093668307460",
"output": "YES"
},
{
"input": "116453141993601660 87060381463547965",
"output": "YES"
},
{
"input": "766959657 370931668",
"output": "NO"
},
{
"input": "255787422422806632 146884995820359999",
"output": "YES"
},
{
"input": "502007866464507926 71266379084204128",
"output": "YES"
},
{
"input": "257439908778973480 64157133126869976",
"output": "NO"
},
{
"input": "232709385 91708542",
"output": "NO"
},
{
"input": "252482458300407528 89907711721009125",
"output": "NO"
},
{
"input": "6 2",
"output": "YES"
},
{
"input": "6 3",
"output": "NO"
},
{
"input": "6 4",
"output": "YES"
},
{
"input": "6 5",
"output": "YES"
},
{
"input": "6 6",
"output": "YES"
},
{
"input": "258266151957056904 30153168463725364",
"output": "NO"
},
{
"input": "83504367885565783 52285355047292458",
"output": "YES"
},
{
"input": "545668929424440387 508692735816921376",
"output": "YES"
},
{
"input": "547321411485639939 36665750286082900",
"output": "NO"
},
{
"input": "548973893546839491 183137237979822911",
"output": "NO"
},
{
"input": "544068082 193116851",
"output": "NO"
},
{
"input": "871412474 749817171",
"output": "YES"
},
{
"input": "999999999 1247",
"output": "NO"
},
{
"input": "851941088 712987048",
"output": "YES"
},
{
"input": "559922900 418944886",
"output": "YES"
},
{
"input": "293908937 37520518",
"output": "YES"
},
{
"input": "650075786 130049650",
"output": "NO"
},
{
"input": "1000000000 1000000000",
"output": "YES"
},
{
"input": "548147654663723363 107422751713800746",
"output": "YES"
},
{
"input": "828159210 131819483",
"output": "NO"
},
{
"input": "6242634 4110365",
"output": "YES"
},
{
"input": "458601973 245084155",
"output": "YES"
},
{
"input": "349593257 18089089",
"output": "YES"
},
{
"input": "814768821 312514745",
"output": "NO"
},
{
"input": "697884949 626323363",
"output": "YES"
},
{
"input": "667011589 54866795",
"output": "NO"
},
{
"input": "1000000000000000000 2",
"output": "NO"
},
{
"input": "1000000000000000000 3",
"output": "YES"
},
{
"input": "1000000000000000000 4",
"output": "NO"
},
{
"input": "999999999999999 1",
"output": "YES"
},
{
"input": "17 4",
"output": "NO"
},
{
"input": "2 2",
"output": "YES"
},
{
"input": "1000000000000000 2",
"output": "NO"
},
{
"input": "12 4",
"output": "YES"
},
{
"input": "6 1",
"output": "NO"
},
{
"input": "2 1",
"output": "NO"
},
{
"input": "10000000005 1",
"output": "YES"
},
{
"input": "10000000000000009 2",
"output": "NO"
},
{
"input": "12457895452123 1",
"output": "YES"
},
{
"input": "999999999999999999 9",
"output": "YES"
},
{
"input": "1000000000000 3",
"output": "YES"
},
{
"input": "13099714659575475 6549849616514894",
"output": "NO"
},
{
"input": "100000000000000001 1",
"output": "YES"
},
{
"input": "825175814723458 324",
"output": "YES"
},
{
"input": "20 4",
"output": "YES"
},
{
"input": "100000176877 4",
"output": "YES"
},
{
"input": "100000 3",
"output": "YES"
},
{
"input": "946744073709551614 10",
"output": "YES"
}
] | 1,589,557,245 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 93 | 6,656,000 | #https://codeforces.com/problemset/problem/832/A
inp = input()
inp = inp.split(" ")
numbers = []
for number in inp:
numbers.append(int(number))
Sasha = numbers[1]
Lena = numbers[0]-numbers[1]
if Sasha > Lena:
print ("YES")
else:
print ("NO")
| Title: Sasha and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's one more school day now. Sasha doesn't like classes and is always bored at them. So, each day he invents some game and plays in it alone or with friends.
Today he invented one simple game to play with Lena, with whom he shares a desk. The rules are simple. Sasha draws *n* sticks in a row. After that the players take turns crossing out exactly *k* sticks from left or right in each turn. Sasha moves first, because he is the inventor of the game. If there are less than *k* sticks on the paper before some turn, the game ends. Sasha wins if he makes strictly more moves than Lena. Sasha wants to know the result of the game before playing, you are to help him.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1018, *k*<=≤<=*n*) — the number of sticks drawn by Sasha and the number *k* — the number of sticks to be crossed out on each turn.
