contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
195 | B | After Training | PROGRAMMING | 1,300 | [
"data structures",
"implementation",
"math"
]
| null | null | After a team finished their training session on Euro football championship, Valeric was commissioned to gather the balls and sort them into baskets. Overall the stadium has *n* balls and *m* baskets. The baskets are positioned in a row from left to right and they are numbered with numbers from 1 to *m*, correspondingly. The balls are numbered with numbers from 1 to *n*.
Valeric decided to sort the balls in the order of increasing of their numbers by the following scheme. He will put each new ball in the basket with the least number of balls. And if he's got several variants, he chooses the basket which stands closer to the middle. That means that he chooses the basket for which is minimum, where *i* is the number of the basket. If in this case Valeric still has multiple variants, he chooses the basket with the minimum number.
For every ball print the number of the basket where it will go according to Valeric's scheme.
Note that the balls are sorted into baskets in the order of increasing numbers, that is, the first ball goes first, then goes the second ball and so on. | The first line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of balls and baskets, correspondingly. | Print *n* numbers, one per line. The *i*-th line must contain the number of the basket for the *i*-th ball. | [
"4 3\n",
"3 1\n"
]
| [
"2\n1\n3\n2\n",
"1\n1\n1\n"
]
| none | 1,000 | [
{
"input": "4 3",
"output": "2\n1\n3\n2"
},
{
"input": "3 1",
"output": "1\n1\n1"
},
{
"input": "10 3",
"output": "2\n1\n3\n2\n1\n3\n2\n1\n3\n2"
},
{
"input": "6 5",
"output": "3\n2\n4\n1\n5\n3"
},
{
"input": "2 6",
"output": "3\n4"
},
{
"input": "5 2",
"output": "1\n2\n1\n2\n1"
},
{
"input": "85702 100000",
"output": "50000\n50001\n49999\n50002\n49998\n50003\n49997\n50004\n49996\n50005\n49995\n50006\n49994\n50007\n49993\n50008\n49992\n50009\n49991\n50010\n49990\n50011\n49989\n50012\n49988\n50013\n49987\n50014\n49986\n50015\n49985\n50016\n49984\n50017\n49983\n50018\n49982\n50019\n49981\n50020\n49980\n50021\n49979\n50022\n49978\n50023\n49977\n50024\n49976\n50025\n49975\n50026\n49974\n50027\n49973\n50028\n49972\n50029\n49971\n50030\n49970\n50031\n49969\n50032\n49968\n50033\n49967\n50034\n49966\n50035\n49965\n50036\n49964\n..."
},
{
"input": "9 2",
"output": "1\n2\n1\n2\n1\n2\n1\n2\n1"
},
{
"input": "45 88",
"output": "44\n45\n43\n46\n42\n47\n41\n48\n40\n49\n39\n50\n38\n51\n37\n52\n36\n53\n35\n54\n34\n55\n33\n56\n32\n57\n31\n58\n30\n59\n29\n60\n28\n61\n27\n62\n26\n63\n25\n64\n24\n65\n23\n66\n22"
},
{
"input": "61 51",
"output": "26\n25\n27\n24\n28\n23\n29\n22\n30\n21\n31\n20\n32\n19\n33\n18\n34\n17\n35\n16\n36\n15\n37\n14\n38\n13\n39\n12\n40\n11\n41\n10\n42\n9\n43\n8\n44\n7\n45\n6\n46\n5\n47\n4\n48\n3\n49\n2\n50\n1\n51\n26\n25\n27\n24\n28\n23\n29\n22\n30\n21"
},
{
"input": "21 57",
"output": "29\n28\n30\n27\n31\n26\n32\n25\n33\n24\n34\n23\n35\n22\n36\n21\n37\n20\n38\n19\n39"
},
{
"input": "677 787",
"output": "394\n393\n395\n392\n396\n391\n397\n390\n398\n389\n399\n388\n400\n387\n401\n386\n402\n385\n403\n384\n404\n383\n405\n382\n406\n381\n407\n380\n408\n379\n409\n378\n410\n377\n411\n376\n412\n375\n413\n374\n414\n373\n415\n372\n416\n371\n417\n370\n418\n369\n419\n368\n420\n367\n421\n366\n422\n365\n423\n364\n424\n363\n425\n362\n426\n361\n427\n360\n428\n359\n429\n358\n430\n357\n431\n356\n432\n355\n433\n354\n434\n353\n435\n352\n436\n351\n437\n350\n438\n349\n439\n348\n440\n347\n441\n346\n442\n345\n443\n344\n444\n343\n4..."
},
{
"input": "37 849",
"output": "425\n424\n426\n423\n427\n422\n428\n421\n429\n420\n430\n419\n431\n418\n432\n417\n433\n416\n434\n415\n435\n414\n436\n413\n437\n412\n438\n411\n439\n410\n440\n409\n441\n408\n442\n407\n443"
},
{
"input": "453 855",
"output": "428\n427\n429\n426\n430\n425\n431\n424\n432\n423\n433\n422\n434\n421\n435\n420\n436\n419\n437\n418\n438\n417\n439\n416\n440\n415\n441\n414\n442\n413\n443\n412\n444\n411\n445\n410\n446\n409\n447\n408\n448\n407\n449\n406\n450\n405\n451\n404\n452\n403\n453\n402\n454\n401\n455\n400\n456\n399\n457\n398\n458\n397\n459\n396\n460\n395\n461\n394\n462\n393\n463\n392\n464\n391\n465\n390\n466\n389\n467\n388\n468\n387\n469\n386\n470\n385\n471\n384\n472\n383\n473\n382\n474\n381\n475\n380\n476\n379\n477\n378\n478\n377\n4..."
},
{
"input": "165 374",
"output": "187\n188\n186\n189\n185\n190\n184\n191\n183\n192\n182\n193\n181\n194\n180\n195\n179\n196\n178\n197\n177\n198\n176\n199\n175\n200\n174\n201\n173\n202\n172\n203\n171\n204\n170\n205\n169\n206\n168\n207\n167\n208\n166\n209\n165\n210\n164\n211\n163\n212\n162\n213\n161\n214\n160\n215\n159\n216\n158\n217\n157\n218\n156\n219\n155\n220\n154\n221\n153\n222\n152\n223\n151\n224\n150\n225\n149\n226\n148\n227\n147\n228\n146\n229\n145\n230\n144\n231\n143\n232\n142\n233\n141\n234\n140\n235\n139\n236\n138\n237\n137\n238\n1..."
},
{
"input": "328 3",
"output": "2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3\n2\n1\n3..."
},
{
"input": "8 80",
"output": "40\n41\n39\n42\n38\n43\n37\n44"
},
{
"input": "90 544",
"output": "272\n273\n271\n274\n270\n275\n269\n276\n268\n277\n267\n278\n266\n279\n265\n280\n264\n281\n263\n282\n262\n283\n261\n284\n260\n285\n259\n286\n258\n287\n257\n288\n256\n289\n255\n290\n254\n291\n253\n292\n252\n293\n251\n294\n250\n295\n249\n296\n248\n297\n247\n298\n246\n299\n245\n300\n244\n301\n243\n302\n242\n303\n241\n304\n240\n305\n239\n306\n238\n307\n237\n308\n236\n309\n235\n310\n234\n311\n233\n312\n232\n313\n231\n314\n230\n315\n229\n316\n228\n317"
},
{
"input": "85 60",
"output": "30\n31\n29\n32\n28\n33\n27\n34\n26\n35\n25\n36\n24\n37\n23\n38\n22\n39\n21\n40\n20\n41\n19\n42\n18\n43\n17\n44\n16\n45\n15\n46\n14\n47\n13\n48\n12\n49\n11\n50\n10\n51\n9\n52\n8\n53\n7\n54\n6\n55\n5\n56\n4\n57\n3\n58\n2\n59\n1\n60\n30\n31\n29\n32\n28\n33\n27\n34\n26\n35\n25\n36\n24\n37\n23\n38\n22\n39\n21\n40\n20\n41\n19\n42\n18"
},
{
"input": "392 5",
"output": "3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3..."
},
{
"input": "8 87",
"output": "44\n43\n45\n42\n46\n41\n47\n40"
},
{
"input": "6 358",
"output": "179\n180\n178\n181\n177\n182"
},
{
"input": "501 70",
"output": "35\n36\n34\n37\n33\n38\n32\n39\n31\n40\n30\n41\n29\n42\n28\n43\n27\n44\n26\n45\n25\n46\n24\n47\n23\n48\n22\n49\n21\n50\n20\n51\n19\n52\n18\n53\n17\n54\n16\n55\n15\n56\n14\n57\n13\n58\n12\n59\n11\n60\n10\n61\n9\n62\n8\n63\n7\n64\n6\n65\n5\n66\n4\n67\n3\n68\n2\n69\n1\n70\n35\n36\n34\n37\n33\n38\n32\n39\n31\n40\n30\n41\n29\n42\n28\n43\n27\n44\n26\n45\n25\n46\n24\n47\n23\n48\n22\n49\n21\n50\n20\n51\n19\n52\n18\n53\n17\n54\n16\n55\n15\n56\n14\n57\n13\n58\n12\n59\n11\n60\n10\n61\n9\n62\n8\n63\n7\n64\n6\n65\n5\n6..."
},
{
"input": "3834 1",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1..."
},
{
"input": "1 8828",
"output": "4414"
},
{
"input": "69230 89906",
"output": "44953\n44954\n44952\n44955\n44951\n44956\n44950\n44957\n44949\n44958\n44948\n44959\n44947\n44960\n44946\n44961\n44945\n44962\n44944\n44963\n44943\n44964\n44942\n44965\n44941\n44966\n44940\n44967\n44939\n44968\n44938\n44969\n44937\n44970\n44936\n44971\n44935\n44972\n44934\n44973\n44933\n44974\n44932\n44975\n44931\n44976\n44930\n44977\n44929\n44978\n44928\n44979\n44927\n44980\n44926\n44981\n44925\n44982\n44924\n44983\n44923\n44984\n44922\n44985\n44921\n44986\n44920\n44987\n44919\n44988\n44918\n44989\n44917\n..."
},
{
"input": "27646 59913",
"output": "29957\n29956\n29958\n29955\n29959\n29954\n29960\n29953\n29961\n29952\n29962\n29951\n29963\n29950\n29964\n29949\n29965\n29948\n29966\n29947\n29967\n29946\n29968\n29945\n29969\n29944\n29970\n29943\n29971\n29942\n29972\n29941\n29973\n29940\n29974\n29939\n29975\n29938\n29976\n29937\n29977\n29936\n29978\n29935\n29979\n29934\n29980\n29933\n29981\n29932\n29982\n29931\n29983\n29930\n29984\n29929\n29985\n29928\n29986\n29927\n29987\n29926\n29988\n29925\n29989\n29924\n29990\n29923\n29991\n29922\n29992\n29921\n29993\n..."
},
{
"input": "37006 54783",
"output": "27392\n27391\n27393\n27390\n27394\n27389\n27395\n27388\n27396\n27387\n27397\n27386\n27398\n27385\n27399\n27384\n27400\n27383\n27401\n27382\n27402\n27381\n27403\n27380\n27404\n27379\n27405\n27378\n27406\n27377\n27407\n27376\n27408\n27375\n27409\n27374\n27410\n27373\n27411\n27372\n27412\n27371\n27413\n27370\n27414\n27369\n27415\n27368\n27416\n27367\n27417\n27366\n27418\n27365\n27419\n27364\n27420\n27363\n27421\n27362\n27422\n27361\n27423\n27360\n27424\n27359\n27425\n27358\n27426\n27357\n27427\n27356\n27428\n..."
},
{
"input": "1 100000",
"output": "50000"
},
{
"input": "100000 1",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1..."
},
{
"input": "100000 100000",
"output": "50000\n50001\n49999\n50002\n49998\n50003\n49997\n50004\n49996\n50005\n49995\n50006\n49994\n50007\n49993\n50008\n49992\n50009\n49991\n50010\n49990\n50011\n49989\n50012\n49988\n50013\n49987\n50014\n49986\n50015\n49985\n50016\n49984\n50017\n49983\n50018\n49982\n50019\n49981\n50020\n49980\n50021\n49979\n50022\n49978\n50023\n49977\n50024\n49976\n50025\n49975\n50026\n49974\n50027\n49973\n50028\n49972\n50029\n49971\n50030\n49970\n50031\n49969\n50032\n49968\n50033\n49967\n50034\n49966\n50035\n49965\n50036\n49964\n..."
},
{
"input": "100000 13",
"output": "7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n13\n7\n6\n8\n5\n9\n4\n10\n3\n11\n2\n12\n1\n..."
},
{
"input": "100000 44",
"output": "22\n23\n21\n24\n20\n25\n19\n26\n18\n27\n17\n28\n16\n29\n15\n30\n14\n31\n13\n32\n12\n33\n11\n34\n10\n35\n9\n36\n8\n37\n7\n38\n6\n39\n5\n40\n4\n41\n3\n42\n2\n43\n1\n44\n22\n23\n21\n24\n20\n25\n19\n26\n18\n27\n17\n28\n16\n29\n15\n30\n14\n31\n13\n32\n12\n33\n11\n34\n10\n35\n9\n36\n8\n37\n7\n38\n6\n39\n5\n40\n4\n41\n3\n42\n2\n43\n1\n44\n22\n23\n21\n24\n20\n25\n19\n26\n18\n27\n17\n28\n16\n29\n15\n30\n14\n31\n13\n32\n12\n33\n11\n34\n10\n35\n9\n36\n8\n37\n7\n38\n6\n39\n5\n40\n4\n41\n3\n42\n2\n43\n1\n44\n22\n23\n21..."
},
{
"input": "100000 37820",
"output": "18910\n18911\n18909\n18912\n18908\n18913\n18907\n18914\n18906\n18915\n18905\n18916\n18904\n18917\n18903\n18918\n18902\n18919\n18901\n18920\n18900\n18921\n18899\n18922\n18898\n18923\n18897\n18924\n18896\n18925\n18895\n18926\n18894\n18927\n18893\n18928\n18892\n18929\n18891\n18930\n18890\n18931\n18889\n18932\n18888\n18933\n18887\n18934\n18886\n18935\n18885\n18936\n18884\n18937\n18883\n18938\n18882\n18939\n18881\n18940\n18880\n18941\n18879\n18942\n18878\n18943\n18877\n18944\n18876\n18945\n18875\n18946\n18874\n..."
},
{
"input": "99999 77777",
"output": "38889\n38888\n38890\n38887\n38891\n38886\n38892\n38885\n38893\n38884\n38894\n38883\n38895\n38882\n38896\n38881\n38897\n38880\n38898\n38879\n38899\n38878\n38900\n38877\n38901\n38876\n38902\n38875\n38903\n38874\n38904\n38873\n38905\n38872\n38906\n38871\n38907\n38870\n38908\n38869\n38909\n38868\n38910\n38867\n38911\n38866\n38912\n38865\n38913\n38864\n38914\n38863\n38915\n38862\n38916\n38861\n38917\n38860\n38918\n38859\n38919\n38858\n38920\n38857\n38921\n38856\n38922\n38855\n38923\n38854\n38924\n38853\n38925\n..."
},
{
"input": "1991 1935",
"output": "968\n967\n969\n966\n970\n965\n971\n964\n972\n963\n973\n962\n974\n961\n975\n960\n976\n959\n977\n958\n978\n957\n979\n956\n980\n955\n981\n954\n982\n953\n983\n952\n984\n951\n985\n950\n986\n949\n987\n948\n988\n947\n989\n946\n990\n945\n991\n944\n992\n943\n993\n942\n994\n941\n995\n940\n996\n939\n997\n938\n998\n937\n999\n936\n1000\n935\n1001\n934\n1002\n933\n1003\n932\n1004\n931\n1005\n930\n1006\n929\n1007\n928\n1008\n927\n1009\n926\n1010\n925\n1011\n924\n1012\n923\n1013\n922\n1014\n921\n1015\n920\n1016\n919\n1017..."
},
{
"input": "17 812",
"output": "406\n407\n405\n408\n404\n409\n403\n410\n402\n411\n401\n412\n400\n413\n399\n414\n398"
},
{
"input": "30078 300",
"output": "150\n151\n149\n152\n148\n153\n147\n154\n146\n155\n145\n156\n144\n157\n143\n158\n142\n159\n141\n160\n140\n161\n139\n162\n138\n163\n137\n164\n136\n165\n135\n166\n134\n167\n133\n168\n132\n169\n131\n170\n130\n171\n129\n172\n128\n173\n127\n174\n126\n175\n125\n176\n124\n177\n123\n178\n122\n179\n121\n180\n120\n181\n119\n182\n118\n183\n117\n184\n116\n185\n115\n186\n114\n187\n113\n188\n112\n189\n111\n190\n110\n191\n109\n192\n108\n193\n107\n194\n106\n195\n105\n196\n104\n197\n103\n198\n102\n199\n101\n200\n100\n201\n9..."
},
{
"input": "10500 5",
"output": "3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3\n2\n4\n1\n5\n3..."
},
{
"input": "90091 322",
"output": "161\n162\n160\n163\n159\n164\n158\n165\n157\n166\n156\n167\n155\n168\n154\n169\n153\n170\n152\n171\n151\n172\n150\n173\n149\n174\n148\n175\n147\n176\n146\n177\n145\n178\n144\n179\n143\n180\n142\n181\n141\n182\n140\n183\n139\n184\n138\n185\n137\n186\n136\n187\n135\n188\n134\n189\n133\n190\n132\n191\n131\n192\n130\n193\n129\n194\n128\n195\n127\n196\n126\n197\n125\n198\n124\n199\n123\n200\n122\n201\n121\n202\n120\n203\n119\n204\n118\n205\n117\n206\n116\n207\n115\n208\n114\n209\n113\n210\n112\n211\n111\n212\n1..."
},
{
"input": "8471 92356",
"output": "46178\n46179\n46177\n46180\n46176\n46181\n46175\n46182\n46174\n46183\n46173\n46184\n46172\n46185\n46171\n46186\n46170\n46187\n46169\n46188\n46168\n46189\n46167\n46190\n46166\n46191\n46165\n46192\n46164\n46193\n46163\n46194\n46162\n46195\n46161\n46196\n46160\n46197\n46159\n46198\n46158\n46199\n46157\n46200\n46156\n46201\n46155\n46202\n46154\n46203\n46153\n46204\n46152\n46205\n46151\n46206\n46150\n46207\n46149\n46208\n46148\n46209\n46147\n46210\n46146\n46211\n46145\n46212\n46144\n46213\n46143\n46214\n46142\n..."
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 1",
"output": "1\n1"
},
{
"input": "52097 88310",
"output": "44155\n44156\n44154\n44157\n44153\n44158\n44152\n44159\n44151\n44160\n44150\n44161\n44149\n44162\n44148\n44163\n44147\n44164\n44146\n44165\n44145\n44166\n44144\n44167\n44143\n44168\n44142\n44169\n44141\n44170\n44140\n44171\n44139\n44172\n44138\n44173\n44137\n44174\n44136\n44175\n44135\n44176\n44134\n44177\n44133\n44178\n44132\n44179\n44131\n44180\n44130\n44181\n44129\n44182\n44128\n44183\n44127\n44184\n44126\n44185\n44125\n44186\n44124\n44187\n44123\n44188\n44122\n44189\n44121\n44190\n44120\n44191\n44119\n..."
}
]
| 1,648,840,140 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 6 | 2,000 | 6,758,400 | def chooseBasket(x, baskets, m):
smaller = -1
smallerList = []
for i in range(m):
if len(baskets[i]) < smaller or smaller == -1:
smallerList = [i]
smaller = len(baskets[i])
elif len(baskets[i]) == smaller:
smallerList.append(i)
if len(smallerList) == 1:
baskets[smallerList[0]].append(x)
return smallerList[0]+1
closest = -1
closestList = []
for small in smallerList:
aux = abs(0.5*(m+1) - (small+1))
if aux < closest or closest == -1:
closestList = [small]
closest = aux
elif aux == closest:
closestList.append(small)
if len(closestList) == 1:
baskets[closestList[0]].append(x)
return closestList[0]+1
smaller = -1
for i in range(len(closestList)):
if closestList[i] < smaller or smaller == -1:
smaller = closestList[i]
baskets[smaller].append(x)
return smaller+1
n,m = map(int, input().split())
baskets = []
for i in range(m):
baskets.append([])
for i in range(n):
aux = chooseBasket(i, baskets, m)
print(aux)
| Title: After Training
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a team finished their training session on Euro football championship, Valeric was commissioned to gather the balls and sort them into baskets. Overall the stadium has *n* balls and *m* baskets. The baskets are positioned in a row from left to right and they are numbered with numbers from 1 to *m*, correspondingly. The balls are numbered with numbers from 1 to *n*.
Valeric decided to sort the balls in the order of increasing of their numbers by the following scheme. He will put each new ball in the basket with the least number of balls. And if he's got several variants, he chooses the basket which stands closer to the middle. That means that he chooses the basket for which is minimum, where *i* is the number of the basket. If in this case Valeric still has multiple variants, he chooses the basket with the minimum number.
For every ball print the number of the basket where it will go according to Valeric's scheme.
Note that the balls are sorted into baskets in the order of increasing numbers, that is, the first ball goes first, then goes the second ball and so on.
Input Specification:
The first line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the number of balls and baskets, correspondingly.
Output Specification:
Print *n* numbers, one per line. The *i*-th line must contain the number of the basket for the *i*-th ball.