Output Specification:
If Sasha wins, print "YES" (without quotes), otherwise print "NO" (without quotes).
You can print each letter in arbitrary case (upper of lower).
Demo Input:
['1 1\n', '10 4\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example Sasha crosses out 1 stick, and then there are no sticks. So Lena can't make a move, and Sasha wins.
In the second example Sasha crosses out 4 sticks, then Lena crosses out 4 sticks, and after that there are only 2 sticks left. Sasha can't make a move. The players make equal number of moves, so Sasha doesn't win. | ```python
#https://codeforces.com/problemset/problem/832/A
inp = input()
inp = inp.split(" ")
numbers = []
for number in inp:
numbers.append(int(number))
Sasha = numbers[1]
Lena = numbers[0]-numbers[1]
if Sasha > Lena:
print ("YES")
else:
print ("NO")
``` | 0 |
|
495 | B | Modular Equations | PROGRAMMING | 1,600 | [
"math",
"number theory"
] | null | null | Last week, Hamed learned about a new type of equations in his math class called Modular Equations. Lets define *i* modulo *j* as the remainder of division of *i* by *j* and denote it by . A Modular Equation, as Hamed's teacher described, is an equation of the form in which *a* and *b* are two non-negative integers and *x* is a variable. We call a positive integer *x* for which a solution of our equation.
Hamed didn't pay much attention to the class since he was watching a movie. He only managed to understand the definitions of these equations.
Now he wants to write his math exercises but since he has no idea how to do that, he asked you for help. He has told you all he knows about Modular Equations and asked you to write a program which given two numbers *a* and *b* determines how many answers the Modular Equation has. | In the only line of the input two space-separated integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=109) are given. | If there is an infinite number of answers to our equation, print "infinity" (without the quotes). Otherwise print the number of solutions of the Modular Equation . | [
"21 5\n",
"9435152 272\n",
"10 10\n"
] | [
"2\n",
"282\n",
"infinity\n"
] | In the first sample the answers of the Modular Equation are 8 and 16 since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6f5ff39ebd209bf990adaf91f4b82f9687097224.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 1,000 | [
{
"input": "21 5",
"output": "2"
},
{
"input": "9435152 272",
"output": "282"
},
{
"input": "10 10",
"output": "infinity"
},
{
"input": "0 1000000000",
"output": "0"
},
{
"input": "11 2",
"output": "2"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "0 0",
"output": "infinity"
},
{
"input": "121 0",
"output": "3"
},
{
"input": "772930485 686893955",
"output": "0"
},
{
"input": "257424 24",
"output": "127"
},
{
"input": "295138437 589952171",
"output": "0"
},
{
"input": "223093836 966",
"output": "399"
},
{
"input": "233758336 10665466",
"output": "13"
},
{
"input": "223092887 17",
"output": "500"
},
{
"input": "223094728 1858",
"output": "371"
},
{
"input": "223092899 29",
"output": "495"
},
{
"input": "997920 0",
"output": "240"
},
{
"input": "887043 3",
"output": "213"
},
{
"input": "124 24",
"output": "3"
},
{
"input": "982901 101",
"output": "193"
},
{
"input": "357987 35",
"output": "45"
},
{
"input": "954374 1030",
"output": "32"
},
{
"input": "49106 46",
"output": "15"
},
{
"input": "325508499 119510657",
"output": "1"
},
{
"input": "89768760 885778845",
"output": "0"
},
{
"input": "944387968 700818251",
"output": "0"
},
{
"input": "12 3",
"output": "1"
},
{
"input": "1000000000 1",
"output": "19"
},
{
"input": "923456789 3",
"output": "14"
},
{
"input": "1000000000 6",
"output": "6"
},
{
"input": "1000000000 333333300",
"output": "2"
},
{
"input": "5 2",
"output": "1"
},
{
"input": "1 10",
"output": "0"
},
{
"input": "15 3",
"output": "3"
},
{
"input": "2 0",
"output": "2"
},
{
"input": "77 75",
"output": "0"
},
{
"input": "1000000000 1000000000",
"output": "infinity"
}
] | 1,580,317,252 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 124 | 0 | a,b = list(map(int , input().split()))
if(a<b): print(0)
else:
if a==b:
print('infinity')
elif a>b:
cnt =0
for i in range(1,int((a-b)**0.5)+1):
if(a-b)%i==0:
if(i>b): cnt+=1
if(a-b)/i > b and i*i != (a-b) : cnt+=1
print(cnt) | Title: Modular Equations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Last week, Hamed learned about a new type of equations in his math class called Modular Equations. Lets define *i* modulo *j* as the remainder of division of *i* by *j* and denote it by . A Modular Equation, as Hamed's teacher described, is an equation of the form in which *a* and *b* are two non-negative integers and *x* is a variable. We call a positive integer *x* for which a solution of our equation.
Hamed didn't pay much attention to the class since he was watching a movie. He only managed to understand the definitions of these equations.
Now he wants to write his math exercises but since he has no idea how to do that, he asked you for help. He has told you all he knows about Modular Equations and asked you to write a program which given two numbers *a* and *b* determines how many answers the Modular Equation has.
Input Specification:
In the only line of the input two space-separated integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=109) are given.
Output Specification:
If there is an infinite number of answers to our equation, print "infinity" (without the quotes). Otherwise print the number of solutions of the Modular Equation .
Demo Input:
['21 5\n', '9435152 272\n', '10 10\n']
Demo Output:
['2\n', '282\n', 'infinity\n']
Note:
In the first sample the answers of the Modular Equation are 8 and 16 since <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6f5ff39ebd209bf990adaf91f4b82f9687097224.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
a,b = list(map(int , input().split()))
if(a<b): print(0)
else:
if a==b:
print('infinity')
elif a>b:
cnt =0
for i in range(1,int((a-b)**0.5)+1):
if(a-b)%i==0:
if(i>b): cnt+=1
if(a-b)/i > b and i*i != (a-b) : cnt+=1
print(cnt)
``` | 3 |
|
932 | B | Recursive Queries | PROGRAMMING | 1,300 | [
"binary search",
"data structures",
"dfs and similar"
] | null | null | Let us define two functions *f* and *g* on positive integer numbers.
You need to process *Q* queries. In each query, you will be given three integers *l*, *r* and *k*. You need to print the number of integers *x* between *l* and *r* inclusive, such that *g*(*x*)<==<=*k*. | The first line of the input contains an integer *Q* (1<=≤<=*Q*<=≤<=2<=×<=105) representing the number of queries.
*Q* lines follow, each of which contains 3 integers *l*, *r* and *k* (1<=≤<=*l*<=≤<=*r*<=≤<=106,<=1<=≤<=*k*<=≤<=9). | For each query, print a single line containing the answer for that query. | [
"4\n22 73 9\n45 64 6\n47 55 7\n2 62 4\n",
"4\n82 94 6\n56 67 4\n28 59 9\n39 74 4\n"
] | [
"1\n4\n0\n8\n",
"3\n1\n1\n5\n"
] | In the first example:
- *g*(33) = 9 as *g*(33) = *g*(3 × 3) = *g*(9) = 9 - *g*(47) = *g*(48) = *g*(60) = *g*(61) = 6 - There are no such integers between 47 and 55. - *g*(4) = *g*(14) = *g*(22) = *g*(27) = *g*(39) = *g*(40) = *g*(41) = *g*(58) = 4 | 1,000 | [
{
"input": "4\n22 73 9\n45 64 6\n47 55 7\n2 62 4",
"output": "1\n4\n0\n8"
},
{
"input": "4\n82 94 6\n56 67 4\n28 59 9\n39 74 4",
"output": "3\n1\n1\n5"
}
] | 1,585,461,521 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 7 | 2,000 | 74,649,600 | def func(num):
ans = 1
while True:
for i in str(num):
if i!='0':
ans = ans*(int(i))
if ans<10:
break
else:
num = ans
ans = 1
return ans
N = 10**6+1
mat = [[0 for i in range(N)]for j in range(10)]
for i in range(N):
mat[func(i)][i]+=1
for i in range(10):
for j in range(1,N):
mat[i][j]+=mat[i][j-1]
for _ in range(int(input())):
l,r,x = list(map(int,input().split()))
y = mat[x][r]-mat[x][l]
if func(l)==x:
y+=1
print(y) | Title: Recursive Queries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let us define two functions *f* and *g* on positive integer numbers.
You need to process *Q* queries. In each query, you will be given three integers *l*, *r* and *k*. You need to print the number of integers *x* between *l* and *r* inclusive, such that *g*(*x*)<==<=*k*.