Demo Input:
['4 3\n', '3 1\n']
Demo Output:
['2\n1\n3\n2\n', '1\n1\n1\n']
Note:
none | ```python
def chooseBasket(x, baskets, m):
smaller = -1
smallerList = []
for i in range(m):
if len(baskets[i]) < smaller or smaller == -1:
smallerList = [i]
smaller = len(baskets[i])
elif len(baskets[i]) == smaller:
smallerList.append(i)
if len(smallerList) == 1:
baskets[smallerList[0]].append(x)
return smallerList[0]+1
closest = -1
closestList = []
for small in smallerList:
aux = abs(0.5*(m+1) - (small+1))
if aux < closest or closest == -1:
closestList = [small]
closest = aux
elif aux == closest:
closestList.append(small)
if len(closestList) == 1:
baskets[closestList[0]].append(x)
return closestList[0]+1
smaller = -1
for i in range(len(closestList)):
if closestList[i] < smaller or smaller == -1:
smaller = closestList[i]
baskets[smaller].append(x)
return smaller+1
n,m = map(int, input().split())
baskets = []
for i in range(m):
baskets.append([])
for i in range(n):
aux = chooseBasket(i, baskets, m)
print(aux)
``` | 0 |
|
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
]
| A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
]
| [
"word\nl10n\ni18n\np43s\n"
]
| none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
]
| 1,687,354,717 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | x = input()
while int(x) != 0:
w = input()
if len(w) >= 10:
print(w[0], len(w), w[-1], sep="")
else:
print(w)
x = int(x) - 1
| Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
x = input()
while int(x) != 0:
w = input()
if len(w) >= 10:
print(w[0], len(w), w[-1], sep="")
else:
print(w)
x = int(x) - 1
``` | 0 |
721 | A | One-dimensional Japanese Crossword | PROGRAMMING | 800 | [
"implementation"
]
| null | null | Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew). | The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right. | [
"3\nBBW\n",
"5\nBWBWB\n",
"4\nWWWW\n",
"4\nBBBB\n",
"13\nWBBBBWWBWBBBW\n"
]
| [
"1\n2 ",
"3\n1 1 1 ",
"0\n",
"1\n4 ",
"3\n4 1 3 "
]
| The last sample case correspond to the picture in the statement. | 500 | [
{
"input": "3\nBBW",
"output": "1\n2 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "4\nWWWW",
"output": "0"
},
{
"input": "4\nBBBB",
"output": "1\n4 "
},
{
"input": "13\nWBBBBWWBWBBBW",
"output": "3\n4 1 3 "
},
{
"input": "1\nB",
"output": "1\n1 "
},
{
"input": "2\nBB",
"output": "1\n2 "
},
{
"input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB",
"output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "1\nW",
"output": "0"
},
{
"input": "2\nWW",
"output": "0"
},
{
"input": "2\nWB",
"output": "1\n1 "
},
{
"input": "2\nBW",
"output": "1\n1 "
},
{
"input": "3\nBBB",
"output": "1\n3 "
},
{
"input": "3\nBWB",
"output": "2\n1 1 "
},
{
"input": "3\nWBB",
"output": "1\n2 "
},
{
"input": "3\nWWB",
"output": "1\n1 "
},
{
"input": "3\nWBW",
"output": "1\n1 "
},
{
"input": "3\nBWW",
"output": "1\n1 "
},
{
"input": "3\nWWW",
"output": "0"
},
{
"input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB",
"output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 "
},
{
"input": "5\nBBBWB",
"output": "2\n3 1 "
},
{
"input": "5\nBWWWB",
"output": "2\n1 1 "
},
{
"input": "5\nWWWWB",
"output": "1\n1 "
},
{
"input": "5\nBWWWW",
"output": "1\n1 "
},
{
"input": "5\nBBBWW",
"output": "1\n3 "
},
{
"input": "5\nWWBBB",
"output": "1\n3 "
},
{
"input": "10\nBBBBBWWBBB",
"output": "2\n5 3 "
},
{
"input": "10\nBBBBWBBWBB",
"output": "3\n4 2 2 "
},
{
"input": "20\nBBBBBWWBWBBWBWWBWBBB",
"output": "6\n5 1 2 1 1 3 "
},
{
"input": "20\nBBBWWWWBBWWWBWBWWBBB",
"output": "5\n3 2 1 1 3 "
},
{
"input": "20\nBBBBBBBBWBBBWBWBWBBB",
"output": "5\n8 3 1 1 3 "
},
{
"input": "20\nBBBWBWBWWWBBWWWWBWBB",
"output": "6\n3 1 1 2 1 2 "
},
{
"input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB",
"output": "5\n6 1 1 1 12 "
},
{
"input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB",
"output": "9\n5 1 2 1 1 4 1 1 8 "
},
{
"input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB",
"output": "7\n11 1 1 8 1 1 6 "
},
{
"input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW",
"output": "9\n5 1 1 1 1 2 2 1 1 "
},
{
"input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB",
"output": "6\n1 1 1 1 1 5 "
},
{
"input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB",
"output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB",
"output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n100 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB",
"output": "11\n20 1 1 1 2 1 1 1 1 1 20 "
},
{
"input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB",
"output": "11\n4 1 1 1 1 2 1 1 1 1 6 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "10\nWWBWWWBWBB",
"output": "3\n1 1 2 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n17 31 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n24 42 "
},
{
"input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB",
"output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 "
},
{
"input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB",
"output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 "
},
{
"input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB",
"output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 "
},
{
"input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB",
"output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 "
},
{
"input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB",
"output": "11\n1 5 3 4 3 1 1 2 1 2 4 "
}
]
| 1,683,807,566 | 2,147,483,647 | Python 3 | OK | TESTS | 54 | 46 | 0 | n = int(input())
s = input()
groups = []
current_group_size = 0
for i in range(n):
if s[i] == 'B':
current_group_size += 1
else:
if current_group_size > 0:
groups.append(current_group_size)
current_group_size = 0
if current_group_size > 0:
groups.append(current_group_size)
print(len(groups))
print(' '.join(str(x) for x in groups))
| Title: One-dimensional Japanese Crossword
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
Output Specification:
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
Demo Input:
['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n']
Demo Output:
['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 ']
Note:
The last sample case correspond to the picture in the statement. | ```python
n = int(input())
s = input()
groups = []
current_group_size = 0
for i in range(n):
if s[i] == 'B':
current_group_size += 1
else:
if current_group_size > 0:
groups.append(current_group_size)
current_group_size = 0
if current_group_size > 0:
groups.append(current_group_size)
print(len(groups))
print(' '.join(str(x) for x in groups))
``` | 3 |
|
870 | A | Search for Pretty Integers | PROGRAMMING | 900 | [
"brute force",
"implementation"
]
| null | null | You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer? | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list. | Print the smallest pretty integer. | [
"2 3\n4 2\n5 7 6\n",
"8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n"
]
| [
"25\n",
"1\n"
]
| In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer. | 500 | [
{
"input": "2 3\n4 2\n5 7 6",
"output": "25"
},
{
"input": "8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n9\n1",
"output": "19"
},
{
"input": "9 1\n5 4 2 3 6 1 7 9 8\n9",
"output": "9"
},
{
"input": "5 3\n7 2 5 8 6\n3 1 9",
"output": "12"
},
{
"input": "4 5\n5 2 6 4\n8 9 1 3 7",
"output": "12"
},
{
"input": "5 9\n4 2 1 6 7\n2 3 4 5 6 7 8 9 1",
"output": "1"
},
{
"input": "9 9\n5 4 3 2 1 6 7 8 9\n3 2 1 5 4 7 8 9 6",
"output": "1"
},
{
"input": "9 5\n2 3 4 5 6 7 8 9 1\n4 2 1 6 7",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n8\n9",
"output": "89"
},
{
"input": "1 1\n9\n8",
"output": "89"
},
{
"input": "1 1\n1\n2",
"output": "12"
},
{
"input": "1 1\n2\n1",
"output": "12"
},
{
"input": "1 1\n9\n9",
"output": "9"
},
{
"input": "1 1\n1\n1",
"output": "1"
},
{
"input": "4 5\n3 2 4 5\n1 6 5 9 8",
"output": "5"
},
{
"input": "3 2\n4 5 6\n1 5",
"output": "5"
},
{
"input": "5 4\n1 3 5 6 7\n2 4 3 9",
"output": "3"
},
{
"input": "5 5\n1 3 5 7 9\n2 4 6 8 9",
"output": "9"
},
{
"input": "2 2\n1 8\n2 8",
"output": "8"
},
{
"input": "5 5\n5 6 7 8 9\n1 2 3 4 5",
"output": "5"
},
{
"input": "5 5\n1 2 3 4 5\n1 2 3 4 5",
"output": "1"
},
{
"input": "5 5\n1 2 3 4 5\n2 3 4 5 6",
"output": "2"
},
{
"input": "2 2\n1 5\n2 5",
"output": "5"
},
{
"input": "4 4\n1 3 5 8\n2 4 6 8",
"output": "8"
},
{
"input": "3 3\n1 5 3\n2 5 7",
"output": "5"
},
{
"input": "3 3\n3 6 8\n2 6 9",
"output": "6"
},
{
"input": "2 2\n1 4\n2 4",
"output": "4"
},
{
"input": "5 3\n3 4 5 6 7\n1 5 9",
"output": "5"
},
{
"input": "4 4\n1 2 3 4\n2 5 6 7",
"output": "2"
},
{
"input": "5 5\n1 2 3 4 5\n9 2 1 7 5",
"output": "1"
},
{
"input": "2 2\n1 3\n2 3",
"output": "3"
},
{
"input": "3 3\n3 2 1\n3 2 1",
"output": "1"
},
{
"input": "3 3\n1 3 5\n2 3 6",
"output": "3"
},
{
"input": "3 3\n5 6 7\n5 6 7",
"output": "5"
},
{
"input": "1 2\n5\n2 5",
"output": "5"
},
{
"input": "3 3\n2 4 9\n7 8 9",
"output": "9"
},
{
"input": "3 3\n1 2 4\n3 4 5",
"output": "4"
},
{
"input": "3 2\n1 4 9\n2 4",
"output": "4"
},
{
"input": "3 3\n3 5 6\n1 5 9",
"output": "5"
},
{
"input": "3 2\n1 2 4\n3 4",
"output": "4"
},
{
"input": "2 4\n8 9\n1 2 3 9",
"output": "9"
},
{
"input": "1 2\n9\n8 9",
"output": "9"
},
{
"input": "3 2\n1 2 4\n4 2",
"output": "2"
},
{
"input": "2 3\n4 5\n1 3 5",
"output": "5"
},
{
"input": "3 2\n1 2 3\n2 3",
"output": "2"
},
{
"input": "4 3\n1 3 5 9\n2 8 9",
"output": "9"
},
{
"input": "2 2\n1 9\n9 2",
"output": "9"
}
]
| 1,596,530,809 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 124 | 20,172,800 | n, m = [int(i) for i in input().split()]
a = set(int(i) for i in input().split())
b = set(int(i) for i in input().split())
x = min(a)
y = min(b)
if(x==y):
print(x)
else:
print(min(x, y), max(x, y), sep='') | Title: Search for Pretty Integers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list.
Output Specification:
Print the smallest pretty integer.
Demo Input:
['2 3\n4 2\n5 7 6\n', '8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n']
Demo Output:
['25\n', '1\n']
Note:
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer. | ```python
n, m = [int(i) for i in input().split()]
a = set(int(i) for i in input().split())
b = set(int(i) for i in input().split())
x = min(a)
y = min(b)
if(x==y):
print(x)
else:
print(min(x, y), max(x, y), sep='')
``` | 0 |
|
888 | A | Local Extrema | PROGRAMMING | 800 | [
"brute force",
"implementation"
]
| null | null | You are given an array *a*. Some element of this array *a**i* is a local minimum iff it is strictly less than both of its neighbours (that is, *a**i*<=<<=*a**i*<=-<=1 and *a**i*<=<<=*a**i*<=+<=1). Also the element can be called local maximum iff it is strictly greater than its neighbours (that is, *a**i*<=><=*a**i*<=-<=1 and *a**i*<=><=*a**i*<=+<=1). Since *a*1 and *a**n* have only one neighbour each, they are neither local minima nor local maxima.
An element is called a local extremum iff it is either local maximum or local minimum. Your task is to calculate the number of local extrema in the given array. | The first line contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in array *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=1000) — the elements of array *a*. | Print the number of local extrema in the given array. | [
"3\n1 2 3\n",
"4\n1 5 2 5\n"
]
| [
"0\n",
"2\n"
]
| none | 0 | [
{
"input": "3\n1 2 3",
"output": "0"
},
{
"input": "4\n1 5 2 5",
"output": "2"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n548",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "3\n3 2 3",
"output": "1"
},
{
"input": "2\n1 1000",
"output": "0"
},
{
"input": "3\n1 2 1",
"output": "1"
}
]
| 1,511,238,008 | 308 | Python 3 | OK | TESTS | 14 | 62 | 0 | n = int(input())
a = list(map(int, input().split()))
ct = 0
for x in range(1, n - 1) :
if a[x-1] < a[x] > a[x+1] or a[x-1] > a[x] < a[x+1] :
ct += 1
print(ct) | Title: Local Extrema
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array *a*. Some element of this array *a**i* is a local minimum iff it is strictly less than both of its neighbours (that is, *a**i*<=<<=*a**i*<=-<=1 and *a**i*<=<<=*a**i*<=+<=1). Also the element can be called local maximum iff it is strictly greater than its neighbours (that is, *a**i*<=><=*a**i*<=-<=1 and *a**i*<=><=*a**i*<=+<=1). Since *a*1 and *a**n* have only one neighbour each, they are neither local minima nor local maxima.
An element is called a local extremum iff it is either local maximum or local minimum. Your task is to calculate the number of local extrema in the given array.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in array *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=1000) — the elements of array *a*.
Output Specification:
Print the number of local extrema in the given array.
Demo Input:
['3\n1 2 3\n', '4\n1 5 2 5\n']
Demo Output:
['0\n', '2\n']
Note:
none | ```python
n = int(input())
a = list(map(int, input().split()))
ct = 0
for x in range(1, n - 1) :
if a[x-1] < a[x] > a[x+1] or a[x-1] > a[x] < a[x+1] :
ct += 1
print(ct)
``` | 3 |
|
58 | A | Chat room | PROGRAMMING | 1,000 | [
"greedy",
"strings"
]
| A. Chat room | 1 | 256 | Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. | The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. | If Vasya managed to say hello, print "YES", otherwise print "NO". | [
"ahhellllloou\n",
"hlelo\n"
]
| [
"YES\n",
"NO\n"
]
| none | 500 | [
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
]
| 1,634,315,132 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 46 | 0 | a=input()
b=[]
c=0
for i in a:
if(i=="l" and c==1):
b.append(i)
c=2
if i not in b:
b.append(i)
if(i=="l" and c==0):
c=1
c="".join(b)
if "hello" in c:
print("YES")
else:
print("NO")
| Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
a=input()
b=[]
c=0
for i in a:
if(i=="l" and c==1):
b.append(i)
c=2
if i not in b:
b.append(i)
if(i=="l" and c==0):
c=1
c="".join(b)
if "hello" in c:
print("YES")
else:
print("NO")
``` | 0 |
298 | A | Snow Footprints | PROGRAMMING | 1,300 | [
"greedy",
"implementation"
]
| null | null | There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one.
At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road.
You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints. | The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=1000).
The second line contains the description of the road — the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint).
It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists. | Print two space-separated integers — the values of *s* and *t*. If there are several possible solutions you can print any of them. | [
"9\n..RRLL...\n",
"11\n.RRRLLLLL..\n"
]
| [
"3 4\n",
"7 5\n"
]
| The first test sample is the one in the picture. | 500 | [
{
"input": "11\n.RRRLLLLL..",
"output": "7 5"
},
{
"input": "4\n.RL.",
"output": "3 2"
},
{
"input": "3\n.L.",
"output": "2 1"
},
{
"input": "3\n.R.",
"output": "2 3"
}
]
| 1,666,679,349 | 2,147,483,647 | Python 3 | OK | TESTS | 23 | 92 | 0 | n = int(input())
seq = input()
rBegin = rEnd = lBegin = lEnd = 0
R = L = False
for i in range(n):
if seq[i] == 'R':
if R == False:
R = True
rBegin = i+1
rEnd = i+1
elif seq[i] == 'L':
if L == False:
L = True
lBegin = i+1
lEnd = i+1
if R==True and L==True:
print(rBegin, lBegin-1)
elif R==True:
print(rBegin, rEnd+1)
else:
print(lEnd, lBegin-1)
| Title: Snow Footprints
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a straight snowy road, divided into *n* blocks. The blocks are numbered from 1 to *n* from left to right. If one moves from the *i*-th block to the (*i*<=+<=1)-th block, he will leave a right footprint on the *i*-th block. Similarly, if one moves from the *i*-th block to the (*i*<=-<=1)-th block, he will leave a left footprint on the *i*-th block. If there already is a footprint on the *i*-th block, the new footprint will cover the old one.
At the beginning, there were no footprints. Then polar bear Alice starts from the *s*-th block, makes a sequence of moves and ends in the *t*-th block. It is known that Alice never moves outside of the road.
You are given the description of Alice's footprints. Your task is to find a pair of possible values of *s*,<=*t* by looking at the footprints.
Input Specification:
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=1000).
The second line contains the description of the road — the string that consists of *n* characters. Each character will be either "." (a block without footprint), or "L" (a block with a left footprint), "R" (a block with a right footprint).
It's guaranteed that the given string contains at least one character not equal to ".". Also, the first and the last character will always be ".". It's guaranteed that a solution exists.
Output Specification:
Print two space-separated integers — the values of *s* and *t*. If there are several possible solutions you can print any of them.
Demo Input:
['9\n..RRLL...\n', '11\n.RRRLLLLL..\n']
Demo Output:
['3 4\n', '7 5\n']
Note:
The first test sample is the one in the picture. | ```python
n = int(input())
seq = input()
rBegin = rEnd = lBegin = lEnd = 0
R = L = False
for i in range(n):
if seq[i] == 'R':
if R == False:
R = True
rBegin = i+1
rEnd = i+1
elif seq[i] == 'L':
if L == False:
L = True
lBegin = i+1
lEnd = i+1
if R==True and L==True:
print(rBegin, lBegin-1)
elif R==True:
print(rBegin, rEnd+1)
else:
print(lEnd, lBegin-1)
``` | 3 |
|
616 | D | Longest k-Good Segment | PROGRAMMING | 1,600 | [
"binary search",
"data structures",
"two pointers"
]
| null | null | The array *a* with *n* integers is given. Let's call the sequence of one or more consecutive elements in *a* segment. Also let's call the segment k-good if it contains no more than *k* different values.
Find any longest k-good segment.
As the input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use scanf/printf instead of cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java. | The first line contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=5·105) — the number of elements in *a* and the parameter *k*.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=106) — the elements of the array *a*. | Print two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*) — the index of the left and the index of the right ends of some k-good longest segment. If there are several longest segments you can print any of them. The elements in *a* are numbered from 1 to *n* from left to right. | [
"5 5\n1 2 3 4 5\n",
"9 3\n6 5 1 2 3 2 1 4 5\n",
"3 1\n1 2 3\n"
]
| [
"1 5\n",
"3 7\n",
"1 1\n"
]
| none | 0 | [
{
"input": "5 5\n1 2 3 4 5",
"output": "1 5"
},
{
"input": "9 3\n6 5 1 2 3 2 1 4 5",
"output": "3 7"
},
{
"input": "3 1\n1 2 3",
"output": "1 1"
},
{
"input": "1 1\n747391",
"output": "1 1"
},
{
"input": "5 2\n171230 171230 171230 171230 171230",
"output": "1 5"
},
{
"input": "10 3\n512008 512008 452221 512008 314256 123232 314256 512008 314256 123232",
"output": "4 10"
},
{
"input": "6 1\n1 1 2 1 1 1",
"output": "4 6"
},
{
"input": "5 4\n1 2 3 4 0",
"output": "1 4"
},
{
"input": "5 4\n2 3 4 5 0",
"output": "1 4"
},
{
"input": "2 2\n0 1",
"output": "1 2"
},
{
"input": "2 2\n0 0",
"output": "1 2"
},
{
"input": "5 4\n1 2 3 45 0",
"output": "1 4"
}
]
| 1,670,531,901 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 7 | 1,000 | 102,400 | # n, r1, r2 = map(int, input().split())
# last_cities = list(map(int, input().split()))
# last_cities.insert(r1-1, f'r{r1}')
#
# paths = []
# saving = []
# dead_end = []
# for i in range(n):
# if i+1 == r2:
# saving.append(last_cities[i])
# if last_cities[i] == f'r{r1}':
# last_cities[i] = i + 1
# if i == r2-1:
# last_cities[i] = f'r{r2}'
# paths.append([i + 1, last_cities[i]])
# check = set(last_cities)
# for i in range(len(saving)): # Перебираем ветки
# prev_element = r2 # предыдущий. 5 изначально
# element = saving[i] # текущий. у которого будем изменять путь
# not_dead_end = True #для проверки на тупик
# index_branch = element - 1 # индекс того, у которого будем изменять
# while not_dead_end: # Пока не тупик или пока не пришли к нашей старой столице
# element = paths[index_branch][1]
# paths[index_branch][1], prev_element = prev_element, paths[index_branch][0]
# index_branch = element - 1
# if element == r1 and paths[index_branch][0] == paths[index_branch][1]: # если дошли до прошлой столицы, её нужно развернуть в напр текущей
# paths[index_branch][1] = prev_element
# break
# elif element == r1:
# break
# if element not in check:
# not_dead_end = False
# answer = ''
# for el in paths:
# if type(el[1]) != str:
# answer += f'{el[1]} '
# print(answer[:-1])
n, k = map(int, input().split())
segment = list(map(int, input().split()))
l_index = 0
r_index = -1
# r = n
turn = True
for l in range(n):
r = n
# if turn is True:
# print(segment[l:r])
# while len(set(segment[l:r])) > k:
# r -= 1
# else:
# while len(set(segment[l:r])) < k and r < n:
# r += 1
# turn = True
while len(set(segment[l:r])) > k:
r -= 1
# while len(set(segment[l:r])) <= k and r < n:
# r += 1
# turn = False
# turn = not turn
if r-l > r_index-l_index:
r_index = r
l_index = l
# if r-l > r_index-l_index and turn:
# r_index = r
# l_index = l
# elif r-l > r_index-l_index and not turn and l != n - :
# r_index = r - 1
# l_index = l
print(f"{l_index+1} {r_index}")
| Title: Longest k-Good Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The array *a* with *n* integers is given. Let's call the sequence of one or more consecutive elements in *a* segment. Also let's call the segment k-good if it contains no more than *k* different values.
Find any longest k-good segment.
As the input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use scanf/printf instead of cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
Input Specification:
The first line contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=5·105) — the number of elements in *a* and the parameter *k*.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=106) — the elements of the array *a*.
Output Specification:
Print two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*) — the index of the left and the index of the right ends of some k-good longest segment. If there are several longest segments you can print any of them. The elements in *a* are numbered from 1 to *n* from left to right.
Demo Input:
['5 5\n1 2 3 4 5\n', '9 3\n6 5 1 2 3 2 1 4 5\n', '3 1\n1 2 3\n']
Demo Output:
['1 5\n', '3 7\n', '1 1\n']
Note:
none | ```python
# n, r1, r2 = map(int, input().split())
# last_cities = list(map(int, input().split()))
# last_cities.insert(r1-1, f'r{r1}')
#
# paths = []
# saving = []
# dead_end = []
# for i in range(n):
# if i+1 == r2:
# saving.append(last_cities[i])
# if last_cities[i] == f'r{r1}':
# last_cities[i] = i + 1
# if i == r2-1:
# last_cities[i] = f'r{r2}'
# paths.append([i + 1, last_cities[i]])
# check = set(last_cities)
# for i in range(len(saving)): # Перебираем ветки
# prev_element = r2 # предыдущий. 5 изначально
# element = saving[i] # текущий. у которого будем изменять путь
# not_dead_end = True #для проверки на тупик
# index_branch = element - 1 # индекс того, у которого будем изменять
# while not_dead_end: # Пока не тупик или пока не пришли к нашей старой столице
# element = paths[index_branch][1]
# paths[index_branch][1], prev_element = prev_element, paths[index_branch][0]
# index_branch = element - 1
# if element == r1 and paths[index_branch][0] == paths[index_branch][1]: # если дошли до прошлой столицы, её нужно развернуть в напр текущей
# paths[index_branch][1] = prev_element
# break
# elif element == r1:
# break
# if element not in check:
# not_dead_end = False
# answer = ''
# for el in paths:
# if type(el[1]) != str:
# answer += f'{el[1]} '
# print(answer[:-1])
n, k = map(int, input().split())
segment = list(map(int, input().split()))
l_index = 0
r_index = -1
# r = n
turn = True
for l in range(n):
r = n
# if turn is True:
# print(segment[l:r])
# while len(set(segment[l:r])) > k:
# r -= 1
# else:
# while len(set(segment[l:r])) < k and r < n:
# r += 1
# turn = True
while len(set(segment[l:r])) > k:
r -= 1
# while len(set(segment[l:r])) <= k and r < n:
# r += 1
# turn = False
# turn = not turn
if r-l > r_index-l_index:
r_index = r
l_index = l
# if r-l > r_index-l_index and turn:
# r_index = r
# l_index = l
# elif r-l > r_index-l_index and not turn and l != n - :
# r_index = r - 1
# l_index = l
print(f"{l_index+1} {r_index}")
``` | 0 |
|
835 | C | Star sky | PROGRAMMING | 1,600 | [
"dp",
"implementation"
]
| null | null | The Cartesian coordinate system is set in the sky. There you can see *n* stars, the *i*-th has coordinates (*x**i*, *y**i*), a maximum brightness *c*, equal for all stars, and an initial brightness *s**i* (0<=≤<=*s**i*<=≤<=*c*).
Over time the stars twinkle. At moment 0 the *i*-th star has brightness *s**i*. Let at moment *t* some star has brightness *x*. Then at moment (*t*<=+<=1) this star will have brightness *x*<=+<=1, if *x*<=+<=1<=≤<=*c*, and 0, otherwise.
You want to look at the sky *q* times. In the *i*-th time you will look at the moment *t**i* and you will see a rectangle with sides parallel to the coordinate axes, the lower left corner has coordinates (*x*1*i*, *y*1*i*) and the upper right — (*x*2*i*, *y*2*i*). For each view, you want to know the total brightness of the stars lying in the viewed rectangle.