Input Specification:
The first line of the input contains an integer *Q* (1<=≤<=*Q*<=≤<=2<=×<=105) representing the number of queries.
*Q* lines follow, each of which contains 3 integers *l*, *r* and *k* (1<=≤<=*l*<=≤<=*r*<=≤<=106,<=1<=≤<=*k*<=≤<=9).
Output Specification:
For each query, print a single line containing the answer for that query.
Demo Input:
['4\n22 73 9\n45 64 6\n47 55 7\n2 62 4\n', '4\n82 94 6\n56 67 4\n28 59 9\n39 74 4\n']
Demo Output:
['1\n4\n0\n8\n', '3\n1\n1\n5\n']
Note:
In the first example:
- *g*(33) = 9 as *g*(33) = *g*(3 × 3) = *g*(9) = 9 - *g*(47) = *g*(48) = *g*(60) = *g*(61) = 6 - There are no such integers between 47 and 55. - *g*(4) = *g*(14) = *g*(22) = *g*(27) = *g*(39) = *g*(40) = *g*(41) = *g*(58) = 4 | ```python
def func(num):
ans = 1
while True:
for i in str(num):
if i!='0':
ans = ans*(int(i))
if ans<10:
break
else:
num = ans
ans = 1
return ans
N = 10**6+1
mat = [[0 for i in range(N)]for j in range(10)]
for i in range(N):
mat[func(i)][i]+=1
for i in range(10):
for j in range(1,N):
mat[i][j]+=mat[i][j-1]
for _ in range(int(input())):
l,r,x = list(map(int,input().split()))
y = mat[x][r]-mat[x][l]
if func(l)==x:
y+=1
print(y)
``` | 0 |
|
567 | A | Lineland Mail | PROGRAMMING | 900 | [
"greedy",
"implementation"
] | null | null | All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city | The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order. | Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city. | [
"4\n-5 -2 2 7\n",
"2\n-1 1\n"
] | [
"3 12\n3 9\n4 7\n5 12\n",
"2 2\n2 2\n"
] | none | 500 | [
{
"input": "4\n-5 -2 2 7",
"output": "3 12\n3 9\n4 7\n5 12"
},
{
"input": "2\n-1 1",
"output": "2 2\n2 2"
},
{
"input": "3\n-1 0 1",
"output": "1 2\n1 1\n1 2"
},
{
"input": "4\n-1 0 1 3",
"output": "1 4\n1 3\n1 2\n2 4"
},
{
"input": "3\n-1000000000 0 1000000000",
"output": "1000000000 2000000000\n1000000000 1000000000\n1000000000 2000000000"
},
{
"input": "2\n-1000000000 1000000000",
"output": "2000000000 2000000000\n2000000000 2000000000"
},
{
"input": "10\n1 10 12 15 59 68 130 912 1239 9123",
"output": "9 9122\n2 9113\n2 9111\n3 9108\n9 9064\n9 9055\n62 8993\n327 8211\n327 7884\n7884 9122"
},
{
"input": "5\n-2 -1 0 1 2",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "5\n-2 -1 0 1 3",
"output": "1 5\n1 4\n1 3\n1 3\n2 5"
},
{
"input": "3\n-10000 1 10000",
"output": "10001 20000\n9999 10001\n9999 20000"
},
{
"input": "5\n-1000000000 -999999999 -999999998 -999999997 -999999996",
"output": "1 4\n1 3\n1 2\n1 3\n1 4"
},
{
"input": "10\n-857422304 -529223472 82412729 145077145 188538640 265299215 527377039 588634631 592896147 702473706",
"output": "328198832 1559896010\n328198832 1231697178\n62664416 939835033\n43461495 1002499449\n43461495 1045960944\n76760575 1122721519\n61257592 1384799343\n4261516 1446056935\n4261516 1450318451\n109577559 1559896010"
},
{
"input": "10\n-876779400 -829849659 -781819137 -570920213 18428128 25280705 121178189 219147240 528386329 923854124",
"output": "46929741 1800633524\n46929741 1753703783\n48030522 1705673261\n210898924 1494774337\n6852577 905425996\n6852577 902060105\n95897484 997957589\n97969051 1095926640\n309239089 1405165729\n395467795 1800633524"
},
{
"input": "30\n-15 1 21 25 30 40 59 60 77 81 97 100 103 123 139 141 157 158 173 183 200 215 226 231 244 256 267 279 289 292",
"output": "16 307\n16 291\n4 271\n4 267\n5 262\n10 252\n1 233\n1 232\n4 215\n4 211\n3 195\n3 192\n3 189\n16 169\n2 154\n2 156\n1 172\n1 173\n10 188\n10 198\n15 215\n11 230\n5 241\n5 246\n12 259\n11 271\n11 282\n10 294\n3 304\n3 307"