A star lies in a rectangle if it lies on its border or lies strictly inside it. | The first line contains three integers *n*, *q*, *c* (1<=≤<=*n*,<=*q*<=≤<=105, 1<=≤<=*c*<=≤<=10) — the number of the stars, the number of the views and the maximum brightness of the stars.
The next *n* lines contain the stars description. The *i*-th from these lines contains three integers *x**i*, *y**i*, *s**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=100, 0<=≤<=*s**i*<=≤<=*c*<=≤<=10) — the coordinates of *i*-th star and its initial brightness.
The next *q* lines contain the views description. The *i*-th from these lines contains five integers *t**i*, *x*1*i*, *y*1*i*, *x*2*i*, *y*2*i* (0<=≤<=*t**i*<=≤<=109, 1<=≤<=*x*1*i*<=<<=*x*2*i*<=≤<=100, 1<=≤<=*y*1*i*<=<<=*y*2*i*<=≤<=100) — the moment of the *i*-th view and the coordinates of the viewed rectangle. | For each view print the total brightness of the viewed stars. | [
"2 3 3\n1 1 1\n3 2 0\n2 1 1 2 2\n0 2 1 4 5\n5 1 1 5 5\n",
"3 4 5\n1 1 2\n2 3 0\n3 3 1\n0 1 1 100 100\n1 2 2 4 4\n2 2 1 4 7\n1 50 50 51 51\n"
]
| [
"3\n0\n3\n",
"3\n3\n5\n0\n"
]
| Let's consider the first example.
At the first view, you can see only the first star. At moment 2 its brightness is 3, so the answer is 3.
At the second view, you can see only the second star. At moment 0 its brightness is 0, so the answer is 0.
At the third view, you can see both stars. At moment 5 brightness of the first is 2, and brightness of the second is 1, so the answer is 3. | 1,250 | [
{
"input": "2 3 3\n1 1 1\n3 2 0\n2 1 1 2 2\n0 2 1 4 5\n5 1 1 5 5",
"output": "3\n0\n3"
},
{
"input": "3 4 5\n1 1 2\n2 3 0\n3 3 1\n0 1 1 100 100\n1 2 2 4 4\n2 2 1 4 7\n1 50 50 51 51",
"output": "3\n3\n5\n0"
}
]
| 1,604,235,029 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 233 | 6,041,600 | from sys import stdin, stdout
n,q,c=map(int,stdin.readline().split())
cs=[[[0]*101 for _ in range(101)] for _ in range(11)]
lx=1000000000
hx=0
ly=1000000000
hy=0
for k in range(n):
x,y,s=map(int,stdin.readline().split())
cs[s][x][y]=1
for i in range(1,101):
for j in range(1,101):
for k in range(11):
cs[k][i][j]=max(cs[k][i][j]+cs[k][i-1][j-1],cs[k][i][j]+cs[k][i-1][j],cs[k][i][j]+cs[k][i][j-1])
for _ in range(q):
t,x1,y1,x2,y2=map(int,stdin.readline().split())
totalb=0
for k in range(11):
totalb+=((k+t)%(c+1))*(cs[k][x2][y2]-cs[k][x2][y1-1]-cs[k][x1-1][y2]+cs[k][x1-1][y1-1])
print(totalb) | Title: Star sky
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Cartesian coordinate system is set in the sky. There you can see *n* stars, the *i*-th has coordinates (*x**i*, *y**i*), a maximum brightness *c*, equal for all stars, and an initial brightness *s**i* (0<=≤<=*s**i*<=≤<=*c*).
Over time the stars twinkle. At moment 0 the *i*-th star has brightness *s**i*. Let at moment *t* some star has brightness *x*. Then at moment (*t*<=+<=1) this star will have brightness *x*<=+<=1, if *x*<=+<=1<=≤<=*c*, and 0, otherwise.
You want to look at the sky *q* times. In the *i*-th time you will look at the moment *t**i* and you will see a rectangle with sides parallel to the coordinate axes, the lower left corner has coordinates (*x*1*i*, *y*1*i*) and the upper right — (*x*2*i*, *y*2*i*). For each view, you want to know the total brightness of the stars lying in the viewed rectangle.
A star lies in a rectangle if it lies on its border or lies strictly inside it.
Input Specification:
The first line contains three integers *n*, *q*, *c* (1<=≤<=*n*,<=*q*<=≤<=105, 1<=≤<=*c*<=≤<=10) — the number of the stars, the number of the views and the maximum brightness of the stars.
The next *n* lines contain the stars description. The *i*-th from these lines contains three integers *x**i*, *y**i*, *s**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=100, 0<=≤<=*s**i*<=≤<=*c*<=≤<=10) — the coordinates of *i*-th star and its initial brightness.
The next *q* lines contain the views description. The *i*-th from these lines contains five integers *t**i*, *x*1*i*, *y*1*i*, *x*2*i*, *y*2*i* (0<=≤<=*t**i*<=≤<=109, 1<=≤<=*x*1*i*<=<<=*x*2*i*<=≤<=100, 1<=≤<=*y*1*i*<=<<=*y*2*i*<=≤<=100) — the moment of the *i*-th view and the coordinates of the viewed rectangle.
Output Specification:
For each view print the total brightness of the viewed stars.
Demo Input:
['2 3 3\n1 1 1\n3 2 0\n2 1 1 2 2\n0 2 1 4 5\n5 1 1 5 5\n', '3 4 5\n1 1 2\n2 3 0\n3 3 1\n0 1 1 100 100\n1 2 2 4 4\n2 2 1 4 7\n1 50 50 51 51\n']
Demo Output:
['3\n0\n3\n', '3\n3\n5\n0\n']
Note:
Let's consider the first example.
At the first view, you can see only the first star. At moment 2 its brightness is 3, so the answer is 3.
At the second view, you can see only the second star. At moment 0 its brightness is 0, so the answer is 0.
At the third view, you can see both stars. At moment 5 brightness of the first is 2, and brightness of the second is 1, so the answer is 3. | ```python
from sys import stdin, stdout
n,q,c=map(int,stdin.readline().split())
cs=[[[0]*101 for _ in range(101)] for _ in range(11)]
lx=1000000000
hx=0
ly=1000000000
hy=0
for k in range(n):
x,y,s=map(int,stdin.readline().split())
cs[s][x][y]=1
for i in range(1,101):
for j in range(1,101):
for k in range(11):
cs[k][i][j]=max(cs[k][i][j]+cs[k][i-1][j-1],cs[k][i][j]+cs[k][i-1][j],cs[k][i][j]+cs[k][i][j-1])
for _ in range(q):
t,x1,y1,x2,y2=map(int,stdin.readline().split())
totalb=0
for k in range(11):
totalb+=((k+t)%(c+1))*(cs[k][x2][y2]-cs[k][x2][y1-1]-cs[k][x1-1][y2]+cs[k][x1-1][y1-1])
print(totalb)
``` | 0 |
|
344 | A | Magnets | PROGRAMMING | 800 | [
"implementation"
]
| null | null | Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other.
Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own.
Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed. | The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position. | On the single line of the output print the number of groups of magnets. | [
"6\n10\n10\n10\n01\n10\n10\n",
"4\n01\n01\n10\n10\n"
]
| [
"3\n",
"2\n"
]
| The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets.
The second testcase has two groups, each consisting of two magnets. | 500 | [
{
"input": "6\n10\n10\n10\n01\n10\n10",
"output": "3"
},
{
"input": "4\n01\n01\n10\n10",
"output": "2"
},
{
"input": "1\n10",
"output": "1"
},
{
"input": "2\n01\n10",
"output": "2"
},
{
"input": "2\n10\n10",
"output": "1"
},
{
"input": "3\n10\n01\n10",
"output": "3"
},
{
"input": "1\n01",
"output": "1"
},
{
"input": "2\n01\n01",
"output": "1"
},
{
"input": "2\n10\n01",
"output": "2"
},
{
"input": "3\n01\n01\n01",
"output": "1"
},
{
"input": "3\n10\n10\n01",
"output": "2"
},
{
"input": "3\n01\n10\n10",
"output": "2"
},
{
"input": "115\n10\n10\n10\n10\n01\n01\n10\n10\n10\n01\n01\n10\n01\n01\n10\n10\n10\n01\n10\n01\n10\n10\n01\n01\n10\n10\n10\n10\n01\n10\n01\n01\n10\n10\n10\n10\n01\n10\n10\n10\n01\n10\n01\n10\n10\n10\n10\n01\n01\n01\n10\n10\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n10\n10\n01\n10\n01\n01\n01\n01\n01\n10\n01\n10\n10\n01\n01\n01\n10\n01\n01\n10\n10\n01\n01\n01\n01\n01\n10\n01\n10\n01\n10\n01\n01\n01\n10\n01\n10\n10\n01\n10\n10\n01\n01\n01\n10\n10\n10\n10\n10\n10\n10\n10",
"output": "55"
}
]
| 1,698,617,901 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 6 | 1,000 | 10,956,800 | n = int(input())
s = 1
c = [input()]
for i in range(1, n):
c.append(input())
if c[i-1] != c[i]:
s += 1
print(s)
| Title: Magnets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mad scientist Mike entertains himself by arranging rows of dominoes. He doesn't need dominoes, though: he uses rectangular magnets instead. Each magnet has two poles, positive (a "plus") and negative (a "minus"). If two magnets are put together at a close distance, then the like poles will repel each other and the opposite poles will attract each other.
Mike starts by laying one magnet horizontally on the table. During each following step Mike adds one more magnet horizontally to the right end of the row. Depending on how Mike puts the magnet on the table, it is either attracted to the previous one (forming a group of multiple magnets linked together) or repelled by it (then Mike lays this magnet at some distance to the right from the previous one). We assume that a sole magnet not linked to others forms a group of its own.
Mike arranged multiple magnets in a row. Determine the number of groups that the magnets formed.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100000) — the number of magnets. Then *n* lines follow. The *i*-th line (1<=≤<=*i*<=≤<=*n*) contains either characters "01", if Mike put the *i*-th magnet in the "plus-minus" position, or characters "10", if Mike put the magnet in the "minus-plus" position.
Output Specification:
On the single line of the output print the number of groups of magnets.
Demo Input:
['6\n10\n10\n10\n01\n10\n10\n', '4\n01\n01\n10\n10\n']
Demo Output:
['3\n', '2\n']
Note:
The first testcase corresponds to the figure. The testcase has three groups consisting of three, one and two magnets.
The second testcase has two groups, each consisting of two magnets. | ```python
n = int(input())
s = 1
c = [input()]
for i in range(1, n):
c.append(input())
if c[i-1] != c[i]:
s += 1
print(s)
``` | 0 |
|
186 | A | Comparing Strings | PROGRAMMING | 1,100 | [
"implementation",
"strings"
]
| null | null | Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not. | The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length. | Print "YES", if the dwarves belong to the same race. Otherwise, print "NO". | [
"ab\nba\n",
"aa\nab\n"
]
| [
"YES\n",
"NO\n"
]
| - First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b". | 500 | [
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "aa\nab",
"output": "NO"
},
{
"input": "a\nza",
"output": "NO"
},
{
"input": "vvea\nvvae",
"output": "YES"
},
{
"input": "rtfabanpc\natfabrnpc",
"output": "YES"
},
{
"input": "mt\ntm",
"output": "YES"
},
{
"input": "qxolmbkkt\naovlajmlf",
"output": "NO"
},
{
"input": "b\ng",
"output": "NO"
},
{
"input": "ab\naba",
"output": "NO"
},
{
"input": "ba\na",
"output": "NO"
},
{
"input": "a\nab",
"output": "NO"
},
{
"input": "a\naa",
"output": "NO"
},
{
"input": "a\nz",
"output": "NO"
},
{
"input": "aabb\nbbaa",
"output": "NO"
},
{
"input": "ab\nbd",
"output": "NO"
},
{
"input": "bac\ndae",
"output": "NO"
},
{
"input": "abc\nakl",
"output": "NO"
},
{
"input": "cb\naa",
"output": "NO"
},
{
"input": "abaab\naabba",
"output": "NO"
},
{
"input": "aab\naaa",
"output": "NO"
},
{
"input": "abcde\nedcba",
"output": "NO"
},
{
"input": "abab\nbaba",
"output": "NO"
},
{
"input": "ab\nbac",
"output": "NO"
},
{
"input": "abcd\naqcb",
"output": "NO"
},
{
"input": "abc\nbad",
"output": "NO"
},
{
"input": "ab\nca",
"output": "NO"
},
{
"input": "abc\nab",
"output": "NO"
},
{
"input": "ab\nbae",
"output": "NO"
},
{
"input": "aaaabcccca\naaaadccccb",
"output": "NO"
},
{
"input": "acaa\nabca",
"output": "NO"
},
{
"input": "aba\naab",
"output": "YES"
},
{
"input": "ah\nla",
"output": "NO"
},
{
"input": "aab\naa",
"output": "NO"
},
{
"input": "abab\nabcd",
"output": "NO"
},
{
"input": "ed\nab",
"output": "NO"
}
]
| 1,611,831,606 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 30 | 340 | 6,144,000 | l1=list(input())
l2=list(input())
l1.sort(reverse=True)
l2.sort(reverse=True)
print("YES" if l1==l2 else "NO") | Title: Comparing Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
Input Specification:
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Output Specification:
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
Demo Input:
['ab\nba\n', 'aa\nab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b". | ```python
l1=list(input())
l2=list(input())
l1.sort(reverse=True)
l2.sort(reverse=True)
print("YES" if l1==l2 else "NO")
``` | 0 |
|
863 | C | 1-2-3 | PROGRAMMING | 1,800 | [
"graphs",
"implementation"
]
| null | null | Ilya is working for the company that constructs robots. Ilya writes programs for entertainment robots, and his current project is "Bob", a new-generation game robot. Ilya's boss wants to know his progress so far. Especially he is interested if Bob is better at playing different games than the previous model, "Alice".
So now Ilya wants to compare his robots' performance in a simple game called "1-2-3". This game is similar to the "Rock-Paper-Scissors" game: both robots secretly choose a number from the set {1,<=2,<=3} and say it at the same moment. If both robots choose the same number, then it's a draw and noone gets any points. But if chosen numbers are different, then one of the robots gets a point: 3 beats 2, 2 beats 1 and 1 beats 3.
Both robots' programs make them choose their numbers in such a way that their choice in (*i*<=+<=1)-th game depends only on the numbers chosen by them in *i*-th game.
Ilya knows that the robots will play *k* games, Alice will choose number *a* in the first game, and Bob will choose *b* in the first game. He also knows both robots' programs and can tell what each robot will choose depending on their choices in previous game. Ilya doesn't want to wait until robots play all *k* games, so he asks you to predict the number of points they will have after the final game. | The first line contains three numbers *k*, *a*, *b* (1<=≤<=*k*<=≤<=1018, 1<=≤<=*a*,<=*b*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *A**i*,<=1, *A**i*,<=2, *A**i*,<=3, where *A**i*,<=*j* represents Alice's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*A**i*,<=*j*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *B**i*,<=1, *B**i*,<=2, *B**i*,<=3, where *B**i*,<=*j* represents Bob's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*B**i*,<=*j*<=≤<=3). | Print two numbers. First of them has to be equal to the number of points Alice will have, and second of them must be Bob's score after *k* games. | [
"10 2 1\n1 1 1\n1 1 1\n1 1 1\n2 2 2\n2 2 2\n2 2 2\n",
"8 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3\n",
"5 1 1\n1 2 2\n2 2 2\n2 2 2\n1 2 2\n2 2 2\n2 2 2\n"
]
| [
"1 9\n",
"5 2\n",
"0 0\n"
]
| In the second example game goes like this:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e21b6e200707470571d69c9946ace6b56f5279b.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The fourth and the seventh game are won by Bob, the first game is draw and the rest are won by Alice. | 0 | [
{
"input": "10 2 1\n1 1 1\n1 1 1\n1 1 1\n2 2 2\n2 2 2\n2 2 2",
"output": "1 9"
},
{
"input": "8 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3",
"output": "5 2"
},
{
"input": "5 1 1\n1 2 2\n2 2 2\n2 2 2\n1 2 2\n2 2 2\n2 2 2",
"output": "0 0"
},
{
"input": "1 1 1\n3 3 1\n1 1 1\n3 2 2\n2 2 2\n1 3 1\n3 3 2",
"output": "0 0"
},
{
"input": "1 3 1\n1 3 3\n2 3 2\n2 1 3\n1 3 2\n3 3 2\n3 1 1",
"output": "0 1"
},
{
"input": "10 2 1\n2 2 1\n3 2 2\n3 1 3\n3 1 3\n1 2 2\n3 3 2",
"output": "8 1"
},
{
"input": "10 1 2\n1 1 2\n2 1 2\n1 3 1\n2 3 3\n3 2 2\n3 2 1",
"output": "3 5"
},
{
"input": "1000000 2 3\n3 1 1\n3 1 1\n1 2 2\n3 1 1\n3 1 1\n1 1 3",
"output": "0 333334"
},
{
"input": "1000000 1 3\n1 2 3\n2 1 2\n2 1 2\n1 2 3\n1 1 1\n2 3 3",
"output": "999998 1"
},
{
"input": "1000000000000 1 3\n3 1 1\n3 2 1\n2 2 2\n2 2 1\n1 2 2\n1 1 3",
"output": "500000000001 499999999998"
},
{
"input": "1000000000000 3 2\n2 3 3\n2 1 2\n1 1 1\n2 3 1\n1 3 3\n3 3 3",
"output": "500000000001 499999999999"
},
{
"input": "1000000000000000000 2 3\n1 3 1\n2 3 3\n2 2 2\n1 2 3\n3 1 2\n2 2 2",
"output": "1 500000000000000000"
},
{
"input": "999999999999999999 2 2\n2 3 2\n2 1 2\n1 3 3\n2 2 2\n1 3 2\n1 2 1",
"output": "499999999999999999 0"
},
{
"input": "1000000000000000000 2 1\n3 1 2\n2 3 3\n1 2 3\n2 2 3\n1 1 3\n2 3 2",
"output": "1000000000000000000 0"
},
{
"input": "1000000000000000000 3 3\n2 1 3\n1 2 3\n1 3 2\n3 2 2\n3 1 3\n3 3 1",
"output": "750000000000000000 0"
},
{
"input": "1000000000000000000 3 1\n2 3 2\n2 2 1\n2 3 3\n3 3 3\n2 1 1\n1 2 1",
"output": "500000000000000000 1"
},
{
"input": "478359268475263455 1 1\n3 2 3\n2 3 3\n2 1 1\n3 3 3\n2 3 3\n1 3 1",
"output": "0 0"
},
{
"input": "837264528963824683 3 3\n3 1 1\n1 3 1\n1 3 1\n3 2 1\n2 3 3\n2 2 2",
"output": "0 837264528963824682"
},
{
"input": "129341234876124184 1 2\n1 3 3\n1 1 2\n1 2 3\n3 1 1\n3 1 3\n3 2 3",
"output": "64670617438062091 64670617438062093"
},
{
"input": "981267318925341267 3 2\n1 2 1\n3 2 2\n3 3 3\n3 2 2\n2 2 3\n2 2 1",
"output": "981267318925341267 0"
},
{
"input": "12 2 2\n1 1 2\n2 2 3\n3 3 1\n2 3 1\n2 3 1\n2 3 1",
"output": "3 5"
},
{
"input": "3 1 3\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "3 0"
},
{
"input": "3 2 2\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "0 1"
},
{
"input": "67 1 1\n1 1 2\n2 2 3\n3 3 1\n2 3 1\n2 3 1\n2 3 1",
"output": "23 22"
},
{
"input": "4991 1 2\n1 1 2\n2 2 3\n3 1 3\n2 3 1\n2 3 1\n2 1 3",
"output": "1872 1872"
},
{
"input": "3 1 1\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "1 1"
},
{
"input": "4 1 1\n1 1 2\n2 2 3\n3 3 1\n2 3 1\n2 3 1\n2 3 1",
"output": "2 1"
},
{
"input": "1 2 1\n1 2 3\n1 3 2\n2 1 3\n1 2 3\n3 3 3\n2 1 3",
"output": "1 0"
},
{
"input": "1000000000002 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3",
"output": "666666666668 333333333333"
},
{
"input": "1000000000005 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3",
"output": "666666666670 333333333334"
},
{
"input": "4 3 1\n1 1 2\n2 1 3\n3 3 3\n2 3 1\n1 1 3\n3 3 3",
"output": "0 1"
}
]
| 1,564,386,163 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 7 | 140 | 1,228,800 | def kek(a, b):
if a == b:
return ([0, 0])
elif a == 3 and b == 1:
return ([0, 1])
elif a == 1 and b == 3:
return ([1, 0])
elif a == 1 and b == 2:
return ([0, 1])
elif a == 2 and b == 1:
return ([1, 0])
elif a == 2 and b == 3:
return ([0, 1])
elif a == 3 and b == 2:
return ([1, 0])
k, a1, b1 = map(int, input().split())
a, b = [], []
for i in range(3):
a.append([int(i) for i in input().split()])
for i in range(3):
b.append([int(i) for i in input().split()])
n, m = [], []
n.append([a1, b1])
m.append(kek(a1, b1))
i = 1
ansb, ansa = 0, 0
while i != k:
i += 1
a1, b1 = a[a1 - 1][b1 - 1], b[a1 - 1][b1 - 1]
t = [a1, b1]
if t not in n:
n.append([a1, b1])
m.append(kek(a1, b1))
m[-1][0] += m[-2][0]
m[-1][1] += m[-2][1]
else:
break
if i == k:
print(*m[-1])
else:
ansa, ansb = m[-1][0], m[-1][1]
i -= 1
for j in range(len(n)):
if n[j] == [a1, b1]:
t = j
break
while i + len(n) - t <= k:
if t != 0:
ansa += m[-1][0] - m[t - 1][0]
ansb += m[-1][1] - m[t - 1][1]
else:
ansa += m[-1][0]
ansb += m[-1][1]
i += len(n) - t
for j in range(k - i):
a1, b1 = a[a1 - 1][b1 - 1], b[a1 - 1][b1 - 1]
tmp = kek(a1, b1)
ansa += tmp[0]
ansb += tmp[1]
print(ansa, ansb)
| Title: 1-2-3
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya is working for the company that constructs robots. Ilya writes programs for entertainment robots, and his current project is "Bob", a new-generation game robot. Ilya's boss wants to know his progress so far. Especially he is interested if Bob is better at playing different games than the previous model, "Alice".
So now Ilya wants to compare his robots' performance in a simple game called "1-2-3". This game is similar to the "Rock-Paper-Scissors" game: both robots secretly choose a number from the set {1,<=2,<=3} and say it at the same moment. If both robots choose the same number, then it's a draw and noone gets any points. But if chosen numbers are different, then one of the robots gets a point: 3 beats 2, 2 beats 1 and 1 beats 3.
Both robots' programs make them choose their numbers in such a way that their choice in (*i*<=+<=1)-th game depends only on the numbers chosen by them in *i*-th game.
Ilya knows that the robots will play *k* games, Alice will choose number *a* in the first game, and Bob will choose *b* in the first game. He also knows both robots' programs and can tell what each robot will choose depending on their choices in previous game. Ilya doesn't want to wait until robots play all *k* games, so he asks you to predict the number of points they will have after the final game.
Input Specification:
The first line contains three numbers *k*, *a*, *b* (1<=≤<=*k*<=≤<=1018, 1<=≤<=*a*,<=*b*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *A**i*,<=1, *A**i*,<=2, *A**i*,<=3, where *A**i*,<=*j* represents Alice's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*A**i*,<=*j*<=≤<=3).
Then 3 lines follow, *i*-th of them containing 3 numbers *B**i*,<=1, *B**i*,<=2, *B**i*,<=3, where *B**i*,<=*j* represents Bob's choice in the game if Alice chose *i* in previous game and Bob chose *j* (1<=≤<=*B**i*,<=*j*<=≤<=3).
Output Specification:
Print two numbers. First of them has to be equal to the number of points Alice will have, and second of them must be Bob's score after *k* games.
Demo Input:
['10 2 1\n1 1 1\n1 1 1\n1 1 1\n2 2 2\n2 2 2\n2 2 2\n', '8 1 1\n2 2 1\n3 3 1\n3 1 3\n1 1 1\n2 1 1\n1 2 3\n', '5 1 1\n1 2 2\n2 2 2\n2 2 2\n1 2 2\n2 2 2\n2 2 2\n']
Demo Output:
['1 9\n', '5 2\n', '0 0\n']
Note:
In the second example game goes like this:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e21b6e200707470571d69c9946ace6b56f5279b.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The fourth and the seventh game are won by Bob, the first game is draw and the rest are won by Alice. | ```python
def kek(a, b):
if a == b:
return ([0, 0])
elif a == 3 and b == 1:
return ([0, 1])
elif a == 1 and b == 3:
return ([1, 0])
elif a == 1 and b == 2:
return ([0, 1])
elif a == 2 and b == 1:
return ([1, 0])
elif a == 2 and b == 3:
return ([0, 1])
elif a == 3 and b == 2:
return ([1, 0])
k, a1, b1 = map(int, input().split())
a, b = [], []
for i in range(3):
a.append([int(i) for i in input().split()])
for i in range(3):
b.append([int(i) for i in input().split()])
n, m = [], []
n.append([a1, b1])
m.append(kek(a1, b1))
i = 1
ansb, ansa = 0, 0
while i != k:
i += 1
a1, b1 = a[a1 - 1][b1 - 1], b[a1 - 1][b1 - 1]
t = [a1, b1]
if t not in n:
n.append([a1, b1])
m.append(kek(a1, b1))
m[-1][0] += m[-2][0]
m[-1][1] += m[-2][1]
else:
break
if i == k:
print(*m[-1])
else:
ansa, ansb = m[-1][0], m[-1][1]
i -= 1
for j in range(len(n)):
if n[j] == [a1, b1]:
t = j
break
while i + len(n) - t <= k:
if t != 0:
ansa += m[-1][0] - m[t - 1][0]
ansb += m[-1][1] - m[t - 1][1]
else:
ansa += m[-1][0]
ansb += m[-1][1]
i += len(n) - t
for j in range(k - i):
a1, b1 = a[a1 - 1][b1 - 1], b[a1 - 1][b1 - 1]
tmp = kek(a1, b1)
ansa += tmp[0]
ansb += tmp[1]
print(ansa, ansb)
``` | 0 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
]
| A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
]
| [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
]
| none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
]
| 1,662,425,794 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 102 | 62 | 0 | def main():
x = input()
y = input()
res = ''
for i in range(len(x)):
if((x[i] == '0' and y[i] == '0') or (x[i] == '1' and y[i] == '1')):
res+='0'
else:
res+='1'
print(res)
if __name__ == '__main__':
main() | Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
def main():
x = input()
y = input()
res = ''
for i in range(len(x)):
if((x[i] == '0' and y[i] == '0') or (x[i] == '1' and y[i] == '1')):
res+='0'
else:
res+='1'
print(res)
if __name__ == '__main__':
main()
``` | 3.9845 |
747 | C | Servers | PROGRAMMING | 1,300 | [
"implementation"
]
| null | null | There are *n* servers in a laboratory, each of them can perform tasks. Each server has a unique id — integer from 1 to *n*.
It is known that during the day *q* tasks will come, the *i*-th of them is characterized with three integers: *t**i* — the moment in seconds in which the task will come, *k**i* — the number of servers needed to perform it, and *d**i* — the time needed to perform this task in seconds. All *t**i* are distinct.
To perform the *i*-th task you need *k**i* servers which are unoccupied in the second *t**i*. After the servers begin to perform the task, each of them will be busy over the next *d**i* seconds. Thus, they will be busy in seconds *t**i*,<=*t**i*<=+<=1,<=...,<=*t**i*<=+<=*d**i*<=-<=1. For performing the task, *k**i* servers with the smallest ids will be chosen from all the unoccupied servers. If in the second *t**i* there are not enough unoccupied servers, the task is ignored.
Write the program that determines which tasks will be performed and which will be ignored. | The first line contains two positive integers *n* and *q* (1<=≤<=*n*<=≤<=100, 1<=≤<=*q*<=≤<=105) — the number of servers and the number of tasks.
Next *q* lines contains three integers each, the *i*-th line contains integers *t**i*, *k**i* and *d**i* (1<=≤<=*t**i*<=≤<=106, 1<=≤<=*k**i*<=≤<=*n*, 1<=≤<=*d**i*<=≤<=1000) — the moment in seconds in which the *i*-th task will come, the number of servers needed to perform it, and the time needed to perform this task in seconds. The tasks are given in a chronological order and they will come in distinct seconds. | Print *q* lines. If the *i*-th task will be performed by the servers, print in the *i*-th line the sum of servers' ids on which this task will be performed. Otherwise, print -1. | [
"4 3\n1 3 2\n2 2 1\n3 4 3\n",
"3 2\n3 2 3\n5 1 2\n",
"8 6\n1 3 20\n4 2 1\n6 5 5\n10 1 1\n15 3 6\n21 8 8\n"
]
| [
"6\n-1\n10\n",
"3\n3\n",
"6\n9\n30\n-1\n15\n36\n"
]
| In the first example in the second 1 the first task will come, it will be performed on the servers with ids 1, 2 and 3 (the sum of the ids equals 6) during two seconds. In the second 2 the second task will come, it will be ignored, because only the server 4 will be unoccupied at that second. In the second 3 the third task will come. By this time, servers with the ids 1, 2 and 3 will be unoccupied again, so the third task will be done on all the servers with the ids 1, 2, 3 and 4 (the sum of the ids is 10).
In the second example in the second 3 the first task will come, it will be performed on the servers with ids 1 and 2 (the sum of the ids is 3) during three seconds. In the second 5 the second task will come, it will be performed on the server 3, because the first two servers will be busy performing the first task. | 1,500 | [
{
"input": "4 3\n1 3 2\n2 2 1\n3 4 3",
"output": "6\n-1\n10"
},
{
"input": "3 2\n3 2 3\n5 1 2",
"output": "3\n3"
},
{
"input": "8 6\n1 3 20\n4 2 1\n6 5 5\n10 1 1\n15 3 6\n21 8 8",
"output": "6\n9\n30\n-1\n15\n36"
},
{
"input": "4 1\n6 1 1",
"output": "1"
},
{
"input": "1 10\n4 1 1\n9 1 1\n10 1 1\n12 1 1\n13 1 1\n15 1 1\n16 1 1\n18 1 1\n19 1 1\n20 1 1",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1"
},
{
"input": "4 10\n1 1 1\n3 1 2\n4 1 2\n6 1 2\n8 1 2\n13 1 2\n16 1 1\n17 1 2\n19 3 1\n20 1 1",
"output": "1\n1\n2\n1\n1\n1\n1\n1\n6\n1"
},
{
"input": "100 1\n1000000 100 1000",
"output": "5050"
},
{
"input": "5 3\n1 4 10\n2 2 5\n3 1 6",
"output": "10\n-1\n5"
},
{
"input": "4 5\n1 2 3\n2 1 3\n3 1 2\n4 3 3\n5 4 1",
"output": "3\n3\n4\n-1\n10"
},
{
"input": "5 3\n1 4 4\n4 2 2\n5 5 2",
"output": "10\n-1\n15"
},
{
"input": "10 4\n1 5 20\n2 5 200\n100 6 20\n101 1 100",
"output": "15\n40\n-1\n1"
},
{
"input": "8 6\n1 3 20\n4 2 1\n6 6 5\n9 1 1\n15 3 6\n21 8 8",
"output": "6\n9\n-1\n4\n15\n36"
},
{
"input": "5 4\n1 1 4\n2 4 4\n5 2 20\n11 5 2",
"output": "1\n14\n-1\n15"
},
{
"input": "8 4\n1 3 2\n2 3 100\n10 6 20\n11 5 20",
"output": "6\n15\n-1\n21"
},
{
"input": "5 3\n1 3 4\n4 3 4\n6 4 1",
"output": "6\n-1\n10"
},
{
"input": "4 3\n1 3 10\n2 2 15\n12 4 1",
"output": "6\n-1\n10"
}
]
| 1,533,579,687 | 4,587 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 7 | 2,000 | 307,200 | n, q = map(int, input().split())
qs = []
ans = [0] * q
used = [0] * n
for _ in range(q):
t, k, d = map(int, input().split())
less = min(sum(used[i] <= t for i in range(n)), k)
if less >= k:
for i in range(n):
if less == 0: break
if used[i] <= t:
used[i] = t + d
ans[_] += i + 1
less -= 1
else:
ans[_] = -1
print("\n".join(map(str, ans)))
| Title: Servers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* servers in a laboratory, each of them can perform tasks. Each server has a unique id — integer from 1 to *n*.
It is known that during the day *q* tasks will come, the *i*-th of them is characterized with three integers: *t**i* — the moment in seconds in which the task will come, *k**i* — the number of servers needed to perform it, and *d**i* — the time needed to perform this task in seconds. All *t**i* are distinct.
To perform the *i*-th task you need *k**i* servers which are unoccupied in the second *t**i*. After the servers begin to perform the task, each of them will be busy over the next *d**i* seconds. Thus, they will be busy in seconds *t**i*,<=*t**i*<=+<=1,<=...,<=*t**i*<=+<=*d**i*<=-<=1. For performing the task, *k**i* servers with the smallest ids will be chosen from all the unoccupied servers. If in the second *t**i* there are not enough unoccupied servers, the task is ignored.
Write the program that determines which tasks will be performed and which will be ignored.
Input Specification:
The first line contains two positive integers *n* and *q* (1<=≤<=*n*<=≤<=100, 1<=≤<=*q*<=≤<=105) — the number of servers and the number of tasks.
Next *q* lines contains three integers each, the *i*-th line contains integers *t**i*, *k**i* and *d**i* (1<=≤<=*t**i*<=≤<=106, 1<=≤<=*k**i*<=≤<=*n*, 1<=≤<=*d**i*<=≤<=1000) — the moment in seconds in which the *i*-th task will come, the number of servers needed to perform it, and the time needed to perform this task in seconds. The tasks are given in a chronological order and they will come in distinct seconds.
Output Specification:
Print *q* lines. If the *i*-th task will be performed by the servers, print in the *i*-th line the sum of servers' ids on which this task will be performed. Otherwise, print -1.
Demo Input:
['4 3\n1 3 2\n2 2 1\n3 4 3\n', '3 2\n3 2 3\n5 1 2\n', '8 6\n1 3 20\n4 2 1\n6 5 5\n10 1 1\n15 3 6\n21 8 8\n']
Demo Output:
['6\n-1\n10\n', '3\n3\n', '6\n9\n30\n-1\n15\n36\n']
Note:
In the first example in the second 1 the first task will come, it will be performed on the servers with ids 1, 2 and 3 (the sum of the ids equals 6) during two seconds. In the second 2 the second task will come, it will be ignored, because only the server 4 will be unoccupied at that second. In the second 3 the third task will come. By this time, servers with the ids 1, 2 and 3 will be unoccupied again, so the third task will be done on all the servers with the ids 1, 2, 3 and 4 (the sum of the ids is 10).
In the second example in the second 3 the first task will come, it will be performed on the servers with ids 1 and 2 (the sum of the ids is 3) during three seconds. In the second 5 the second task will come, it will be performed on the server 3, because the first two servers will be busy performing the first task. | ```python
n, q = map(int, input().split())
qs = []
ans = [0] * q
used = [0] * n
for _ in range(q):
t, k, d = map(int, input().split())
less = min(sum(used[i] <= t for i in range(n)), k)
if less >= k:
for i in range(n):
if less == 0: break
if used[i] <= t:
used[i] = t + d
ans[_] += i + 1
less -= 1
else:
ans[_] = -1
print("\n".join(map(str, ans)))
``` | 0 |
|
339 | A | Helpful Maths | PROGRAMMING | 800 | [
"greedy",
"implementation",
"sortings",
"strings"
]
| null | null | Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum. | The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long. | Print the new sum that Xenia can count. | [
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
]
| [
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
]
| none | 500 | [
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
]
| 1,696,372,156 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 92 | 0 | word = input()
nos = []
for each in word:
if each != "+":
nos.append(int(each))
nos.sort()
ans = ""
for no in nos:
ans += str(no)+"+"
print(ans[:-1]) | Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none | ```python
word = input()
nos = []
for each in word:
if each != "+":
nos.append(int(each))
nos.sort()
ans = ""
for no in nos:
ans += str(no)+"+"
print(ans[:-1])
``` | 3 |
|
433 | B | Kuriyama Mirai's Stones | PROGRAMMING | 1,200 | [
"dp",
"implementation",
"sortings"
]
| null | null | Kuriyama Mirai has killed many monsters and got many (namely *n*) stones. She numbers the stones from 1 to *n*. The cost of the *i*-th stone is *v**i*. Kuriyama Mirai wants to know something about these stones so she will ask you two kinds of questions:
1. She will tell you two numbers, *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), and you should tell her . 1. Let *u**i* be the cost of the *i*-th cheapest stone (the cost that will be on the *i*-th place if we arrange all the stone costs in non-decreasing order). This time she will tell you two numbers, *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), and you should tell her .
For every question you should give the correct answer, or Kuriyama Mirai will say "fuyukai desu" and then become unhappy. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109) — costs of the stones.
The third line contains an integer *m* (1<=≤<=*m*<=≤<=105) — the number of Kuriyama Mirai's questions. Then follow *m* lines, each line contains three integers *type*, *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*; 1<=≤<=*type*<=≤<=2), describing a question. If *type* equal to 1, then you should output the answer for the first question, else you should output the answer for the second one. | Print *m* lines. Each line must contain an integer — the answer to Kuriyama Mirai's question. Print the answers to the questions in the order of input. | [
"6\n6 4 2 7 2 7\n3\n2 3 6\n1 3 4\n1 1 6\n",
"4\n5 5 2 3\n10\n1 2 4\n2 1 4\n1 1 1\n2 1 4\n2 1 2\n1 1 1\n1 3 3\n1 1 3\n1 4 4\n1 2 2\n"
]
| [
"24\n9\n28\n",
"10\n15\n5\n15\n5\n5\n2\n12\n3\n5\n"
]
| Please note that the answers to the questions may overflow 32-bit integer type. | 1,500 | [
{
"input": "6\n6 4 2 7 2 7\n3\n2 3 6\n1 3 4\n1 1 6",
"output": "24\n9\n28"
},
{
"input": "4\n5 5 2 3\n10\n1 2 4\n2 1 4\n1 1 1\n2 1 4\n2 1 2\n1 1 1\n1 3 3\n1 1 3\n1 4 4\n1 2 2",
"output": "10\n15\n5\n15\n5\n5\n2\n12\n3\n5"
},
{
"input": "4\n2 2 3 6\n9\n2 2 3\n1 1 3\n2 2 3\n2 2 3\n2 2 2\n1 1 3\n1 1 3\n2 1 4\n1 1 2",
"output": "5\n7\n5\n5\n2\n7\n7\n13\n4"
},
{
"input": "18\n26 46 56 18 78 88 86 93 13 77 21 84 59 61 5 74 72 52\n25\n1 10 10\n1 9 13\n2 13 17\n1 8 14\n2 2 6\n1 12 16\n2 15 17\n2 3 6\n1 3 13\n2 8 9\n2 17 17\n1 17 17\n2 5 10\n2 1 18\n1 4 16\n1 1 13\n1 1 8\n2 7 11\n2 6 12\n1 5 9\n1 4 5\n2 7 15\n1 8 8\n1 8 14\n1 3 7",
"output": "77\n254\n413\n408\n124\n283\n258\n111\n673\n115\n88\n72\n300\n1009\n757\n745\n491\n300\n420\n358\n96\n613\n93\n408\n326"
},
{
"input": "56\n43 100 44 66 65 11 26 75 96 77 5 15 75 96 11 44 11 97 75 53 33 26 32 33 90 26 68 72 5 44 53 26 33 88 68 25 84 21 25 92 1 84 21 66 94 35 76 51 11 95 67 4 61 3 34 18\n27\n1 20 38\n1 11 46\n2 42 53\n1 8 11\n2 11 42\n2 35 39\n2 37 41\n1 48 51\n1 32 51\n1 36 40\n1 31 56\n1 18 38\n2 9 51\n1 7 48\n1 15 52\n1 27 31\n2 5 19\n2 35 50\n1 31 34\n1 2 7\n2 15 33\n2 46 47\n1 26 28\n2 3 29\n1 23 45\n2 29 55\n1 14 29",
"output": "880\n1727\n1026\n253\n1429\n335\n350\n224\n1063\n247\n1236\n1052\n2215\n2128\n1840\n242\n278\n1223\n200\n312\n722\n168\n166\n662\n1151\n2028\n772"
},
{
"input": "18\n38 93 48 14 69 85 26 47 71 11 57 9 38 65 72 78 52 47\n38\n2 10 12\n1 6 18\n2 2 2\n1 3 15\n2 1 16\n2 5 13\n1 9 17\n1 2 15\n2 5 17\n1 15 15\n2 4 11\n2 3 4\n2 2 5\n2 1 17\n2 6 16\n2 8 16\n2 8 14\n1 9 12\n2 8 13\n2 1 14\n2 5 13\n1 2 3\n1 9 14\n2 12 15\n2 3 3\n2 9 13\n2 4 12\n2 11 14\n2 6 16\n1 8 14\n1 12 15\n2 3 4\n1 3 5\n2 4 14\n1 6 6\n2 7 14\n2 7 18\n1 8 12",
"output": "174\n658\n11\n612\n742\n461\n453\n705\n767\n72\n353\n40\n89\n827\n644\n559\n409\n148\n338\n592\n461\n141\n251\n277\n14\n291\n418\n262\n644\n298\n184\n40\n131\n558\n85\n456\n784\n195"
},
{
"input": "1\n2\n10\n1 1 1\n1 1 1\n2 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n2 1 1\n1 1 1\n1 1 1",
"output": "2\n2\n2\n2\n2\n2\n2\n2\n2\n2"
},
{
"input": "2\n1 5\n8\n2 1 2\n1 1 1\n1 1 2\n1 1 1\n2 2 2\n2 1 2\n1 1 1\n1 2 2",
"output": "6\n1\n6\n1\n5\n6\n1\n5"
},
{
"input": "8\n2 6 4 6 8 4 7 7\n9\n2 6 8\n1 2 3\n2 3 4\n2 1 2\n2 4 5\n1 3 8\n2 4 4\n2 2 4\n1 2 4",
"output": "22\n10\n10\n6\n12\n36\n6\n14\n16"
},
{
"input": "4\n1 1 2 8\n9\n1 2 4\n1 2 4\n1 1 2\n2 3 4\n2 1 1\n1 2 3\n2 3 4\n1 1 4\n1 1 4",
"output": "11\n11\n2\n10\n1\n3\n10\n12\n12"
},
{
"input": "5\n8 8 1 10 7\n5\n1 2 2\n1 1 4\n1 3 3\n1 2 2\n1 2 5",
"output": "8\n27\n1\n8\n26"
},
{
"input": "10\n10 3 3 2 1 2 7 1 1 1\n4\n2 10 10\n2 6 6\n1 5 10\n1 6 8",
"output": "10\n2\n13\n10"
},
{
"input": "6\n6 6 3 8 5 4\n3\n2 2 3\n2 1 5\n1 1 5",
"output": "9\n24\n28"
},
{
"input": "1\n1\n2\n1 1 1\n2 1 1",
"output": "1\n1"
}
]
| 1,638,670,178 | 2,147,483,647 | Python 3 | OK | TESTS | 46 | 1,044 | 8,806,400 |
n = int(input())
serie = input().split()
m = int(input())
serie_ordenada = []
for i in range(n):
serie[i] = int(serie[i])
serie_ordenada.append(serie[i])
serie_ordenada = sorted(serie)
for o in range(1, n):
serie[o] = serie[o] + serie[o - 1]
serie_ordenada[o] = serie_ordenada[o] + serie_ordenada[o - 1]
for e in range(m):
comando, inicio,fim = input().split()
inicio = int(inicio) - 2
fim = int(fim) - 1
if comando == '1':
if inicio == - 1: print(serie[fim])
else: print(serie[fim] - serie[inicio])
else:
if inicio == - 1: print(serie_ordenada[fim])
else: print(serie_ordenada[fim] - serie_ordenada[inicio])
| Title: Kuriyama Mirai's Stones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kuriyama Mirai has killed many monsters and got many (namely *n*) stones. She numbers the stones from 1 to *n*. The cost of the *i*-th stone is *v**i*. Kuriyama Mirai wants to know something about these stones so she will ask you two kinds of questions:
1. She will tell you two numbers, *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), and you should tell her . 1. Let *u**i* be the cost of the *i*-th cheapest stone (the cost that will be on the *i*-th place if we arrange all the stone costs in non-decreasing order). This time she will tell you two numbers, *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), and you should tell her .
For every question you should give the correct answer, or Kuriyama Mirai will say "fuyukai desu" and then become unhappy.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109) — costs of the stones.
The third line contains an integer *m* (1<=≤<=*m*<=≤<=105) — the number of Kuriyama Mirai's questions. Then follow *m* lines, each line contains three integers *type*, *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*; 1<=≤<=*type*<=≤<=2), describing a question. If *type* equal to 1, then you should output the answer for the first question, else you should output the answer for the second one.
Output Specification:
Print *m* lines. Each line must contain an integer — the answer to Kuriyama Mirai's question. Print the answers to the questions in the order of input.
Demo Input:
['6\n6 4 2 7 2 7\n3\n2 3 6\n1 3 4\n1 1 6\n', '4\n5 5 2 3\n10\n1 2 4\n2 1 4\n1 1 1\n2 1 4\n2 1 2\n1 1 1\n1 3 3\n1 1 3\n1 4 4\n1 2 2\n']
Demo Output:
['24\n9\n28\n', '10\n15\n5\n15\n5\n5\n2\n12\n3\n5\n']
Note:
Please note that the answers to the questions may overflow 32-bit integer type. | ```python
n = int(input())
serie = input().split()
m = int(input())
serie_ordenada = []
for i in range(n):
serie[i] = int(serie[i])
serie_ordenada.append(serie[i])
serie_ordenada = sorted(serie)
for o in range(1, n):
serie[o] = serie[o] + serie[o - 1]
serie_ordenada[o] = serie_ordenada[o] + serie_ordenada[o - 1]
for e in range(m):
comando, inicio,fim = input().split()
inicio = int(inicio) - 2
fim = int(fim) - 1
if comando == '1':
if inicio == - 1: print(serie[fim])
else: print(serie[fim] - serie[inicio])
else:
if inicio == - 1: print(serie_ordenada[fim])
else: print(serie_ordenada[fim] - serie_ordenada[inicio])
``` | 3 |
|
385 | B | Bear and Strings | PROGRAMMING | 1,200 | [
"brute force",
"greedy",
"implementation",
"math",
"strings"
]
| null | null | The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem. | The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters. | Print a single number — the answer to the problem. | [
"bearbtear\n",
"bearaabearc\n"
]
| [
"6\n",
"20\n"
]
| In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | 1,000 | [
{
"input": "bearbtear",
"output": "6"
},
{
"input": "bearaabearc",
"output": "20"
},
{
"input": "pbearbearhbearzqbearjkterasjhy",
"output": "291"
},
{
"input": "pbearjbearbebearnbabcffbearbearwubearjezpiorrbearbearjbdlbearbearqbearjbearwipmsbearoaftrsebearzsnqb",
"output": "4419"
},
{
"input": "bear",
"output": "1"
},
{
"input": "a",
"output": "0"
},
{
"input": "be",
"output": "0"
}
]
| 1,595,697,685 | 2,147,483,647 | PyPy 3 | OK | TESTS | 43 | 155 | 21,606,400 | s = input()
pos = [-1]
x = 'bear'
for i in range(len(s)-3):
if s[i:i+4] == x:
pos.append(i)
count = 0
n = len(s)
if len(pos) > 1:
for i in range(1, len(pos)):
k = n - pos[i] - 3
count += k*(pos[i]-pos[i-1])
print(count) | Title: Bear and Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
Input Specification:
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['bearbtear\n', 'bearaabearc\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | ```python
s = input()
pos = [-1]
x = 'bear'
for i in range(len(s)-3):
if s[i:i+4] == x:
pos.append(i)
count = 0
n = len(s)
if len(pos) > 1:
for i in range(1, len(pos)):
k = n - pos[i] - 3
count += k*(pos[i]-pos[i-1])
print(count)
``` | 3 |
|
466 | A | Cheap Travel | PROGRAMMING | 1,200 | [
"implementation"
]
| null | null | Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides? | The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket. | Print a single integer — the minimum sum in rubles that Ann will need to spend. | [
"6 2 1 2\n",
"5 2 2 3\n"
]
| [
"6\n",
"8\n"
]
| In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets. | 500 | [
{
"input": "6 2 1 2",
"output": "6"
},
{
"input": "5 2 2 3",
"output": "8"
},
{
"input": "10 3 5 1",
"output": "4"
},
{
"input": "1000 1 1000 1000",
"output": "1000000"
},
{
"input": "1000 3 1000 1000",
"output": "334000"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "10 2 1 1",
"output": "5"
},
{
"input": "1 1000 1 2",
"output": "1"
},
{
"input": "1 1000 3 2",
"output": "2"
},
{
"input": "10 3 1 2",
"output": "7"
},
{
"input": "995 1 2 1",
"output": "995"
},
{
"input": "556 2 16 15",
"output": "4170"
},
{
"input": "477 2 16 14",
"output": "3346"
},
{
"input": "101 110 1 100",
"output": "100"
},
{
"input": "9 3 3 10",
"output": "27"
},
{
"input": "100 8 10 1",
"output": "13"
},
{
"input": "6 4 1 3",
"output": "5"
},
{
"input": "8 5 2 8",
"output": "14"
},
{
"input": "1000 2 1 1000",
"output": "1000"
}
]
| 1,687,891,872 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 31 | 0 | n,m,a,b=map(int,list(input().split()))
d_min=(n//m*b)+(n%m)*a
print(d_min) | Title: Cheap Travel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides?