},
{
"input": "10\n-1000000000 -999999999 -999999997 -999999996 -999999995 -999999994 -999999992 -999999990 -999999988 -999999986",
"output": "1 14\n1 13\n1 11\n1 10\n1 9\n1 8\n2 8\n2 10\n2 12\n2 14"
},
{
"input": "50\n-50000 -49459 -48875 -48456 -48411 -48096 -47901 -47500 -47150 -46808 -46687 -46679 -46337 -45747 -45604 -45194 -44752 -44242 -44231 -44122 -43636 -43274 -42916 -42881 -42386 -42095 -41830 -41618 -41145 -40897 -40534 -40007 -39761 -39389 -39104 -38909 -38630 -38561 -38364 -38255 -38214 -38084 -37959 -37607 -37202 -36890 -36681 -36136 -36123 -35886",
"output": "541 14114\n541 13573\n419 12989\n45 12570\n45 12525\n195 12210\n195 12015\n350 11614\n342 11264\n121 10922\n8 10801\n8 10793\n342 10451\n143 9861\n143 9718\n410 9308\n442 8866\n11 8356\n11 8345\n109 8236\n362 7750\n358 7388\n35 7084\n35 7119\n291 7614\n265 7905\n212 8170\n212 8382\n248 8855\n248 9103\n363 9466\n246 9993\n246 10239\n285 10611\n195 10896\n195 11091\n69 11370\n69 11439\n109 11636\n41 11745\n41 11786\n125 11916\n125 12041\n352 12393\n312 12798\n209 13110\n209 13319\n13 13864\n13 13877\n237 141..."
},
{
"input": "3\n-1000000000 999999999 1000000000",
"output": "1999999999 2000000000\n1 1999999999\n1 2000000000"
}
] | 1,688,837,533 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 10 | 3,000 | 12,390,400 | n=int(input())
lst=list(map(int,input().split()))
final=[]
for i in range(n):
a=lst[i]
for j in lst:
if a!=j:
p=abs(a-j)
final.append(p)
print(min(final),max(final))
final.clear()
| Title: Lineland Mail
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
All cities of Lineland are located on the *Ox* coordinate axis. Thus, each city is associated with its position *x**i* — a coordinate on the *Ox* axis. No two cities are located at a single point.
Lineland residents love to send letters to each other. A person may send a letter only if the recipient lives in another city (because if they live in the same city, then it is easier to drop in).
Strange but true, the cost of sending the letter is exactly equal to the distance between the sender's city and the recipient's city.
For each city calculate two values *min**i* and *max**i*, where *min**i* is the minimum cost of sending a letter from the *i*-th city to some other city, and *max**i* is the the maximum cost of sending a letter from the *i*-th city to some other city
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=105) — the number of cities in Lineland. The second line contains the sequence of *n* distinct integers *x*1,<=*x*2,<=...,<=*x**n* (<=-<=109<=≤<=*x**i*<=≤<=109), where *x**i* is the *x*-coordinate of the *i*-th city. All the *x**i*'s are distinct and follow in ascending order.
Output Specification:
Print *n* lines, the *i*-th line must contain two integers *min**i*,<=*max**i*, separated by a space, where *min**i* is the minimum cost of sending a letter from the *i*-th city, and *max**i* is the maximum cost of sending a letter from the *i*-th city.
Demo Input:
['4\n-5 -2 2 7\n', '2\n-1 1\n']
Demo Output:
['3 12\n3 9\n4 7\n5 12\n', '2 2\n2 2\n']
Note:
none | ```python
n=int(input())
lst=list(map(int,input().split()))
final=[]
for i in range(n):
a=lst[i]
for j in lst:
if a!=j:
p=abs(a-j)
final.append(p)
print(min(final),max(final))
final.clear()
``` | 0 |
|
545 | A | Toy Cars | PROGRAMMING | 900 | [
"implementation"
] | null | null | Little Susie, thanks to her older brother, likes to play with cars. Today she decided to set up a tournament between them. The process of a tournament is described in the next paragraph.