Input Specification:
The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket.
Output Specification:
Print a single integer — the minimum sum in rubles that Ann will need to spend.
Demo Input:
['6 2 1 2\n', '5 2 2 3\n']
Demo Output:
['6\n', '8\n']
Note:
In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets. | ```python
n,m,a,b=map(int,list(input().split()))
d_min=(n//m*b)+(n%m)*a
print(d_min)
``` | 0 |
|
462 | B | Appleman and Card Game | PROGRAMMING | 1,300 | [
"greedy"
]
| null | null | Appleman has *n* cards. Each card has an uppercase letter written on it. Toastman must choose *k* cards from Appleman's cards. Then Appleman should give Toastman some coins depending on the chosen cards. Formally, for each Toastman's card *i* you should calculate how much Toastman's cards have the letter equal to letter on *i*th, then sum up all these quantities, such a number of coins Appleman should give to Toastman.
Given the description of Appleman's cards. What is the maximum number of coins Toastman can get? | The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The next line contains *n* uppercase letters without spaces — the *i*-th letter describes the *i*-th card of the Appleman. | Print a single integer – the answer to the problem. | [
"15 10\nDZFDFZDFDDDDDDF\n",
"6 4\nYJSNPI\n"
]
| [
"82\n",
"4\n"
]
| In the first test example Toastman can choose nine cards with letter D and one additional card with any letter. For each card with D he will get 9 coins and for the additional card he will get 1 coin. | 1,000 | [
{
"input": "15 10\nDZFDFZDFDDDDDDF",
"output": "82"
},
{
"input": "6 4\nYJSNPI",
"output": "4"
},
{
"input": "5 3\nAOWBY",
"output": "3"
},
{
"input": "1 1\nV",
"output": "1"
},
{
"input": "2 1\nWT",
"output": "1"
},
{
"input": "2 2\nBL",
"output": "2"
},
{
"input": "5 1\nFACJT",
"output": "1"
},
{
"input": "5 5\nMJDIJ",
"output": "7"
},
{
"input": "15 5\nAZBIPTOFTJCJJIK",
"output": "13"
},
{
"input": "100 1\nEVEEVEEEGGECFEHEFVFVFHVHEEEEEFCVEEEEEEVFVEEVEEHEEVEFEVVEFEEEFEVECEHGHEEFGEEVCEECCECEFHEVEEEEEEGEEHVH",
"output": "1"
},
{
"input": "100 15\nKKTFFUTFCKUIKKKKFIFFKTUKUUKUKKIKKKTIFKTKUCFFKKKIIKKKKKKTFKFKKIRKKKFKUUKIKUUUFFKKKKTUZKITUIKKIKUKKTIK",
"output": "225"
},
{
"input": "100 50\nYYIYYAAAIEAAYAYAEAIIIAAEAAYEAEYYYIAEYAYAYYAAAIAYAEAAYAYYIYAAYYAAAAAAIYYYAAYAAEAAYAIEIYIYAYAYAYIIAAEY",
"output": "1972"
},
{
"input": "100 90\nFAFAOOAOOAFAOTFAFAFFATAAAOFAAOAFBAAAFBOAOFFFOAOAFAPFOFAOFAAFOAAAAFAAFOFAAOFPPAAOOAAOOFFOFFFOFAOTOFAF",
"output": "2828"
},
{
"input": "100 99\nBFFBBFBFBQFFFFFQBFFBFFBQFBFQFBBFQFFFBFFFBFQFQFBFFBBFYQFBFFFFFFFBQQFQBFBQBQFFFBQQFFFBQFYFBFBFFFBBBQQY",
"output": "3713"
},
{
"input": "100 100\nMQSBDAJABILIBCUEOWGWCEXMUTEYQKAIWGINXVQEOFDUBSVULROQHQRZZAALVQFEFRAAAYUIMGCAFQGIAEFBETRECGSFQJNXHHDN",
"output": "514"
},
{
"input": "100 50\nBMYIXQSJNHGFVFPJBIOBXIKSFNUFPVODCUBQYSIIQNVNXXCWXWRHKFEUPPIIDDGRDBJLZDCBMNJMYRMWFIHOSTDJJHXHPNRKWNFD",
"output": "328"
},
{
"input": "100 50\nENFNEMLJEMDMFMNNGNIMNINALGLLLAEMENEMNLMMIEIJNAINBJEJMFJLLIMINELGFLAIAMJMHMGNLIEFJIEEFEFGLLLDLMEAEIMM",
"output": "748"
}
]
| 1,609,581,802 | 2,147,483,647 | PyPy 3 | OK | TESTS | 41 | 155 | 1,843,200 | n, k = map(int, input().strip().split())
strs = input()
d= {}
for x in range(n):
if strs[x] not in d:
d[strs[x]] = 1
else:
d[strs[x]] += 1
s = sorted(d.items(), key=lambda x: x[1], reverse=True)
count = 0
for i in range(len(s)):
z = min(s[i][1],k)
count += z*z
k -= z
if k == 0:
print(count)
break
| Title: Appleman and Card Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Appleman has *n* cards. Each card has an uppercase letter written on it. Toastman must choose *k* cards from Appleman's cards. Then Appleman should give Toastman some coins depending on the chosen cards. Formally, for each Toastman's card *i* you should calculate how much Toastman's cards have the letter equal to letter on *i*th, then sum up all these quantities, such a number of coins Appleman should give to Toastman.
Given the description of Appleman's cards. What is the maximum number of coins Toastman can get?
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The next line contains *n* uppercase letters without spaces — the *i*-th letter describes the *i*-th card of the Appleman.
Output Specification:
Print a single integer – the answer to the problem.
Demo Input:
['15 10\nDZFDFZDFDDDDDDF\n', '6 4\nYJSNPI\n']
Demo Output:
['82\n', '4\n']
Note:
In the first test example Toastman can choose nine cards with letter D and one additional card with any letter. For each card with D he will get 9 coins and for the additional card he will get 1 coin. | ```python
n, k = map(int, input().strip().split())
strs = input()
d= {}
for x in range(n):
if strs[x] not in d:
d[strs[x]] = 1
else:
d[strs[x]] += 1
s = sorted(d.items(), key=lambda x: x[1], reverse=True)
count = 0
for i in range(len(s)):
z = min(s[i][1],k)
count += z*z
k -= z
if k == 0:
print(count)
break
``` | 3 |
|
328 | A | IQ Test | PROGRAMMING | 1,800 | [
"implementation"
]
| null | null | Petya is preparing for IQ test and he has noticed that there many problems like: you are given a sequence, find the next number. Now Petya can solve only problems with arithmetic or geometric progressions.
Arithmetic progression is a sequence *a*1, *a*1<=+<=*d*, *a*1<=+<=2*d*, ..., *a*1<=+<=(*n*<=-<=1)*d*, where *a*1 and *d* are any numbers.
Geometric progression is a sequence *b*1, *b*2<==<=*b*1*q*, ..., *b**n*<==<=*b**n*<=-<=1*q*, where *b*1<=≠<=0, *q*<=≠<=0, *q*<=≠<=1.
Help Petya and write a program to determine if the given sequence is arithmetic or geometric. Also it should found the next number. If the sequence is neither arithmetic nor geometric, print 42 (he thinks it is impossible to find better answer). You should also print 42 if the next element of progression is not integer. So answer is always integer. | The first line contains exactly four integer numbers between 1 and 1000, inclusively. | Print the required number. If the given sequence is arithmetic progression, print the next progression element. Similarly, if the given sequence is geometric progression, print the next progression element.
Print 42 if the given sequence is not an arithmetic or geometric progression. | [
"836 624 412 200\n",
"1 334 667 1000\n"
]
| [
"-12\n",
"1333\n"
]
| This problem contains very weak pretests! | 500 | [
{
"input": "836 624 412 200",
"output": "-12"
},
{
"input": "1 334 667 1000",
"output": "1333"
},
{
"input": "501 451 400 350",
"output": "42"
},
{
"input": "836 624 412 200",
"output": "-12"
},
{
"input": "1 334 667 1000",
"output": "1333"
},
{
"input": "11 234 457 680",
"output": "903"
},
{
"input": "640 431 222 13",
"output": "-196"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "1 10 100 1000",
"output": "10000"
},
{
"input": "3 18 108 648",
"output": "3888"
},
{
"input": "512 384 288 216",
"output": "162"
},
{
"input": "891 297 99 33",
"output": "11"
},
{
"input": "64 160 400 1000",
"output": "2500"
},
{
"input": "501 451 400 350",
"output": "42"
},
{
"input": "501 450 400 350",
"output": "42"
},
{
"input": "4 32 48 64",
"output": "42"
},
{
"input": "9 8 7 5",
"output": "42"
},
{
"input": "992 994 998 1000",
"output": "42"
},
{
"input": "2 6 6 8",
"output": "42"
},
{
"input": "2 4 8 8",
"output": "42"
},
{
"input": "2 4 6 14",
"output": "42"
},
{
"input": "2 12 4 14",
"output": "42"
},
{
"input": "2 4 4 2",
"output": "42"
},
{
"input": "1000 100 10 1",
"output": "42"
},
{
"input": "2 9 27 81",
"output": "42"
},
{
"input": "2 4 9 16",
"output": "42"
},
{
"input": "2 4 9 18",
"output": "42"
},
{
"input": "256 64 16 8",
"output": "42"
},
{
"input": "256 385 576 864",
"output": "42"
},
{
"input": "343 147 63 27",
"output": "42"
},
{
"input": "729 648 576 512",
"output": "42"
},
{
"input": "1000 980 960 941",
"output": "42"
},
{
"input": "2 5 10 16",
"output": "42"
},
{
"input": "1 2 3 10",
"output": "42"
},
{
"input": "24 36 54 81",
"output": "42"
},
{
"input": "1 2 4 8",
"output": "16"
},
{
"input": "16 24 36 54",
"output": "81"
},
{
"input": "8 4 2 1",
"output": "42"
},
{
"input": "16 8 4 2",
"output": "1"
},
{
"input": "32 16 8 4",
"output": "2"
},
{
"input": "10 11 12 12",
"output": "42"
},
{
"input": "1 2 10 20",
"output": "42"
},
{
"input": "27 9 3 1",
"output": "42"
},
{
"input": "81 108 144 192",
"output": "256"
},
{
"input": "2 3 4 6",
"output": "42"
},
{
"input": "1000 500 170 40",
"output": "42"
}
]
| 1,689,769,538 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 8 | 92 | 0 | x=list(map(int,input().split()))
if(x[1]/x[0] == x[2]/x[1] == x[3]/x[1]):
print(x[3]*x[1]//x[0])
elif(x[1]-x[0] == x[2]-x[1] == x[3]-x[2]):
print(x[3]+x[1]-x[0])
else:
print(42)
| Title: IQ Test
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya is preparing for IQ test and he has noticed that there many problems like: you are given a sequence, find the next number. Now Petya can solve only problems with arithmetic or geometric progressions.
Arithmetic progression is a sequence *a*1, *a*1<=+<=*d*, *a*1<=+<=2*d*, ..., *a*1<=+<=(*n*<=-<=1)*d*, where *a*1 and *d* are any numbers.
Geometric progression is a sequence *b*1, *b*2<==<=*b*1*q*, ..., *b**n*<==<=*b**n*<=-<=1*q*, where *b*1<=≠<=0, *q*<=≠<=0, *q*<=≠<=1.
Help Petya and write a program to determine if the given sequence is arithmetic or geometric. Also it should found the next number. If the sequence is neither arithmetic nor geometric, print 42 (he thinks it is impossible to find better answer). You should also print 42 if the next element of progression is not integer. So answer is always integer.
Input Specification:
The first line contains exactly four integer numbers between 1 and 1000, inclusively.
Output Specification:
Print the required number. If the given sequence is arithmetic progression, print the next progression element. Similarly, if the given sequence is geometric progression, print the next progression element.
Print 42 if the given sequence is not an arithmetic or geometric progression.
Demo Input:
['836 624 412 200\n', '1 334 667 1000\n']
Demo Output:
['-12\n', '1333\n']
Note:
This problem contains very weak pretests! | ```python
x=list(map(int,input().split()))
if(x[1]/x[0] == x[2]/x[1] == x[3]/x[1]):
print(x[3]*x[1]//x[0])
elif(x[1]-x[0] == x[2]-x[1] == x[3]-x[2]):
print(x[3]+x[1]-x[0])
else:
print(42)
``` | 0 |
|
515 | C | Drazil and Factorial | PROGRAMMING | 1,400 | [
"greedy",
"math",
"sortings"
]
| null | null | Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes. | Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation. | [
"4\n1234\n",
"3\n555\n"
]
| [
"33222\n",
"555\n"
]
| In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 1,000 | [
{
"input": "4\n1234",
"output": "33222"
},
{
"input": "3\n555",
"output": "555"
},
{
"input": "15\n012345781234578",
"output": "7777553333222222222222"
},
{
"input": "1\n8",
"output": "7222"
},
{
"input": "10\n1413472614",
"output": "75333332222222"
},
{
"input": "8\n68931246",
"output": "77553333332222222"
},
{
"input": "7\n4424368",
"output": "75333332222222222"
},
{
"input": "6\n576825",
"output": "7755532222"
},
{
"input": "5\n97715",
"output": "7775332"
},
{
"input": "3\n915",
"output": "75332"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "15\n028745260720699",
"output": "7777755533333332222222222"
},
{
"input": "13\n5761790121605",
"output": "7775555333322"
},
{
"input": "10\n3312667105",
"output": "755533332"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "15\n989898989898989",
"output": "777777777777777333333333333333322222222222222222222222222222"
},
{
"input": "15\n000000000000007",
"output": "7"
},
{
"input": "15\n999999999999990",
"output": "77777777777777333333333333333333333333333322222222222222"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n6",
"output": "53"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "1\n9",
"output": "7332"
},
{
"input": "2\n09",
"output": "7332"
},
{
"input": "13\n1337251172966",
"output": "777555333333222"
},
{
"input": "15\n987654329876543",
"output": "777777555533333333332222222222222"
},
{
"input": "9\n234567899",
"output": "777755333333322222222"
},
{
"input": "2\n99",
"output": "77333322"
},
{
"input": "2\n66",
"output": "5533"
},
{
"input": "3\n999",
"output": "777333333222"
},
{
"input": "5\n99999",
"output": "77777333333333322222"
},
{
"input": "9\n123456789",
"output": "77755333332222222"
},
{
"input": "9\n987654321",
"output": "77755333332222222"
},
{
"input": "3\n666",
"output": "555333"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "6\n555777",
"output": "777555"
},
{
"input": "10\n1234567899",
"output": "777755333333322222222"
},
{
"input": "4\n6666",
"output": "55553333"
},
{
"input": "4\n9754",
"output": "775333222"
},
{
"input": "2\n95",
"output": "75332"
},
{
"input": "14\n11122233344455",
"output": "55333333222222222"
},
{
"input": "12\n836544897832",
"output": "77777553333333222222222222222"
}
]
| 1,661,853,702 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 0 | 77 | 5,222,400 | import math
import copy
import itertools
import bisect
import sys
input = sys.stdin.readline
def ilst():
return list(map(int,input().split()))
def inum():
return map(int,input().split())
n = int(input())
s = input()
ans = []
for i in s:
if i == '0' or i == '1':
continue
if int(i) == 8:
ans += ['7','2','2','2']
elif int(i) == 4:
ans += ['3','2','2']
else:
ans.append(i)
ans.sort(reverse = True)
print("".join(ans)) | Title: Drazil and Factorial
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
Output Specification:
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
Demo Input:
['4\n1234\n', '3\n555\n']
Demo Output:
['33222\n', '555\n']
Note:
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
import math
import copy
import itertools
import bisect
import sys
input = sys.stdin.readline
def ilst():
return list(map(int,input().split()))
def inum():
return map(int,input().split())
n = int(input())
s = input()
ans = []
for i in s:
if i == '0' or i == '1':
continue
if int(i) == 8:
ans += ['7','2','2','2']
elif int(i) == 4:
ans += ['3','2','2']
else:
ans.append(i)
ans.sort(reverse = True)
print("".join(ans))
``` | -1 |
|
785 | A | Anton and Polyhedrons | PROGRAMMING | 800 | [
"implementation",
"strings"
]
| null | null | Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. | Output one number — the total number of faces in all the polyhedrons in Anton's collection. | [
"4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n",
"3\nDodecahedron\nOctahedron\nOctahedron\n"
]
| [
"42\n",
"28\n"
]
| In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces. | 500 | [
{
"input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron",
"output": "42"
},
{
"input": "3\nDodecahedron\nOctahedron\nOctahedron",
"output": "28"
},
{
"input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron",
"output": "256"
},
{
"input": "1\nTetrahedron",
"output": "4"
},
{
"input": "1\nCube",
"output": "6"
},
{
"input": "1\nOctahedron",
"output": "8"
},
{
"input": "1\nDodecahedron",
"output": "12"
},
{
"input": "1\nIcosahedron",
"output": "20"
},
{
"input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron",
"output": "340"
}
]
| 1,676,918,948 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 295 | 0 | n = int(input())
sum_ = 0
for _ in range(n):
s = input()
if(s=="Tetrahedron"):
sum_+=4
elif s=="Cube":
sum_+= 6
elif s == "Octahedron":
sum_+=8
elif s == "Dodecahedron":
sum_+=12
elif s == "Icosahedron":
sum_+=20
print(sum_) | Title: Anton and Polyhedrons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output Specification:
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
Demo Input:
['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n']
Demo Output:
['42\n', '28\n']
Note:
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces. | ```python
n = int(input())
sum_ = 0
for _ in range(n):
s = input()
if(s=="Tetrahedron"):
sum_+=4
elif s=="Cube":
sum_+= 6
elif s == "Octahedron":
sum_+=8
elif s == "Dodecahedron":
sum_+=12
elif s == "Icosahedron":
sum_+=20
print(sum_)
``` | 3 |
|
372 | A | Counting Kangaroos is Fun | PROGRAMMING | 1,600 | [
"binary search",
"greedy",
"sortings",
"two pointers"
]
| null | null | There are *n* kangaroos with pockets. Each kangaroo has a size (integer number). A kangaroo can go into another kangaroo's pocket if and only if the size of kangaroo who hold the kangaroo is at least twice as large as the size of kangaroo who is held.
Each kangaroo can hold at most one kangaroo, and the kangaroo who is held by another kangaroo cannot hold any kangaroos.
The kangaroo who is held by another kangaroo cannot be visible from outside. Please, find a plan of holding kangaroos with the minimal number of kangaroos who is visible. | The first line contains a single integer — *n* (1<=≤<=*n*<=≤<=5·105). Each of the next *n* lines contains an integer *s**i* — the size of the *i*-th kangaroo (1<=≤<=*s**i*<=≤<=105). | Output a single integer — the optimal number of visible kangaroos. | [
"8\n2\n5\n7\n6\n9\n8\n4\n2\n",
"8\n9\n1\n6\n2\n6\n5\n8\n3\n"
]
| [
"5\n",
"5\n"
]
| none | 500 | [
{
"input": "8\n2\n5\n7\n6\n9\n8\n4\n2",
"output": "5"
},
{
"input": "8\n9\n1\n6\n2\n6\n5\n8\n3",
"output": "5"
},
{
"input": "12\n3\n99\n24\n46\n75\n63\n57\n55\n10\n62\n34\n52",
"output": "7"
},
{
"input": "12\n55\n75\n1\n98\n63\n64\n9\n39\n82\n18\n47\n9",
"output": "6"
},
{
"input": "100\n678\n771\n96\n282\n135\n749\n168\n668\n17\n658\n979\n446\n998\n331\n606\n756\n37\n515\n538\n205\n647\n547\n904\n842\n647\n286\n774\n414\n267\n791\n595\n465\n8\n327\n855\n174\n339\n946\n184\n250\n807\n422\n679\n980\n64\n530\n312\n351\n676\n911\n803\n991\n669\n50\n293\n841\n545\n598\n737\n894\n231\n754\n588\n83\n873\n767\n833\n482\n905\n903\n970\n571\n715\n59\n777\n697\n537\n861\n339\n212\n149\n889\n905\n70\n970\n307\n830\n465\n968\n291\n430\n317\n942\n944\n330\n235\n814\n880\n415\n76",
"output": "58"
},
{
"input": "100\n154\n60\n97\n638\n139\n150\n570\n579\n601\n647\n804\n237\n245\n549\n288\n347\n778\n282\n916\n441\n974\n145\n957\n886\n655\n702\n930\n618\n132\n520\n972\n48\n94\n54\n682\n433\n896\n134\n845\n636\n242\n842\n125\n141\n240\n130\n409\n666\n948\n938\n604\n110\n474\n484\n364\n40\n807\n271\n438\n288\n201\n814\n754\n589\n341\n576\n146\n952\n819\n923\n222\n535\n336\n83\n314\n911\n303\n911\n384\n601\n249\n330\n735\n271\n142\n204\n405\n783\n775\n449\n590\n139\n109\n276\n45\n205\n454\n836\n82\n841",
"output": "50"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n1\n1\n1\n2",
"output": "3"
},
{
"input": "5\n1\n2\n4\n8\n16",
"output": "3"
},
{
"input": "7\n1\n2\n4\n8\n16\n32\n64",
"output": "4"
},
{
"input": "3\n1\n2\n4",
"output": "2"
}
]
| 1,592,286,892 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 109 | 0 | n = int(input())
k = [int(input()) for _ in range(n)]
k.sort(reverse=True)
count = 0
half = n//2
last = 0
for i in range((n+1)//2):
for j in range(i, i+half+1):
if k[j] * 2 <= k[i]:
last = j
count += 1
break
print(n-count)
| Title: Counting Kangaroos is Fun
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* kangaroos with pockets. Each kangaroo has a size (integer number). A kangaroo can go into another kangaroo's pocket if and only if the size of kangaroo who hold the kangaroo is at least twice as large as the size of kangaroo who is held.
Each kangaroo can hold at most one kangaroo, and the kangaroo who is held by another kangaroo cannot hold any kangaroos.
The kangaroo who is held by another kangaroo cannot be visible from outside. Please, find a plan of holding kangaroos with the minimal number of kangaroos who is visible.
Input Specification:
The first line contains a single integer — *n* (1<=≤<=*n*<=≤<=5·105). Each of the next *n* lines contains an integer *s**i* — the size of the *i*-th kangaroo (1<=≤<=*s**i*<=≤<=105).
Output Specification:
Output a single integer — the optimal number of visible kangaroos.
Demo Input:
['8\n2\n5\n7\n6\n9\n8\n4\n2\n', '8\n9\n1\n6\n2\n6\n5\n8\n3\n']
Demo Output:
['5\n', '5\n']
Note:
none | ```python
n = int(input())
k = [int(input()) for _ in range(n)]
k.sort(reverse=True)
count = 0
half = n//2
last = 0
for i in range((n+1)//2):
for j in range(i, i+half+1):
if k[j] * 2 <= k[i]:
last = j
count += 1
break
print(n-count)
``` | 0 |
|
551 | A | GukiZ and Contest | PROGRAMMING | 800 | [
"brute force",
"implementation",
"sortings"
]
| null | null | Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected. | The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*). | In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input. | [
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
]
| [
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
]
| In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position. | 500 | [
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
]
| 1,606,919,493 | 2,147,483,647 | PyPy 3 | OK | TESTS | 36 | 202 | 3,686,400 | from collections import Counter
n=int(input())
a=[int(x) for x in input().split()]
freq=dict(Counter(a))
sa=list(set(a))
sa.sort(reverse=True)
count=0
rank={}
for i in sa:
rank[i]=count+1
count+=freq[i]
out=[]
for i in a:
out.append(rank[i])
for i in out:
print(i,end=' ')
print('') | Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position. | ```python
from collections import Counter
n=int(input())
a=[int(x) for x in input().split()]
freq=dict(Counter(a))
sa=list(set(a))
sa.sort(reverse=True)
count=0
rank={}
for i in sa:
rank[i]=count+1
count+=freq[i]
out=[]
for i in a:
out.append(rank[i])
for i in out:
print(i,end=' ')
print('')
``` | 3 |
|
735 | C | Tennis Championship | PROGRAMMING | 1,600 | [
"combinatorics",
"constructive algorithms",
"greedy",
"math"
]
| null | null | Famous Brazil city Rio de Janeiro holds a tennis tournament and Ostap Bender doesn't want to miss this event. There will be *n* players participating, and the tournament will follow knockout rules from the very first game. That means, that if someone loses a game he leaves the tournament immediately.
Organizers are still arranging tournament grid (i.e. the order games will happen and who is going to play with whom) but they have already fixed one rule: two players can play against each other only if the number of games one of them has already played differs by no more than one from the number of games the other one has already played. Of course, both players had to win all their games in order to continue participating in the tournament.
Tournament hasn't started yet so the audience is a bit bored. Ostap decided to find out what is the maximum number of games the winner of the tournament can take part in (assuming the rule above is used). However, it is unlikely he can deal with this problem without your help. | The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1018) — the number of players to participate in the tournament. | Print the maximum number of games in which the winner of the tournament can take part. | [
"2\n",
"3\n",
"4\n",
"10\n"
]
| [
"1\n",
"2\n",
"2\n",
"4\n"
]
| In all samples we consider that player number 1 is the winner.
In the first sample, there would be only one game so the answer is 1.
In the second sample, player 1 can consequently beat players 2 and 3.
In the third sample, player 1 can't play with each other player as after he plays with players 2 and 3 he can't play against player 4, as he has 0 games played, while player 1 already played 2. Thus, the answer is 2 and to achieve we make pairs (1, 2) and (3, 4) and then clash the winners. | 1,750 | [
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "2"
},
{
"input": "10",
"output": "4"
},
{
"input": "1000",
"output": "14"
},
{
"input": "2500",
"output": "15"
},
{
"input": "690000",
"output": "27"
},
{
"input": "3000000000",
"output": "45"
},
{
"input": "123456789123456789",
"output": "81"
},
{
"input": "5",
"output": "3"
},
{
"input": "143",
"output": "9"
},
{
"input": "144",
"output": "10"
},
{
"input": "145",
"output": "10"
},
{
"input": "232",
"output": "10"
},
{
"input": "233",
"output": "11"
},
{
"input": "234",
"output": "11"
},
{
"input": "679891637638612257",
"output": "84"
},
{
"input": "679891637638612258",
"output": "85"
},
{
"input": "679891637638612259",
"output": "85"
},
{
"input": "1000000000000000000",
"output": "85"
},
{
"input": "10235439547",
"output": "47"
},
{
"input": "1240723548",
"output": "43"
},
{
"input": "92353046212453",
"output": "66"
},
{
"input": "192403205846532",
"output": "68"
},
{
"input": "13925230525389",
"output": "62"
},
{
"input": "12048230592523",
"output": "62"
},
{
"input": "19204385325853",
"output": "63"
},
{
"input": "902353283921",
"output": "56"
},
{
"input": "793056859214355",
"output": "70"
},
{
"input": "982045466234565",
"output": "71"
},
{
"input": "126743950353465",
"output": "67"
},
{
"input": "12405430465",
"output": "47"
},
{
"input": "10238439257768",
"output": "61"
},
{
"input": "1728493055346",
"output": "58"
},
{
"input": "927553829046",
"output": "56"
},
{
"input": "62735129403",
"output": "51"
},
{
"input": "71624823950223",
"output": "65"
},
{
"input": "8902353464851212",
"output": "75"
},
{
"input": "61824012598535",
"output": "65"
},
{
"input": "1294902504603347",
"output": "71"
},
{
"input": "6",
"output": "3"
},
{
"input": "7",
"output": "3"
},
{
"input": "8",
"output": "4"
},
{
"input": "9",
"output": "4"
},
{
"input": "11",
"output": "4"
},
{
"input": "12",
"output": "4"
},
{
"input": "13",
"output": "5"
},
{
"input": "14",
"output": "5"
},
{
"input": "15",
"output": "5"
},
{
"input": "16",
"output": "5"
},
{
"input": "17",
"output": "5"
},
{
"input": "18",
"output": "5"
},
{
"input": "19",
"output": "5"
},
{
"input": "20",
"output": "5"
},
{
"input": "21",
"output": "6"
},
{
"input": "22",
"output": "6"
},
{
"input": "23",
"output": "6"
},
{
"input": "355687428096000",
"output": "69"
},
{
"input": "576460752303423488",
"output": "84"
},
{
"input": "32212254719",
"output": "49"
},
{
"input": "26388279066623",
"output": "63"
},
{
"input": "618473717761",
"output": "56"
},
{
"input": "262406072477",
"output": "54"
}
]
| 1,481,597,057 | 2,057 | Python 3 | WRONG_ANSWER | TESTS | 4 | 62 | 0 | import math
n = int(input())
v = math.ceil(math.log2(n))
print(v)
| Title: Tennis Championship
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Famous Brazil city Rio de Janeiro holds a tennis tournament and Ostap Bender doesn't want to miss this event. There will be *n* players participating, and the tournament will follow knockout rules from the very first game. That means, that if someone loses a game he leaves the tournament immediately.
Organizers are still arranging tournament grid (i.e. the order games will happen and who is going to play with whom) but they have already fixed one rule: two players can play against each other only if the number of games one of them has already played differs by no more than one from the number of games the other one has already played. Of course, both players had to win all their games in order to continue participating in the tournament.
Tournament hasn't started yet so the audience is a bit bored. Ostap decided to find out what is the maximum number of games the winner of the tournament can take part in (assuming the rule above is used). However, it is unlikely he can deal with this problem without your help.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1018) — the number of players to participate in the tournament.
Output Specification:
Print the maximum number of games in which the winner of the tournament can take part.
Demo Input:
['2\n', '3\n', '4\n', '10\n']
Demo Output:
['1\n', '2\n', '2\n', '4\n']
Note:
In all samples we consider that player number 1 is the winner.
In the first sample, there would be only one game so the answer is 1.
In the second sample, player 1 can consequently beat players 2 and 3.
In the third sample, player 1 can't play with each other player as after he plays with players 2 and 3 he can't play against player 4, as he has 0 games played, while player 1 already played 2. Thus, the answer is 2 and to achieve we make pairs (1, 2) and (3, 4) and then clash the winners. | ```python
import math
n = int(input())
v = math.ceil(math.log2(n))
print(v)
``` | 0 |
|
704 | A | Thor | PROGRAMMING | 1,600 | [
"brute force",
"data structures",
"implementation"
]
| null | null | Thor is getting used to the Earth. As a gift Loki gave him a smartphone. There are *n* applications on this phone. Thor is fascinated by this phone. He has only one minor issue: he can't count the number of unread notifications generated by those applications (maybe Loki put a curse on it so he can't).
*q* events are about to happen (in chronological order). They are of three types:
1. Application *x* generates a notification (this new notification is unread). 1. Thor reads all notifications generated so far by application *x* (he may re-read some notifications). 1. Thor reads the first *t* notifications generated by phone applications (notifications generated in first *t* events of the first type). It's guaranteed that there were at least *t* events of the first type before this event. Please note that he doesn't read first *t* unread notifications, he just reads the very first *t* notifications generated on his phone and he may re-read some of them in this operation.
Please help Thor and tell him the number of unread notifications after each event. You may assume that initially there are no notifications in the phone. | The first line of input contains two integers *n* and *q* (1<=≤<=*n*,<=*q*<=≤<=300<=000) — the number of applications and the number of events to happen.
The next *q* lines contain the events. The *i*-th of these lines starts with an integer *type**i* — type of the *i*-th event. If *type**i*<==<=1 or *type**i*<==<=2 then it is followed by an integer *x**i*. Otherwise it is followed by an integer *t**i* (1<=≤<=*type**i*<=≤<=3,<=1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*t**i*<=≤<=*q*). | Print the number of unread notifications after each event. | [
"3 4\n1 3\n1 1\n1 2\n2 3\n",
"4 6\n1 2\n1 4\n1 2\n3 3\n1 3\n1 3\n"
]
| [
"1\n2\n3\n2\n",
"1\n2\n3\n0\n1\n2\n"
]
| In the first sample:
1. Application 3 generates a notification (there is 1 unread notification). 1. Application 1 generates a notification (there are 2 unread notifications). 1. Application 2 generates a notification (there are 3 unread notifications). 1. Thor reads the notification generated by application 3, there are 2 unread notifications left.
In the second sample test:
1. Application 2 generates a notification (there is 1 unread notification). 1. Application 4 generates a notification (there are 2 unread notifications). 1. Application 2 generates a notification (there are 3 unread notifications). 1. Thor reads first three notifications and since there are only three of them so far, there will be no unread notification left. 1. Application 3 generates a notification (there is 1 unread notification). 1. Application 3 generates a notification (there are 2 unread notifications). | 500 | [
{
"input": "3 4\n1 3\n1 1\n1 2\n2 3",
"output": "1\n2\n3\n2"
},
{
"input": "4 6\n1 2\n1 4\n1 2\n3 3\n1 3\n1 3",
"output": "1\n2\n3\n0\n1\n2"
},
{
"input": "10 85\n2 2\n1 10\n1 1\n2 6\n1 2\n1 4\n1 7\n2 1\n1 1\n3 3\n1 9\n1 6\n1 8\n1 10\n3 8\n2 8\n1 6\n1 3\n1 9\n1 6\n1 3\n1 8\n1 1\n1 6\n1 10\n2 1\n2 10\n1 10\n1 1\n1 10\n1 6\n1 2\n1 8\n1 3\n1 4\n1 9\n1 5\n1 5\n2 2\n2 4\n1 7\n1 1\n2 4\n1 9\n1 1\n1 7\n1 8\n3 33\n1 10\n2 2\n1 3\n1 10\n1 6\n3 32\n2 3\n1 5\n2 10\n2 2\n2 4\n2 3\n3 16\n1 3\n2 2\n1 1\n3 18\n2 2\n2 5\n1 5\n1 9\n2 4\n1 3\n1 4\n1 3\n1 6\n1 10\n2 2\n1 7\n1 7\n2 8\n1 1\n3 1\n1 8\n1 10\n1 7\n1 8",
"output": "0\n1\n2\n2\n3\n4\n5\n4\n5\n3\n4\n5\n6\n7\n2\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n9\n7\n8\n9\n10\n11\n12\n13\n14\n15\n16\n17\n18\n17\n16\n17\n18\n18\n19\n20\n21\n22\n3\n4\n4\n5\n6\n7\n7\n6\n7\n5\n5\n5\n5\n5\n6\n6\n7\n7\n7\n6\n7\n8\n8\n9\n10\n11\n12\n13\n13\n14\n15\n14\n15\n15\n16\n17\n18\n19"
},
{
"input": "300000 1\n1 300000",
"output": "1"
}
]
| 1,470,816,439 | 2,147,483,647 | Python 3 | OK | TESTS | 99 | 1,153 | 34,713,600 | def main():
n, q = map(int, input().split())
vol, tot, l, res = [0] * (n + 1), [0] * (n + 1), [], []
z = m = 0
for _ in range(q):
t, x = map(int, input().split())
if t == 1:
l.append(x)
tot[x] += 1
vol[x] += 1
z += 1
elif t == 2:
z -= vol[x]
vol[x] = 0
else:
if m < x:
r, m = range(m, x), x
for i in r:
x = l[i]
tot[x] -= 1
if vol[x] > tot[x]:
vol[x] -= 1
z -= 1
res.append(z)
print('\n'.join(map(str, res)))
if __name__ == '__main__':
main()
| Title: Thor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Thor is getting used to the Earth. As a gift Loki gave him a smartphone. There are *n* applications on this phone. Thor is fascinated by this phone. He has only one minor issue: he can't count the number of unread notifications generated by those applications (maybe Loki put a curse on it so he can't).
*q* events are about to happen (in chronological order). They are of three types:
1. Application *x* generates a notification (this new notification is unread). 1. Thor reads all notifications generated so far by application *x* (he may re-read some notifications). 1. Thor reads the first *t* notifications generated by phone applications (notifications generated in first *t* events of the first type). It's guaranteed that there were at least *t* events of the first type before this event. Please note that he doesn't read first *t* unread notifications, he just reads the very first *t* notifications generated on his phone and he may re-read some of them in this operation.
Please help Thor and tell him the number of unread notifications after each event. You may assume that initially there are no notifications in the phone.
Input Specification:
The first line of input contains two integers *n* and *q* (1<=≤<=*n*,<=*q*<=≤<=300<=000) — the number of applications and the number of events to happen.
The next *q* lines contain the events. The *i*-th of these lines starts with an integer *type**i* — type of the *i*-th event. If *type**i*<==<=1 or *type**i*<==<=2 then it is followed by an integer *x**i*. Otherwise it is followed by an integer *t**i* (1<=≤<=*type**i*<=≤<=3,<=1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*t**i*<=≤<=*q*).
Output Specification:
Print the number of unread notifications after each event.
Demo Input:
['3 4\n1 3\n1 1\n1 2\n2 3\n', '4 6\n1 2\n1 4\n1 2\n3 3\n1 3\n1 3\n']
Demo Output:
['1\n2\n3\n2\n', '1\n2\n3\n0\n1\n2\n']
Note:
In the first sample:
1. Application 3 generates a notification (there is 1 unread notification). 1. Application 1 generates a notification (there are 2 unread notifications). 1. Application 2 generates a notification (there are 3 unread notifications). 1. Thor reads the notification generated by application 3, there are 2 unread notifications left.
In the second sample test:
1. Application 2 generates a notification (there is 1 unread notification). 1. Application 4 generates a notification (there are 2 unread notifications). 1. Application 2 generates a notification (there are 3 unread notifications). 1. Thor reads first three notifications and since there are only three of them so far, there will be no unread notification left. 1. Application 3 generates a notification (there is 1 unread notification). 1. Application 3 generates a notification (there are 2 unread notifications). | ```python
def main():
n, q = map(int, input().split())
vol, tot, l, res = [0] * (n + 1), [0] * (n + 1), [], []
z = m = 0
for _ in range(q):
t, x = map(int, input().split())
if t == 1:
l.append(x)
tot[x] += 1
vol[x] += 1
z += 1
elif t == 2:
z -= vol[x]
vol[x] = 0
else:
if m < x:
r, m = range(m, x), x
for i in r:
x = l[i]
tot[x] -= 1
if vol[x] > tot[x]:
vol[x] -= 1
z -= 1
res.append(z)
print('\n'.join(map(str, res)))
if __name__ == '__main__':
main()
``` | 3 |
|
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
]
| A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
]
| [
"house\n",
"VIP\n",
"matrix\n"
]
| none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
]
| 1,642,068,152 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 62 | 0 | s = input()
a = 0
b = 0
for i in range(len(s)):
if s[i].islower():
a += 1
elif s[i].isupper():
b += 1
if a<b:
print(s.upper())
elif b<a:
print(s.lower())
elif a==b:
print(s.upper())
| Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
s = input()
a = 0
b = 0
for i in range(len(s)):
if s[i].islower():
a += 1
elif s[i].isupper():
b += 1
if a<b:
print(s.upper())
elif b<a:
print(s.lower())
elif a==b:
print(s.upper())
``` | 0 |
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
]
| A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
]
| [
"house\n",
"VIP\n",
"matrix\n"
]
| none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
]
| 1,659,033,682 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 30 | 124 | 0 | strr = input()
cntA,cnta = 0,0
for ch in strr:
if ch>='A' and ch<='Z':
cntA+=1
else:
cnta+=1
if(cntA>cnta):
print(strr.upper())
else:
print(strr.lower())
| Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
strr = input()
cntA,cnta = 0,0
for ch in strr:
if ch>='A' and ch<='Z':
cntA+=1
else:
cnta+=1
if(cntA>cnta):
print(strr.upper())
else:
print(strr.lower())
``` | 3.969 |
102 | B | Sum of Digits | PROGRAMMING | 1,000 | [
"implementation"
]
| B. Sum of Digits | 2 | 265 | Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit? | The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes. | Print the number of times a number can be replaced by the sum of its digits until it only contains one digit. | [
"0\n",
"10\n",
"991\n"
]
| [
"0\n",
"1\n",
"3\n"
]
| In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit. | 1,000 | [
{
"input": "0",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "991",
"output": "3"
},
{
"input": "99",
"output": "2"
},
{
"input": "100",
"output": "1"
},
{
"input": "123456789",
"output": "2"
},
{
"input": "32",
"output": "1"
},
{
"input": "86",
"output": "2"
},
{
"input": "2",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "34",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "28",
"output": "2"
},
{
"input": "23",
"output": "1"
},
{
"input": "57",
"output": "2"
},
{
"input": "29",
"output": "2"
},
{
"input": "353869285",
"output": "3"
},
{
"input": "549548646",
"output": "2"
},
{
"input": "858893424",
"output": "2"
},
{
"input": "644818852",
"output": "3"
},
{
"input": "360322525",
"output": "3"
},
{
"input": "122937520",
"output": "2"
},
{
"input": "288403032",
"output": "2"
},
{
"input": "677257481",
"output": "3"
},
{
"input": "58059561",
"output": "3"
},
{
"input": "211288847",
"output": "2"
},
{
"input": "339900034079539584",
"output": "2"
},
{
"input": "784084029310269952",
"output": "3"
},
{
"input": "774730557264864000",
"output": "3"
},
{
"input": "478233807148352256",
"output": "3"
},
{
"input": "165646874056812544",
"output": "3"
},
{
"input": "477533739511673792",
"output": "3"
},
{
"input": "660119944377002240",
"output": "3"
},
{
"input": "448375218506078080",
"output": "3"
},
{
"input": "77213334785795616",
"output": "3"
},
{
"input": "165767221702271872",
"output": "3"
},
{
"input": "1",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561",
"output": "3"
},
{
"input": "9",
"output": "0"
}
]
| 1,627,962,535 | 2,147,483,647 | PyPy 3 | OK | TESTS | 51 | 248 | 22,016,000 | n = input()
c = 0
while len(str(n))>1:
n = sum(map(int,str(n)))
c+=1
print(c) | Title: Sum of Digits
Time Limit: 2 seconds
Memory Limit: 265 megabytes
Problem Description:
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
Input Specification:
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Output Specification:
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
Demo Input:
['0\n', '10\n', '991\n']
Demo Output:
['0\n', '1\n', '3\n']
Note:
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit. | ```python
n = input()
c = 0
while len(str(n))>1:
n = sum(map(int,str(n)))
c+=1
print(c)
``` | 3.898385 |
96 | A | Football | PROGRAMMING | 900 | [
"implementation",
"strings"
]
| A. Football | 2 | 256 | Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not. | The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field. | Print "YES" if the situation is dangerous. Otherwise, print "NO". | [
"001001\n",
"1000000001\n"
]
| [
"NO\n",
"YES\n"
]
| none | 500 | [
{
"input": "001001",
"output": "NO"
},
{
"input": "1000000001",
"output": "YES"
},
{
"input": "00100110111111101",
"output": "YES"
},
{
"input": "11110111111111111",
"output": "YES"
},
{
"input": "01",
"output": "NO"
},
{
"input": "10100101",
"output": "NO"
},
{
"input": "1010010100000000010",
"output": "YES"
},
{
"input": "101010101",
"output": "NO"
},
{
"input": "000000000100000000000110101100000",
"output": "YES"
},
{
"input": "100001000000110101100000",
"output": "NO"
},
{
"input": "100001000011010110000",
"output": "NO"
},
{
"input": "010",
"output": "NO"
},
{
"input": "10101011111111111111111111111100",
"output": "YES"
},
{
"input": "1001101100",
"output": "NO"
},
{
"input": "1001101010",
"output": "NO"
},
{
"input": "1111100111",
"output": "NO"
},
{
"input": "00110110001110001111",
"output": "NO"
},
{
"input": "11110001001111110001",
"output": "NO"
},
{
"input": "10001111001011111101",
"output": "NO"
},
{
"input": "10000010100000001000110001010100001001001010011",
"output": "YES"
},
{
"input": "01111011111010111100101100001011001010111110000010",
"output": "NO"
},
{
"input": "00100000100100101110011001011011101110110110010100",
"output": "NO"
},
{
"input": "10110100110001001011110101110010100010000000000100101010111110111110100011",
"output": "YES"
},
{
"input": "00011101010101111001011011001101101011111101000010100000111000011100101011",
"output": "NO"
},
{
"input": "01110000110100110101110100111000101101011101011110110100100111100001110111",
"output": "NO"
},
{
"input": "11110110011000100111100111101101011111110100010101011011111101110110110111",
"output": "YES"
},
{
"input": "100100010101110010001011001110100011100010011110100101100011010001001010001001101111001100",
"output": "NO"
},
{
"input": "111110010001011010010011111100110110001111000010100011011100111101111101110010101111011110000001010",
"output": "NO"
},
{
"input": "111110111100010100000100001010111011101011000111011011011010110010100010000101011111000011010011110",
"output": "NO"
},
{
"input": "1011110110111010110111111010010010100011111011110000011000110010011110111010110100011010100010111000",
"output": "NO"
},
{
"input": "0010100111100010110110000011100111110100111110001010000100111111111010111100101101010101001011010110",
"output": "YES"
},
{
"input": "1111010100010100101011101100101101110011000010100010000001111100010011100101010001101111000001011000",
"output": "NO"
},
{
"input": "0101100011001110001110100111100011010101011000000000110110010010111100101111010111100011101100100101",
"output": "YES"
},
{
"input": "0001101110011101110000000010011111101001101111100001001010110000110001100000010001111011011110001101",
"output": "YES"
},
{
"input": "1000010000100000100010000100001000010000100001000010000100001000010000100001000010000100001000010000",
"output": "NO"
},
{
"input": "1000000000100000000010000000001000000000100000000010000000001000000000100000000010000000001000000000",
"output": "YES"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "YES"
},
{
"input": "1111111111111111111111111111111111111111011111111111111111111111111111111111111111111111111111111111",
"output": "YES"
},
{
"input": "10100101000",
"output": "NO"
},
{
"input": "11110111011101",
"output": "NO"
},
{
"input": "10000000",
"output": "YES"
},
{
"input": "00000001",
"output": "YES"
},
{
"input": "01111111",
"output": "YES"
},
{
"input": "11111110",
"output": "YES"
}
]
| 1,689,903,060 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 62 | 0 | a = input()
count = 0
x = []
for i in range(len(a)-1):
if a[i] == a[i+1]:
count += 1
else:
x.append(count)
count = 0
print("YES") if max(x) >= 6 else print("NO")
| Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
Input Specification:
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
Output Specification:
Print "YES" if the situation is dangerous. Otherwise, print "NO".