There are *n* toy cars. Each pair collides. The result of a collision can be one of the following: no car turned over, one car turned over, both cars turned over. A car is good if it turned over in no collision. The results of the collisions are determined by an *n*<=×<=*n* matrix *А*: there is a number on the intersection of the *і*-th row and *j*-th column that describes the result of the collision of the *і*-th and the *j*-th car:
- <=-<=1: if this pair of cars never collided. <=-<=1 occurs only on the main diagonal of the matrix. - 0: if no car turned over during the collision. - 1: if only the *i*-th car turned over during the collision. - 2: if only the *j*-th car turned over during the collision. - 3: if both cars turned over during the collision.
Susie wants to find all the good cars. She quickly determined which cars are good. Can you cope with the task? | The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cars.
Each of the next *n* lines contains *n* space-separated integers that determine matrix *A*.
It is guaranteed that on the main diagonal there are <=-<=1, and <=-<=1 doesn't appear anywhere else in the matrix.
It is guaranteed that the input is correct, that is, if *A**ij*<==<=1, then *A**ji*<==<=2, if *A**ij*<==<=3, then *A**ji*<==<=3, and if *A**ij*<==<=0, then *A**ji*<==<=0. | Print the number of good cars and in the next line print their space-separated indices in the increasing order. | [
"3\n-1 0 0\n0 -1 1\n0 2 -1\n",
"4\n-1 3 3 3\n3 -1 3 3\n3 3 -1 3\n3 3 3 -1\n"
] | [
"2\n1 3 ",
"0\n"
] | none | 500 | [
{
"input": "3\n-1 0 0\n0 -1 1\n0 2 -1",
"output": "2\n1 3 "
},
{
"input": "4\n-1 3 3 3\n3 -1 3 3\n3 3 -1 3\n3 3 3 -1",
"output": "0"
},
{
"input": "1\n-1",
"output": "1\n1 "
},
{
"input": "2\n-1 0\n0 -1",
"output": "2\n1 2 "
},
{
"input": "2\n-1 1\n2 -1",
"output": "1\n2 "
},
{
"input": "2\n-1 2\n1 -1",
"output": "1\n1 "
},
{
"input": "2\n-1 3\n3 -1",
"output": "0"
}
] | 1,674,501,798 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 35 | 77 | 2,048,000 | # -*- coding: utf-8 -*-
"""
Created on Mon Jan 23 16:09:09 2023
@author: Lenovo
"""
n = int(input())
m = []
ind = []
for i in range(n):
m.append(list(map(int,input().split())))
for i in m:
if 1 not in i and 3 not in i:
ind.append(m.index(i)+1)
for j in range(n):
x = 0
for i in range(n):
if m[i][j]==2 or m[i][j]==3:
x+=1
if x==0:
if j+1 not in ind:
ind.remove(j+1)
print(len(ind))
ind = sorted(ind)
for i in ind:
print(i,end=' ')
| Title: Toy Cars
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Susie, thanks to her older brother, likes to play with cars. Today she decided to set up a tournament between them. The process of a tournament is described in the next paragraph.
There are *n* toy cars. Each pair collides. The result of a collision can be one of the following: no car turned over, one car turned over, both cars turned over. A car is good if it turned over in no collision. The results of the collisions are determined by an *n*<=×<=*n* matrix *А*: there is a number on the intersection of the *і*-th row and *j*-th column that describes the result of the collision of the *і*-th and the *j*-th car:
- <=-<=1: if this pair of cars never collided. <=-<=1 occurs only on the main diagonal of the matrix. - 0: if no car turned over during the collision. - 1: if only the *i*-th car turned over during the collision. - 2: if only the *j*-th car turned over during the collision. - 3: if both cars turned over during the collision.
Susie wants to find all the good cars. She quickly determined which cars are good. Can you cope with the task?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of cars.
Each of the next *n* lines contains *n* space-separated integers that determine matrix *A*.
It is guaranteed that on the main diagonal there are <=-<=1, and <=-<=1 doesn't appear anywhere else in the matrix.
It is guaranteed that the input is correct, that is, if *A**ij*<==<=1, then *A**ji*<==<=2, if *A**ij*<==<=3, then *A**ji*<==<=3, and if *A**ij*<==<=0, then *A**ji*<==<=0.
Output Specification:
Print the number of good cars and in the next line print their space-separated indices in the increasing order.