Demo Input:
['001001\n', '1000000001\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none | ```python
a = input()
count = 0
x = []
for i in range(len(a)-1):
if a[i] == a[i+1]:
count += 1
else:
x.append(count)
count = 0
print("YES") if max(x) >= 6 else print("NO")
``` | 0 |
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
]
| A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
]
| [
"house\n",
"VIP\n",
"matrix\n"
]
| none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
]
| 1,594,347,287 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 218 | 6,656,000 | str = input()
letter = list(str)
total_lower = 0
totol_upper = 0
for i in letter:
if i.islower():
total_lower +=1
else:
totol_upper +=1
if total_lower >= totol_upper:
str = str.lower()
else:
str = str.upper()
print(str) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
str = input()
letter = list(str)
total_lower = 0
totol_upper = 0
for i in letter:
if i.islower():
total_lower +=1
else:
totol_upper +=1
if total_lower >= totol_upper:
str = str.lower()
else:
str = str.upper()
print(str)
``` | 3.933102 |
161 | D | Distance in Tree | PROGRAMMING | 1,800 | [
"dfs and similar",
"dp",
"trees"
]
| null | null | A tree is a connected graph that doesn't contain any cycles.
The distance between two vertices of a tree is the length (in edges) of the shortest path between these vertices.
You are given a tree with *n* vertices and a positive number *k*. Find the number of distinct pairs of the vertices which have a distance of exactly *k* between them. Note that pairs (*v*, *u*) and (*u*, *v*) are considered to be the same pair. | The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50000, 1<=≤<=*k*<=≤<=500) — the number of vertices and the required distance between the vertices.
Next *n*<=-<=1 lines describe the edges as "*a**i* *b**i*" (without the quotes) (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), where *a**i* and *b**i* are the vertices connected by the *i*-th edge. All given edges are different. | Print a single integer — the number of distinct pairs of the tree's vertices which have a distance of exactly *k* between them.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"5 2\n1 2\n2 3\n3 4\n2 5\n",
"5 3\n1 2\n2 3\n3 4\n4 5\n"
]
| [
"4\n",
"2\n"
]
| In the first sample the pairs of vertexes at distance 2 from each other are (1, 3), (1, 5), (3, 5) and (2, 4). | 2,000 | [
{
"input": "5 2\n1 2\n2 3\n3 4\n2 5",
"output": "4"
},
{
"input": "5 3\n1 2\n2 3\n3 4\n4 5",
"output": "2"
},
{
"input": "10 1\n2 1\n3 1\n4 3\n5 4\n6 5\n7 1\n8 6\n9 2\n10 6",
"output": "9"
},
{
"input": "10 2\n2 1\n3 1\n4 3\n5 4\n6 5\n7 1\n8 6\n9 2\n10 6",
"output": "10"
},
{
"input": "10 3\n2 1\n3 1\n4 3\n5 4\n6 5\n7 1\n8 6\n9 2\n10 6",
"output": "8"
},
{
"input": "50 3\n2 1\n3 2\n4 3\n5 4\n6 5\n7 6\n8 7\n9 8\n10 9\n11 10\n12 11\n13 12\n14 13\n15 14\n16 15\n17 16\n18 17\n19 18\n20 19\n21 20\n22 21\n23 22\n24 23\n25 24\n26 25\n27 26\n28 27\n29 28\n30 29\n31 30\n32 31\n33 32\n34 33\n35 34\n36 35\n37 36\n38 37\n39 38\n40 39\n41 40\n42 41\n43 42\n44 43\n45 44\n46 45\n47 46\n48 47\n49 48\n50 49",
"output": "47"
},
{
"input": "50 4\n2 1\n3 1\n4 2\n5 2\n6 3\n7 3\n8 4\n9 4\n10 5\n11 5\n12 6\n13 6\n14 7\n15 7\n16 8\n17 8\n18 9\n19 9\n20 10\n21 10\n22 11\n23 11\n24 12\n25 12\n26 13\n27 13\n28 14\n29 14\n30 15\n31 15\n32 16\n33 16\n34 17\n35 17\n36 18\n37 18\n38 19\n39 19\n40 20\n41 20\n42 21\n43 21\n44 22\n45 22\n46 23\n47 23\n48 24\n49 24\n50 25",
"output": "124"
},
{
"input": "50 5\n2 1\n3 1\n4 2\n5 2\n6 4\n7 4\n8 6\n9 6\n10 8\n11 8\n12 10\n13 10\n14 12\n15 12\n16 14\n17 14\n18 16\n19 16\n20 18\n21 18\n22 20\n23 20\n24 22\n25 22\n26 24\n27 24\n28 26\n29 26\n30 28\n31 28\n32 30\n33 30\n34 32\n35 32\n36 34\n37 34\n38 36\n39 36\n40 38\n41 38\n42 40\n43 40\n44 42\n45 42\n46 44\n47 44\n48 46\n49 46\n50 48",
"output": "84"
},
{
"input": "10 20\n2 1\n3 2\n4 1\n5 3\n6 4\n7 1\n8 2\n9 7\n10 2",
"output": "0"
}
]
| 1,537,135,378 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 16 | 1,934 | 12,902,400 | class Graph:
def __init__(self, n):
self.adj = [[] for i in range(n)]
self.par = [-1] * n
self.size = [0] * n
self.is_centroid = [False] * n
def add_edge(self, u, v, bidirect = True):
self.adj[u].append(v)
if bidirect:
self.adj[v].append(u)
else:
self.par[v] = u
# /**
# * @graph: graph
# * @root: root
# * @num_nodes: number of nodes on the current sub-graph we're dealing with
# *
# * return: the Centroid of the subgraph we're dealing with
# * complexity: O(N)
# **/
def find_centroid(graph, root, num_nodes):
# // find heaviest child, O(N) total
heaviest_child = -1
for v in graph.adj[root]:
# // ignore nodes that is already a centroid
if not graph.is_centroid[v] and v != graph.par[root] and (heaviest_child == -1 or graph.size[v] > graph.size[heaviest_child]):
heaviest_child = v
# // met centroid's condition
if heaviest_child == -1 or max(graph.size[heaviest_child], num_nodes - graph.size[root]) <= num_nodes // 2:
return root
# // if root is not the centroid, the real centroid must be somewhere in the subtree rooted at the heaviest_child
return find_centroid(graph, heaviest_child, num_nodes);
# /**
# * @graph: graph
# * @root: root
# * @decomposed_graph: decomposed graph
# *
# * return: the centroid as the root of this subgraph
# * complexity: O(NlogN) in total
# **/
def decompose_tree(graph, root, decomposed_graph):
# // find the centroid of current subgraph, O(N)
centroid = find_centroid(graph, root, graph.size[root])
# // mark as centroid, O(N)
graph.is_centroid[centroid] = True
p = graph.par[centroid]
while p != -1 and not graph.is_centroid[p]:
graph.size[p] -= graph.size[centroid]
p = graph.par[p]
# // decompose subtree rooted at centroid
for v in graph.adj[centroid]:
if v != graph.par[centroid] and not graph.is_centroid[v]:
decomposed_graph.add_edge(centroid, decompose_tree(graph, v, decomposed_graph), False)
# // subgraph rooted at root is still not decomposed completely
if centroid != root:
decomposed_graph.add_edge(centroid, decompose_tree(graph, root, decomposed_graph), False)
return centroid;
# /**
# * @graph: graph
# * @root: root
# *
# * return: size of subtree rooted at root
# * complexity: O(N)
# **/
def cal_sizes(graph, root):
graph.size[root] = 1
for v in graph.adj[root]:
if v != graph.par[root]:
graph.par[v] = root
graph.size[root] += cal_sizes(graph, v)
return graph.size[root]
# /**
# * @graph: graph
# * @root: root
# * @par: recent node that's been visited
# * @distance: distance from the caller node
# * @count: count[i] = num of nodes that has distance from caller node of i
# *
# * complexity: O(N)
# **/
def cal_nodes(graph, root, par, distance, count):
count[distance] = count.get(distance, 0) + 1
for v in graph.adj[root]:
if v != par and distance + 1 <= k and not graph.is_centroid[v]:
cal_nodes(graph, v, root, distance + 1, count)
# /**
# * @graph: graph
# * @decomposed_graph: the centroid tree of graph
# * @root: root
# *
# * return: num of pairs that have distance of k in the decomposed tree rooted at root
# * complexity: O(NlogN)
# **/
def cal_paths(graph, decomposed_graph, root):
res = 0
# // reuse is_centroid as visited
graph.is_centroid[root] = True
# // the depth may be much less than k so dont need to initialize a vector of k
count = {}
count[0] = 1; # // dist(root, root) = 0
# // count paths that starts and ends in decomposed graph rooted at root, and goes through root
# // O(N) in total
for v in graph.adj[root]:
if not graph.is_centroid[v] and v != decomposed_graph.par[root]:
count_v = {0: 0}
cal_nodes(graph, v, root, 1, count_v) # // distance starts from 1
if len(count) < len(count_v):
count, count_v = count_v, count
for first, second in count.items():
res += second * count_v.get(k - first, 0)
for key in count.keys():
count[key] += count_v.get(key, 0)
for v in decomposed_graph.adj[root]:
if v != decomposed_graph.par[root]:
res += cal_paths(graph, decomposed_graph, v)
return res
if __name__ == "__main__":
n, k = map(int, input().split())
graph = Graph(n)
for i in range(n - 1):
x, y = map(int, input().split())
graph.add_edge(x - 1, y - 1)
# // cal par and size first
cal_sizes(graph, 0)
# // decompose graph
decomposed_graph = Graph(n)
centroid = decompose_tree(graph, 0, decomposed_graph)
graph.is_centroid = [False] * n
print(cal_paths(graph, decomposed_graph, centroid))
| Title: Distance in Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A tree is a connected graph that doesn't contain any cycles.
The distance between two vertices of a tree is the length (in edges) of the shortest path between these vertices.
You are given a tree with *n* vertices and a positive number *k*. Find the number of distinct pairs of the vertices which have a distance of exactly *k* between them. Note that pairs (*v*, *u*) and (*u*, *v*) are considered to be the same pair.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50000, 1<=≤<=*k*<=≤<=500) — the number of vertices and the required distance between the vertices.
Next *n*<=-<=1 lines describe the edges as "*a**i* *b**i*" (without the quotes) (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), where *a**i* and *b**i* are the vertices connected by the *i*-th edge. All given edges are different.
Output Specification:
Print a single integer — the number of distinct pairs of the tree's vertices which have a distance of exactly *k* between them.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['5 2\n1 2\n2 3\n3 4\n2 5\n', '5 3\n1 2\n2 3\n3 4\n4 5\n']
Demo Output:
['4\n', '2\n']
Note:
In the first sample the pairs of vertexes at distance 2 from each other are (1, 3), (1, 5), (3, 5) and (2, 4). | ```python
class Graph:
def __init__(self, n):
self.adj = [[] for i in range(n)]
self.par = [-1] * n
self.size = [0] * n
self.is_centroid = [False] * n
def add_edge(self, u, v, bidirect = True):
self.adj[u].append(v)
if bidirect:
self.adj[v].append(u)
else:
self.par[v] = u
# /**
# * @graph: graph
# * @root: root
# * @num_nodes: number of nodes on the current sub-graph we're dealing with
# *
# * return: the Centroid of the subgraph we're dealing with
# * complexity: O(N)
# **/
def find_centroid(graph, root, num_nodes):
# // find heaviest child, O(N) total
heaviest_child = -1
for v in graph.adj[root]:
# // ignore nodes that is already a centroid
if not graph.is_centroid[v] and v != graph.par[root] and (heaviest_child == -1 or graph.size[v] > graph.size[heaviest_child]):
heaviest_child = v
# // met centroid's condition
if heaviest_child == -1 or max(graph.size[heaviest_child], num_nodes - graph.size[root]) <= num_nodes // 2:
return root
# // if root is not the centroid, the real centroid must be somewhere in the subtree rooted at the heaviest_child
return find_centroid(graph, heaviest_child, num_nodes);
# /**
# * @graph: graph
# * @root: root
# * @decomposed_graph: decomposed graph
# *
# * return: the centroid as the root of this subgraph
# * complexity: O(NlogN) in total
# **/
def decompose_tree(graph, root, decomposed_graph):
# // find the centroid of current subgraph, O(N)
centroid = find_centroid(graph, root, graph.size[root])
# // mark as centroid, O(N)
graph.is_centroid[centroid] = True
p = graph.par[centroid]
while p != -1 and not graph.is_centroid[p]:
graph.size[p] -= graph.size[centroid]
p = graph.par[p]
# // decompose subtree rooted at centroid
for v in graph.adj[centroid]:
if v != graph.par[centroid] and not graph.is_centroid[v]:
decomposed_graph.add_edge(centroid, decompose_tree(graph, v, decomposed_graph), False)
# // subgraph rooted at root is still not decomposed completely
if centroid != root:
decomposed_graph.add_edge(centroid, decompose_tree(graph, root, decomposed_graph), False)
return centroid;
# /**
# * @graph: graph
# * @root: root
# *
# * return: size of subtree rooted at root
# * complexity: O(N)
# **/
def cal_sizes(graph, root):
graph.size[root] = 1
for v in graph.adj[root]:
if v != graph.par[root]:
graph.par[v] = root
graph.size[root] += cal_sizes(graph, v)
return graph.size[root]
# /**
# * @graph: graph
# * @root: root
# * @par: recent node that's been visited
# * @distance: distance from the caller node
# * @count: count[i] = num of nodes that has distance from caller node of i
# *
# * complexity: O(N)
# **/
def cal_nodes(graph, root, par, distance, count):
count[distance] = count.get(distance, 0) + 1
for v in graph.adj[root]:
if v != par and distance + 1 <= k and not graph.is_centroid[v]:
cal_nodes(graph, v, root, distance + 1, count)
# /**
# * @graph: graph
# * @decomposed_graph: the centroid tree of graph
# * @root: root
# *
# * return: num of pairs that have distance of k in the decomposed tree rooted at root
# * complexity: O(NlogN)
# **/
def cal_paths(graph, decomposed_graph, root):
res = 0
# // reuse is_centroid as visited
graph.is_centroid[root] = True
# // the depth may be much less than k so dont need to initialize a vector of k
count = {}
count[0] = 1; # // dist(root, root) = 0
# // count paths that starts and ends in decomposed graph rooted at root, and goes through root
# // O(N) in total
for v in graph.adj[root]:
if not graph.is_centroid[v] and v != decomposed_graph.par[root]:
count_v = {0: 0}
cal_nodes(graph, v, root, 1, count_v) # // distance starts from 1
if len(count) < len(count_v):
count, count_v = count_v, count
for first, second in count.items():
res += second * count_v.get(k - first, 0)
for key in count.keys():
count[key] += count_v.get(key, 0)
for v in decomposed_graph.adj[root]:
if v != decomposed_graph.par[root]:
res += cal_paths(graph, decomposed_graph, v)
return res
if __name__ == "__main__":
n, k = map(int, input().split())
graph = Graph(n)
for i in range(n - 1):
x, y = map(int, input().split())
graph.add_edge(x - 1, y - 1)
# // cal par and size first
cal_sizes(graph, 0)
# // decompose graph
decomposed_graph = Graph(n)
centroid = decompose_tree(graph, 0, decomposed_graph)
graph.is_centroid = [False] * n
print(cal_paths(graph, decomposed_graph, centroid))
``` | -1 |
|
277 | A | Learning Languages | PROGRAMMING | 1,400 | [
"dfs and similar",
"dsu"
]
| null | null | The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar.
Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating). | The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages.
Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages.
The numbers in the lines are separated by single spaces. | Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating). | [
"5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n",
"8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n",
"2 2\n1 2\n0\n"
]
| [
"0\n",
"2\n",
"1\n"
]
| In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4.
In the third sample employee 2 must learn language 2. | 500 | [
{
"input": "5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5",
"output": "0"
},
{
"input": "8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1",
"output": "2"
},
{
"input": "2 2\n1 2\n0",
"output": "1"
},
{
"input": "2 2\n0\n0",
"output": "2"
},
{
"input": "5 5\n1 3\n0\n0\n2 4 1\n0",
"output": "4"
},
{
"input": "6 2\n0\n0\n2 1 2\n1 1\n1 1\n0",
"output": "3"
},
{
"input": "7 3\n3 1 3 2\n3 2 1 3\n2 2 3\n1 1\n2 2 3\n3 3 2 1\n3 2 3 1",
"output": "0"
},
{
"input": "8 4\n0\n0\n4 2 3 1 4\n4 2 1 4 3\n3 4 3 1\n1 2\n2 4 1\n2 4 2",
"output": "2"
},
{
"input": "10 10\n5 7 5 2 8 1\n7 10 6 9 5 8 2 4\n2 2 7\n5 8 6 9 10 1\n2 9 5\n3 6 5 2\n6 5 8 7 9 10 4\n0\n1 1\n2 8 6",
"output": "1"
},
{
"input": "11 42\n4 20 26 9 24\n14 34 7 28 32 12 15 26 4 10 38 21 20 8 11\n4 21 8 36 6\n11 32 1 39 11 21 10 25 17 26 15 4\n2 8 12\n2 21 31\n8 17 10 3 39 32 30 5 15\n20 24 20 38 17 4 7 21 19 32 28 31 22 30 37 10 5 33 2 13 9\n7 38 34 42 27 20 11 6\n3 40 3 39\n14 39 40 4 30 33 8 36 28 14 23 16 7 25 9",
"output": "0"
},
{
"input": "100 100\n1 33\n0\n2 35 4\n2 40 78\n1 69\n0\n1 2\n0\n0\n2 81 34\n1 45\n0\n1 87\n1 50\n1 97\n0\n2 100 59\n0\n0\n0\n1 45\n0\n0\n0\n1 6\n1 54\n0\n0\n0\n4 79 96 52 84\n1 86\n0\n0\n0\n0\n0\n0\n0\n0\n3 90 2 80\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 2\n0\n1 64\n0\n1 78\n1 82\n0\n0\n0\n0\n0\n1 6\n0\n0\n2 47 57\n1 95\n0\n2 91 79\n0\n1 27\n0\n1 74\n0\n0\n1 14\n0\n0\n2 90 19\n0\n1 10\n0\n0\n0\n0\n0\n1 57\n0\n2 28 50\n0\n0\n0\n1 47\n0\n0\n1 14\n0\n1 84\n1 1\n0\n0",
"output": "87"
},
{
"input": "2 2\n2 1 2\n2 1 2",
"output": "0"
},
{
"input": "2 2\n2 1 2\n1 1",
"output": "0"
},
{
"input": "2 2\n1 2\n1 1",
"output": "1"
},
{
"input": "3 100\n0\n0\n0",
"output": "3"
},
{
"input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "100"
},
{
"input": "3 3\n0\n0\n0",
"output": "3"
}
]
| 1,637,290,479 | 2,147,483,647 | PyPy 3 | OK | TESTS | 33 | 216 | 2,355,200 | n, m = map(int, input().split(' '))
parent = [x for x in range(m + 1)]
rank = [0 for x in range(m + 1)]
def find(v):
if v == parent[v]:
return v
parent[v] = find(parent[v])
return parent[v]
def union(a, b):
a = find(a)
b = find(b)
if a != b:
if rank[a] < rank[b]:
a, b = b, a
parent[b] = a
if rank[a] == rank[b]:
rank[a] += 1
nolang = 0
unusedlang = 0
counts = [0 for x in range(m + 1)]
for i in range(n):
line = input().split(' ')
k = int(line[0])
if k != 0:
languages = [x for x in map(int, line[1:])]
counts[languages[0]] += 1
for j in range(1, k):
counts[languages[j]] += 1
union(languages[j - 1], languages[j])
else:
nolang += 1
# calculate the answer
cost = -1
for i in range(1, m + 1):
if counts[i] == 0:
unusedlang += 1
elif parent[i] == i:
cost += 1
if unusedlang == m:
print(n)
else:
print(cost + nolang)
| Title: Learning Languages
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar.
Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating).
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages.
Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages.
The numbers in the lines are separated by single spaces.
Output Specification:
Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating).
Demo Input:
['5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n', '8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n', '2 2\n1 2\n0\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4.
In the third sample employee 2 must learn language 2. | ```python
n, m = map(int, input().split(' '))
parent = [x for x in range(m + 1)]
rank = [0 for x in range(m + 1)]
def find(v):
if v == parent[v]:
return v
parent[v] = find(parent[v])
return parent[v]
def union(a, b):
a = find(a)
b = find(b)
if a != b:
if rank[a] < rank[b]:
a, b = b, a
parent[b] = a
if rank[a] == rank[b]:
rank[a] += 1
nolang = 0
unusedlang = 0
counts = [0 for x in range(m + 1)]
for i in range(n):
line = input().split(' ')
k = int(line[0])
if k != 0:
languages = [x for x in map(int, line[1:])]
counts[languages[0]] += 1
for j in range(1, k):
counts[languages[j]] += 1
union(languages[j - 1], languages[j])
else:
nolang += 1
# calculate the answer
cost = -1
for i in range(1, m + 1):
if counts[i] == 0:
unusedlang += 1
elif parent[i] == i:
cost += 1
if unusedlang == m:
print(n)
else:
print(cost + nolang)
``` | 3 |
|
805 | B | 3-palindrome | PROGRAMMING | 1,000 | [
"constructive algorithms"
]
| null | null | In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string. | Print the string that satisfies all the constraints.
If there are multiple answers, print any of them. | [
"2\n",
"3\n"
]
| [
"aa\n",
"bba\n"
]
| A palindrome is a sequence of characters which reads the same backward and forward. | 1,000 | [
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
]
| 1,568,730,666 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 93 | 0 | n = int(input())
res = ""
n = n / 2
for i in range(0,int(n)):
if i % 2 != 0:
res += 'aa'
else:
res += 'bb'
if res.__len__() < n*2:
res += 'b'
print(res) | Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward. | ```python
n = int(input())
res = ""
n = n / 2
for i in range(0,int(n)):
if i % 2 != 0:
res += 'aa'
else:
res += 'bb'
if res.__len__() < n*2:
res += 'b'
print(res)
``` | 0 |
|
932 | E | Team Work | PROGRAMMING | 2,400 | [
"combinatorics",
"dp",
"math"
]
| null | null | You have a team of *N* people. For a particular task, you can pick any non-empty subset of people. The cost of having *x* people for the task is *x**k*.
Output the sum of costs over all non-empty subsets of people. | Only line of input contains two integers *N* (1<=≤<=*N*<=≤<=109) representing total number of people and *k* (1<=≤<=*k*<=≤<=5000). | Output the sum of costs for all non empty subsets modulo 109<=+<=7. | [
"1 1\n",
"3 2\n"
]
| [
"1\n",
"24\n"
]
| In the first example, there is only one non-empty subset {1} with cost 1<sup class="upper-index">1</sup> = 1.
In the second example, there are seven non-empty subsets.