Demo Input:
['3\n-1 0 0\n0 -1 1\n0 2 -1\n', '4\n-1 3 3 3\n3 -1 3 3\n3 3 -1 3\n3 3 3 -1\n']
Demo Output:
['2\n1 3 ', '0\n']
Note:
none | ```python
# -*- coding: utf-8 -*-
"""
Created on Mon Jan 23 16:09:09 2023
@author: Lenovo
"""
n = int(input())
m = []
ind = []
for i in range(n):
m.append(list(map(int,input().split())))
for i in m:
if 1 not in i and 3 not in i:
ind.append(m.index(i)+1)
for j in range(n):
x = 0
for i in range(n):
if m[i][j]==2 or m[i][j]==3:
x+=1
if x==0:
if j+1 not in ind:
ind.remove(j+1)
print(len(ind))
ind = sorted(ind)
for i in ind:
print(i,end=' ')
``` | 3 |
|
365 | A | Good Number | PROGRAMMING | 1,100 | [
"implementation"
] | null | null | Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*). | The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109). | Print a single integer — the number of *k*-good numbers in *a*. | [
"10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n",
"2 1\n1\n10\n"
] | [
"10\n",
"1\n"
] | none | 500 | [
{
"input": "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560",
"output": "10"
},
{
"input": "2 1\n1\n10",
"output": "1"
},
{
"input": "1 0\n1000000000",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "6 0\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "1 3\n1000000000",
"output": "0"
},
{
"input": "1 9\n1000000000",
"output": "0"
},
{
"input": "1 0\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 3\n1",
"output": "0"
},
{
"input": "1 9\n1",
"output": "0"
},
{
"input": "2 8\n123456780\n123",
"output": "1"
},
{
"input": "2 8\n12345678\n1230",
"output": "0"
},
{
"input": "6 1\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "6 2\n10\n102\n120\n1032\n1212103\n1999999",
"output": "4"
},
{
"input": "6 3\n10\n102\n120\n1032\n1212103\n1999999",
"output": "2"
},
{
"input": "6 9\n10\n102\n120\n1032\n1212103\n1999999",
"output": "0"
},
{
"input": "1 2\n2220",
"output": "0"
}
] | 1,691,341,606 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 31 | 0 | test_cases, k = map(int, input().split())
counter = 0
for _ in range(test_cases):
num = input()
temp = [i for i in range(0, k+1)]
temp = ''.join(str(n) for n in temp)
if temp == ''.join(sorted(num)): counter += 1
print(counter) | Title: Good Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
Input Specification:
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print a single integer — the number of *k*-good numbers in *a*.
Demo Input:
['10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n', '2 1\n1\n10\n']
Demo Output:
['10\n', '1\n']
Note:
none | ```python
test_cases, k = map(int, input().split())
counter = 0
for _ in range(test_cases):
num = input()
temp = [i for i in range(0, k+1)]
temp = ''.join(str(n) for n in temp)
if temp == ''.join(sorted(num)): counter += 1
print(counter)
``` | 0 |
|
734 | A | Anton and Danik | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game. | If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes). | [
"6\nADAAAA\n",
"7\nDDDAADA\n",
"6\nDADADA\n"
] | [
"Anton\n",
"Danik\n",
"Friendship\n"
] | In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship". | 500 | [
{
"input": "6\nADAAAA",
"output": "Anton"
},
{
"input": "7\nDDDAADA",
"output": "Danik"
},
{
"input": "6\nDADADA",
"output": "Friendship"
},
{
"input": "10\nDDDDADDADD",
"output": "Danik"
},
{
"input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA",
"output": "Anton"
},
{
"input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD",
"output": "Friendship"
},
{
"input": "1\nA",
"output": "Anton"
},
{
"input": "1\nD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "4\nDADA",
"output": "Friendship"
},
{
"input": "4\nDAAD",
"output": "Friendship"
},
{
"input": "3\nADD",
"output": "Danik"
},
{
"input": "3\nDAD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA",
"output": "Anton"
}
] | 1,698,155,448 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | n = input ()
n = int (n)
text = input ()
danik = 0
anton = 0
for in range (n)
if text (i) =("D"):
danik = danik + 1
else:
anton = anton + 1
if anton == danik:
print(friend ship)
elif anton>danik
print(anton)
else:
print("danik")
| Title: Anton and Danik
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
Output Specification:
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
Demo Input:
['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n']
Demo Output:
['Anton\n', 'Danik\n', 'Friendship\n']
Note:
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship". | ```python
n = input ()
n = int (n)
text = input ()
danik = 0
anton = 0
for in range (n)
if text (i) =("D"):
danik = danik + 1
else:
anton = anton + 1
if anton == danik:
print(friend ship)
elif anton>danik
print(anton)
else:
print("danik")
``` | -1 |
|
988 | A | Diverse Team | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them. | The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student. | If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$. | [
"5 3\n15 13 15 15 12\n",
"5 4\n15 13 15 15 12\n",
"4 4\n20 10 40 30\n"
] | [
"YES\n1 2 5 \n",
"NO\n",
"YES\n1 2 3 4 \n"
] | All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter. | 0 | [
{
"input": "5 3\n15 13 15 15 12",
"output": "YES\n1 2 5 "
},
{
"input": "5 4\n15 13 15 15 12",
"output": "NO"
},
{
"input": "4 4\n20 10 40 30",
"output": "YES\n1 2 3 4 "
},
{
"input": "1 1\n1",
"output": "YES\n1 "
},
{
"input": "100 53\n16 17 1 2 27 5 9 9 53 24 17 33 35 24 20 48 56 73 12 14 39 55 58 13 59 73 29 26 40 33 22 29 34 22 55 38 63 66 36 13 60 42 10 15 21 9 11 5 23 37 79 47 26 3 79 53 44 8 71 75 42 11 34 39 79 33 10 26 23 23 17 14 54 41 60 31 83 5 45 4 14 35 6 60 28 48 23 18 60 36 21 28 7 34 9 25 52 43 54 19",
"output": "YES\n1 2 3 4 5 6 7 9 10 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 31 33 36 37 38 39 41 42 43 44 45 47 49 50 51 52 54 57 58 59 60 73 74 76 77 79 80 83 "
},
{
"input": "2 2\n100 100",
"output": "NO"
},
{
"input": "2 2\n100 99",
"output": "YES\n1 2 "
},
{
"input": "100 100\n63 100 75 32 53 24 73 98 76 15 70 48 8 81 88 58 95 78 27 92 14 16 72 43 46 39 66 38 64 42 59 9 22 51 4 6 10 94 28 99 68 80 35 50 45 20 47 7 30 26 49 91 77 19 96 57 65 1 11 13 31 12 82 87 93 34 62 3 21 79 56 41 89 18 44 23 74 86 2 33 69 36 61 67 25 83 5 84 90 37 40 29 97 60 52 55 54 71 17 85",
"output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 41\n54 16 42 3 45 6 9 72 100 13 24 57 35 5 89 13 97 27 43 9 73 89 48 16 48 55 18 15 55 28 30 6 18 41 100 61 9 42 35 54 57 25 73 15 42 54 49 5 72 48 30 55 4 43 94 5 60 92 93 23 89 75 53 92 74 93 89 28 69 6 3 49 15 28 49 57 54 55 30 57 69 18 89 6 25 23 93 74 30 13 87 53 6 42 4 54 60 30 4 35",
"output": "NO"
},
{
"input": "100 2\n70 64 70 32 70 64 32 70 64 32 32 64 70 64 64 32 64 64 64 70 70 64 64 64 64 70 32 64 70 64 32 70 70 70 64 70 64 70 64 32 70 32 70 64 64 64 32 70 64 70 70 32 70 32 32 32 70 32 70 32 64 64 70 32 32 64 70 64 32 32 64 64 32 32 70 70 32 70 32 64 32 70 64 64 32 64 32 64 70 32 70 32 70 64 64 64 70 70 64 70",
"output": "YES\n1 2 "
}
] | 1,631,160,472 | 472 | PyPy 3 | OK | TESTS | 10 | 93 | 20,172,800 | n,k = list(map(int, input().split()))
arr = list(map(int, input().split()))
arr_set = set()
ans_list = []
for index, num in enumerate(arr):
if not num in arr_set:
arr_set.add(num)
ans_list.append(index+1)
if k > len(arr_set):
print('NO')
else:
print('YES')
for i in range(k):
print(ans_list[i], end= ' ')
| Title: Diverse Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
Output Specification:
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$.
Demo Input:
['5 3\n15 13 15 15 12\n', '5 4\n15 13 15 15 12\n', '4 4\n20 10 40 30\n']
Demo Output:
['YES\n1 2 5 \n', 'NO\n', 'YES\n1 2 3 4 \n']
Note:
All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter. | ```python
n,k = list(map(int, input().split()))
arr = list(map(int, input().split()))
arr_set = set()
ans_list = []
for index, num in enumerate(arr):
if not num in arr_set:
arr_set.add(num)
ans_list.append(index+1)
if k > len(arr_set):
print('NO')
else:
print('YES')
for i in range(k):
print(ans_list[i], end= ' ')
``` | 3 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.