- {1} with cost 1<sup class="upper-index">2</sup> = 1
- {2} with cost 1<sup class="upper-index">2</sup> = 1
- {1, 2} with cost 2<sup class="upper-index">2</sup> = 4
- {3} with cost 1<sup class="upper-index">2</sup> = 1
- {1, 3} with cost 2<sup class="upper-index">2</sup> = 4
- {2, 3} with cost 2<sup class="upper-index">2</sup> = 4
- {1, 2, 3} with cost 3<sup class="upper-index">2</sup> = 9
The total cost is 1 + 1 + 4 + 1 + 4 + 4 + 9 = 24. | 2,500 | [
{
"input": "1 1",
"output": "1"
},
{
"input": "3 2",
"output": "24"
},
{
"input": "5 3",
"output": "800"
},
{
"input": "12 4",
"output": "8067072"
},
{
"input": "20 5",
"output": "87486873"
},
{
"input": "522 4575",
"output": "558982611"
},
{
"input": "1426 4445",
"output": "503519668"
},
{
"input": "81 3772",
"output": "420178413"
},
{
"input": "629 3447",
"output": "989788663"
},
{
"input": "2202 3497",
"output": "682330518"
},
{
"input": "2775 4325",
"output": "434053861"
},
{
"input": "3982 4784",
"output": "987043323"
},
{
"input": "2156 3417",
"output": "216656956"
},
{
"input": "902 1932",
"output": "78732216"
},
{
"input": "728 3537",
"output": "957098547"
},
{
"input": "739 3857",
"output": "836213774"
},
{
"input": "1918 4211",
"output": "972992457"
},
{
"input": "3506 4679",
"output": "130374558"
},
{
"input": "1000000000 5000",
"output": "642932262"
},
{
"input": "2500 5000",
"output": "416584034"
},
{
"input": "158260522 4575",
"output": "875142289"
},
{
"input": "602436426 4445",
"output": "582490088"
},
{
"input": "861648772 81",
"output": "939143440"
},
{
"input": "433933447 629",
"output": "396606775"
},
{
"input": "262703497 2202",
"output": "813734619"
},
{
"input": "971407775 4325",
"output": "905271522"
},
{
"input": "731963982 4784",
"output": "7722713"
},
{
"input": "450968417 2156",
"output": "634922960"
},
{
"input": "982631932 902",
"output": "262226561"
},
{
"input": "880895728 3537",
"output": "266659411"
},
{
"input": "4483 4938",
"output": "371059472"
},
{
"input": "4278 3849",
"output": "183616686"
},
{
"input": "3281 4798",
"output": "467929252"
},
{
"input": "12195 4781",
"output": "628055652"
},
{
"input": "5092 4809",
"output": "587575377"
},
{
"input": "2511 4990",
"output": "622898200"
},
{
"input": "9896 4771",
"output": "388524304"
},
{
"input": "493 4847",
"output": "414977957"
},
{
"input": "137 4733",
"output": "279404197"
},
{
"input": "6399 4957",
"output": "639782892"
},
{
"input": "999999376 642",
"output": "842765934"
},
{
"input": "999997777 645",
"output": "31545099"
},
{
"input": "999998604 448",
"output": "642283867"
},
{
"input": "999974772 208",
"output": "268825720"
},
{
"input": "999980457 228",
"output": "848255312"
},
{
"input": "999999335 1040",
"output": "585378634"
},
{
"input": "999976125 157",
"output": "300682474"
},
{
"input": "999974335 786",
"output": "754709460"
},
{
"input": "999985549 266",
"output": "607440620"
},
{
"input": "999999648 34",
"output": "378413808"
}
]
| 1,519,045,483 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 11 | 2,000 | 29,081,600 | n, k = map(int, input().split())
m = 0x3b9aca07
r = 0
p = pow(2, n, m) * pow(500000004, k, m)
a = [1] + [0] * k
for i in range(k):
for j in range(i, -1, -1):
a[j + 1] = (a[j + 1] + a[j] * (n - j)) % m
a[j] = a[j] * j % m
for i in range(k, 0, -1):
r = (r + p * a[i]) % m
p = p * 2 % m
print(r)
| Title: Team Work
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a team of *N* people. For a particular task, you can pick any non-empty subset of people. The cost of having *x* people for the task is *x**k*.
Output the sum of costs over all non-empty subsets of people.
Input Specification:
Only line of input contains two integers *N* (1<=≤<=*N*<=≤<=109) representing total number of people and *k* (1<=≤<=*k*<=≤<=5000).
Output Specification:
Output the sum of costs for all non empty subsets modulo 109<=+<=7.
Demo Input:
['1 1\n', '3 2\n']
Demo Output:
['1\n', '24\n']
Note:
In the first example, there is only one non-empty subset {1} with cost 1<sup class="upper-index">1</sup> = 1.
In the second example, there are seven non-empty subsets.
- {1} with cost 1<sup class="upper-index">2</sup> = 1
- {2} with cost 1<sup class="upper-index">2</sup> = 1
- {1, 2} with cost 2<sup class="upper-index">2</sup> = 4
- {3} with cost 1<sup class="upper-index">2</sup> = 1
- {1, 3} with cost 2<sup class="upper-index">2</sup> = 4
- {2, 3} with cost 2<sup class="upper-index">2</sup> = 4
- {1, 2, 3} with cost 3<sup class="upper-index">2</sup> = 9
The total cost is 1 + 1 + 4 + 1 + 4 + 4 + 9 = 24. | ```python
n, k = map(int, input().split())
m = 0x3b9aca07
r = 0
p = pow(2, n, m) * pow(500000004, k, m)
a = [1] + [0] * k
for i in range(k):
for j in range(i, -1, -1):
a[j + 1] = (a[j + 1] + a[j] * (n - j)) % m
a[j] = a[j] * j % m
for i in range(k, 0, -1):
r = (r + p * a[i]) % m
p = p * 2 % m
print(r)
``` | 0 |
|
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
]
| A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
]
| [
"house\n",
"VIP\n",
"matrix\n"
]
| none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
]
| 1,650,270,422 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 30 | 124 | 0 | s=input()
u=0
d=0
for a in s:
if a.isupper():
u+=1
else:
d+=1
if u>d:
print(s.upper())
else:
print(s.lower())
| Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
s=input()
u=0
d=0
for a in s:
if a.isupper():
u+=1
else:
d+=1
if u>d:
print(s.upper())
else:
print(s.lower())
``` | 3.969 |
492 | B | Vanya and Lanterns | PROGRAMMING | 1,200 | [
"binary search",
"implementation",
"math",
"sortings"
]
| null | null | Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns.
Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street? | The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively.
The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street. | Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9. | [
"7 15\n15 5 3 7 9 14 0\n",
"2 5\n2 5\n"
]
| [
"2.5000000000\n",
"2.0000000000\n"
]
| Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit. | 1,000 | [
{
"input": "7 15\n15 5 3 7 9 14 0",
"output": "2.5000000000"
},
{
"input": "2 5\n2 5",
"output": "2.0000000000"
},
{
"input": "46 615683844\n431749087 271781274 274974690 324606253 480870261 401650581 13285442 478090364 266585394 425024433 588791449 492057200 391293435 563090494 317950 173675329 473068378 356306865 311731938 192959832 321180686 141984626 578985584 512026637 175885185 590844074 47103801 212211134 330150 509886963 565955809 315640375 612907074 500474373 524310737 568681652 315339618 478782781 518873818 271322031 74600969 539099112 85129347 222068995 106014720 77282307",
"output": "22258199.5000000000"
},
{
"input": "2 1000000000\n0 1000000000",
"output": "500000000.0000000000"
},
{
"input": "2 555\n200 300",
"output": "255.0000000000"
},
{
"input": "1 1\n1",
"output": "1.0000000000"
},
{
"input": "1 1\n0",
"output": "1.0000000000"
},
{
"input": "1 1000000000\n0",
"output": "1000000000.0000000000"
},
{
"input": "1 1000000000\n1000000000",
"output": "1000000000.0000000000"
},
{
"input": "1 999999999\n499999999",
"output": "500000000.0000000000"
},
{
"input": "4 700\n0 250 475 700",
"output": "125.0000000000"
},
{
"input": "4 700\n0 225 450 700",
"output": "125.0000000000"
},
{
"input": "5 1000\n0 250 500 750 1000",
"output": "125.0000000000"
},
{
"input": "5 2000\n1001 1001 1001 1001 1001",
"output": "1001.0000000000"
},
{
"input": "1 999\n501",
"output": "501.0000000000"
},
{
"input": "2 1000\n400 600",
"output": "400.0000000000"
},
{
"input": "4 15\n1 3 9 11",
"output": "4.0000000000"
},
{
"input": "1 5\n2",
"output": "3.0000000000"
}
]
| 1,685,829,473 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 8 | 46 | 0 | a, b = input().split(), input().split()
kol = int(a[0])
dl = int(a[1])
b = [int(i) for i in b]
b.sort()
max = 0
for i in range(1, kol):
if b[i] - b[i - 1] > max:
max = b[i] - b[i - 1]
if min(b) < max / 2:
print(max / 2)
else:
print(min(b)) | Title: Vanya and Lanterns
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns.
Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street?
Input Specification:
The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively.
The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street.
Output Specification:
Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9.
Demo Input:
['7 15\n15 5 3 7 9 14 0\n', '2 5\n2 5\n']
Demo Output:
['2.5000000000\n', '2.0000000000\n']
Note:
Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit. | ```python
a, b = input().split(), input().split()
kol = int(a[0])
dl = int(a[1])
b = [int(i) for i in b]
b.sort()
max = 0
for i in range(1, kol):
if b[i] - b[i - 1] > max:
max = b[i] - b[i - 1]
if min(b) < max / 2:
print(max / 2)
else:
print(min(b))
``` | 0 |
|
327 | A | Flipping Game | PROGRAMMING | 1,200 | [
"brute force",
"dp",
"implementation"
]
| null | null | Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub. | The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1. | Print an integer — the maximal number of 1s that can be obtained after exactly one move. | [
"5\n1 0 0 1 0\n",
"4\n1 0 0 1\n"
]
| [
"4\n",
"4\n"
]
| In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1. | 500 | [
{
"input": "5\n1 0 0 1 0",
"output": "4"
},
{
"input": "4\n1 0 0 1",
"output": "4"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "8\n1 0 0 0 1 0 0 0",
"output": "7"
},
{
"input": "18\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "18"
},
{
"input": "23\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "22"
},
{
"input": "100\n0 1 0 1 1 1 0 1 0 1 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 0 0 1 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 1 0 0 1 1 1 1 1 1 1 1 0 1 1 1 0 1 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1",
"output": "70"
},
{
"input": "100\n0 1 1 0 1 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 0 0 0 0 0 1 0 1 0 1 0 1 0 1 0 0 0 1 0 0 0 0 0 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 0 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 0 0 0 1 0 0 0 0 1 1 1 1",
"output": "60"
},
{
"input": "18\n0 1 0 1 0 1 0 1 0 1 1 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "25\n0 1 0 0 0 0 0 1 0 1 0 1 0 0 0 0 1 1 1 0 0 1 1 0 1",
"output": "18"
},
{
"input": "55\n0 0 1 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 1 0 0 1 0 0 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 1 0 0 0 0 1 1 0 1 1 1 1",
"output": "36"
},
{
"input": "75\n1 1 0 1 0 1 1 0 0 0 0 0 1 1 1 1 1 0 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 1 0 1 0 0 0 0 1 0 0 1 1 1 0 0 1 0 1 1 0 0 0 0 1 1 0 0 0 1 0 0 0",
"output": "44"
},
{
"input": "100\n0 0 1 0 1 0 0 1 1 0 1 1 0 1 0 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 0 1 1 0 0 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 1 0 1",
"output": "61"
},
{
"input": "100\n0 0 0 1 0 0 0 1 0 1 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 0 1 0 0 1 1 0 1 1 0 1 0 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 1 1 0 1 1 0",
"output": "61"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "100\n0 0 1 1 1 0 1 1 0 0 1 0 1 0 1 0 0 1 0 1 1 0 0 1 1 1 1 1 1 0 1 0 0 1 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 1 1 1 0 1 1 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 0 0 0 1 0",
"output": "61"
},
{
"input": "100\n0 1 1 1 1 1 1 0 0 0 1 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 0 1 1 1 0 1 0 0 1 1 0 0 0 1 1 1 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 0 1 0 1 0 1 0 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 1 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "99\n1 1 0 0 0 1 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 0 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 0 0 1 0 1 1 0 1 0 0 1 1 0 1 0 0 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 0 0 1 0 0 0 0 0 1 0 1 1 1",
"output": "61"
},
{
"input": "2\n1 1",
"output": "1"
}
]
| 1,658,063,500 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | def solve():
n = int(input())
s = 0
pre = []
lst = list(map(int,input().split()))
for i in lst:
s+=i
pre.append(s)
for j in pre[::-1]:
if j == max(pre):
ans = j
break
print(ans)
#case = int(input())
#for _ in range(case):
solve()
| Title: Flipping Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
Output Specification:
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
Demo Input:
['5\n1 0 0 1 0\n', '4\n1 0 0 1\n']
Demo Output:
['4\n', '4\n']
Note:
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1. | ```python
def solve():
n = int(input())
s = 0
pre = []
lst = list(map(int,input().split()))
for i in lst:
s+=i
pre.append(s)
for j in pre[::-1]:
if j == max(pre):
ans = j
break
print(ans)
#case = int(input())
#for _ in range(case):
solve()
``` | 0 |
|
271 | A | Beautiful Year | PROGRAMMING | 800 | [
"brute force"
]
| null | null | It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits. | The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number. | Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists. | [
"1987\n",
"2013\n"
]
| [
"2013\n",
"2014\n"
]
| none | 500 | [
{
"input": "1987",
"output": "2013"
},
{
"input": "2013",
"output": "2014"
},
{
"input": "1000",
"output": "1023"
},
{
"input": "1001",
"output": "1023"
},
{
"input": "1234",
"output": "1235"
},
{
"input": "5555",
"output": "5601"
},
{
"input": "9000",
"output": "9012"
},
{
"input": "1111",
"output": "1203"
},
{
"input": "8999",
"output": "9012"
},
{
"input": "4572",
"output": "4573"
},
{
"input": "6666",
"output": "6701"
},
{
"input": "2001",
"output": "2013"
},
{
"input": "3000",
"output": "3012"
},
{
"input": "7712",
"output": "7801"
},
{
"input": "8088",
"output": "8091"
},
{
"input": "1594",
"output": "1596"
},
{
"input": "6016",
"output": "6017"
},
{
"input": "8800",
"output": "8901"
},
{
"input": "3331",
"output": "3401"
},
{
"input": "5090",
"output": "5091"
},
{
"input": "2342",
"output": "2345"
},
{
"input": "2334",
"output": "2340"
},
{
"input": "1123",
"output": "1203"
},
{
"input": "8989",
"output": "9012"
},
{
"input": "8977",
"output": "9012"
},
{
"input": "6869",
"output": "6870"
},
{
"input": "8999",
"output": "9012"
}
]
| 1,695,189,210 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 30 | 0 | n = int(input())
mapped_data = list(map(int, input().split()))
if sum(mapped_data) == 0:
print("EASY")
else:
print("HARD") | Title: Beautiful Year
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It seems like the year of 2013 came only yesterday. Do you know a curious fact? The year of 2013 is the first year after the old 1987 with only distinct digits.
Now you are suggested to solve the following problem: given a year number, find the minimum year number which is strictly larger than the given one and has only distinct digits.
Input Specification:
The single line contains integer *y* (1000<=≤<=*y*<=≤<=9000) — the year number.
Output Specification:
Print a single integer — the minimum year number that is strictly larger than *y* and all it's digits are distinct. It is guaranteed that the answer exists.
Demo Input:
['1987\n', '2013\n']
Demo Output:
['2013\n', '2014\n']
Note:
none | ```python
n = int(input())
mapped_data = list(map(int, input().split()))
if sum(mapped_data) == 0:
print("EASY")
else:
print("HARD")
``` | -1 |
|
379 | A | New Year Candles | PROGRAMMING | 1,000 | [
"implementation"
]
| null | null | Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number. | The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000). | Print a single integer — the number of hours Vasily can light up the room for. | [
"4 2\n",
"6 3\n"
]
| [
"7\n",
"8\n"
]
| Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours. | 500 | [
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
]
| 1,693,919,527 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 46 | 0 | A=input().split()
a=int(A[0])
b=int(A[1])
x=a
while x>=b:
k=x//b
a+=k
x=x-k*b+k
print(a) | Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours. | ```python
A=input().split()
a=int(A[0])
b=int(A[1])
x=a
while x>=b:
k=x//b
a+=k
x=x-k*b+k
print(a)
``` | 3 |
|
588 | A | Duff and Meat | PROGRAMMING | 900 | [
"greedy"
]
| null | null | Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat.
There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future.
Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days. | The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days.
In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day. | Print the minimum money needed to keep Duff happy for *n* days, in one line. | [
"3\n1 3\n2 2\n3 1\n",
"3\n1 3\n2 1\n3 2\n"
]
| [
"10\n",
"8\n"
]
| In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day.
In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day. | 750 | [
{
"input": "3\n1 3\n2 2\n3 1",
"output": "10"
},
{
"input": "3\n1 3\n2 1\n3 2",
"output": "8"
},
{
"input": "1\n39 52",
"output": "2028"
},
{
"input": "2\n25 56\n94 17",
"output": "2998"
},
{
"input": "5\n39 21\n95 89\n73 90\n9 55\n85 32",
"output": "6321"
},
{
"input": "12\n70 11\n74 27\n32 11\n26 83\n57 18\n97 28\n75 43\n75 21\n84 29\n16 2\n89 63\n21 88",
"output": "6742"
},
{
"input": "2\n100 68\n38 80",
"output": "9384"
}
]
| 1,616,272,468 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | ans=0
for i in range(int(input())):
a,b=map(int,input().split())
ans+=a*b
print(ans)
| Title: Duff and Meat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Duff is addicted to meat! Malek wants to keep her happy for *n* days. In order to be happy in *i*-th day, she needs to eat exactly *a**i* kilograms of meat.
There is a big shop uptown and Malek wants to buy meat for her from there. In *i*-th day, they sell meat for *p**i* dollars per kilogram. Malek knows all numbers *a*1,<=...,<=*a**n* and *p*1,<=...,<=*p**n*. In each day, he can buy arbitrary amount of meat, also he can keep some meat he has for the future.
Malek is a little tired from cooking meat, so he asked for your help. Help him to minimize the total money he spends to keep Duff happy for *n* days.
Input Specification:
The first line of input contains integer *n* (1<=≤<=*n*<=≤<=105), the number of days.
In the next *n* lines, *i*-th line contains two integers *a**i* and *p**i* (1<=≤<=*a**i*,<=*p**i*<=≤<=100), the amount of meat Duff needs and the cost of meat in that day.
Output Specification:
Print the minimum money needed to keep Duff happy for *n* days, in one line.
Demo Input:
['3\n1 3\n2 2\n3 1\n', '3\n1 3\n2 1\n3 2\n']
Demo Output:
['10\n', '8\n']
Note:
In the first sample case: An optimal way would be to buy 1 kg on the first day, 2 kg on the second day and 3 kg on the third day.
In the second sample case: An optimal way would be to buy 1 kg on the first day and 5 kg (needed meat for the second and third day) on the second day. | ```python
ans=0
for i in range(int(input())):
a,b=map(int,input().split())
ans+=a*b
print(ans)
``` | 0 |
|
844 | A | Diversity | PROGRAMMING | 1,000 | [
"greedy",
"implementation",
"strings"
]
| null | null | Calculate the minimum number of characters you need to change in the string *s*, so that it contains at least *k* different letters, or print that it is impossible.
String *s* consists only of lowercase Latin letters, and it is allowed to change characters only to lowercase Latin letters too. | First line of input contains string *s*, consisting only of lowercase Latin letters (1<=≤<=|*s*|<=≤<=1000, |*s*| denotes the length of *s*).
Second line of input contains integer *k* (1<=≤<=*k*<=≤<=26). | Print single line with a minimum number of necessary changes, or the word «impossible» (without quotes) if it is impossible. | [
"yandex\n6\n",
"yahoo\n5\n",
"google\n7\n"
]
| [
"0\n",
"1\n",
"impossible\n"
]
| In the first test case string contains 6 different letters, so we don't need to change anything.
In the second test case string contains 4 different letters: {'*a*', '*h*', '*o*', '*y*'}. To get 5 different letters it is necessary to change one occurrence of '*o*' to some letter, which doesn't occur in the string, for example, {'*b*'}.
In the third test case, it is impossible to make 7 different letters because the length of the string is 6. | 500 | [
{
"input": "yandex\n6",
"output": "0"
},
{
"input": "yahoo\n5",
"output": "1"
},
{
"input": "google\n7",
"output": "impossible"
},
{
"input": "a\n1",
"output": "0"
},
{
"input": "z\n2",
"output": "impossible"
},
{
"input": "fwgfrwgkuwghfiruhewgirueguhergiqrbvgrgf\n26",
"output": "14"
},
{
"input": "nfevghreuoghrueighoqghbnebvnejbvnbgneluqe\n26",
"output": "12"
},
{
"input": "a\n3",
"output": "impossible"
},
{
"input": "smaxpqplaqqbxuqxalqmbmmgubbpspxhawbxsuqhhegpmmpebqmqpbbeplwaepxmsahuepuhuhwxeqmmlgqubuaxehwuwasgxpqmugbmuawuhwqlswllssueglbxepbmwgs\n1",
"output": "0"
},
{
"input": "cuguccgcugcugucgggggcgcgucgucugcuuuccccuugccg\n4",
"output": "1"
},
{
"input": "fcfccfcfccfcfcffcffffffcfccfccfcffccccfcffffccfccfcffcfcccccffcfffcccffcfccfffffcccfccffffffccfccccf\n20",
"output": "18"
},
{
"input": "swmkwaruyv\n5",
"output": "0"
},
{
"input": "tnbqpsuhkczmejirvyfdolxwga\n22",
"output": "0"
},
{
"input": "abcde\n3",
"output": "0"
},
{
"input": "abb\n1",
"output": "0"
},
{
"input": "aaaa\n1",
"output": "0"
},
{
"input": "abcde\n2",
"output": "0"
},
{
"input": "yandex\n4",
"output": "0"
},
{
"input": "aaabbbccc\n1",
"output": "0"
},
{
"input": "abcd\n2",
"output": "0"
},
{
"input": "asdfgh\n2",
"output": "0"
},
{
"input": "aab\n1",
"output": "0"
},
{
"input": "mynameissako\n5",
"output": "0"
},
{
"input": "abcde\n1",
"output": "0"
},
{
"input": "abcd\n3",
"output": "0"
},
{
"input": "abcdef\n2",
"output": "0"
},
{
"input": "abcdefg\n4",
"output": "0"
},
{
"input": "abc\n1",
"output": "0"
},
{
"input": "asdafjsgljdllgjdgkl\n5",
"output": "0"
},
{
"input": "yaay\n3",
"output": "1"
},
{
"input": "yaay\n4",
"output": "2"
},
{
"input": "zzzzzz\n2",
"output": "1"
}
]
| 1,503,594,745 | 2,245 | Python 3 | OK | TESTS | 41 | 77 | 0 | s = input()
n = int(input())
k = set(s)
if len(s) - len(k) < n - len(k):
print('impossible')
else:
print(max(n - len(k), 0)) | Title: Diversity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Calculate the minimum number of characters you need to change in the string *s*, so that it contains at least *k* different letters, or print that it is impossible.
String *s* consists only of lowercase Latin letters, and it is allowed to change characters only to lowercase Latin letters too.
Input Specification:
First line of input contains string *s*, consisting only of lowercase Latin letters (1<=≤<=|*s*|<=≤<=1000, |*s*| denotes the length of *s*).
Second line of input contains integer *k* (1<=≤<=*k*<=≤<=26).
Output Specification:
Print single line with a minimum number of necessary changes, or the word «impossible» (without quotes) if it is impossible.
Demo Input:
['yandex\n6\n', 'yahoo\n5\n', 'google\n7\n']
Demo Output:
['0\n', '1\n', 'impossible\n']
Note:
In the first test case string contains 6 different letters, so we don't need to change anything.
In the second test case string contains 4 different letters: {'*a*', '*h*', '*o*', '*y*'}. To get 5 different letters it is necessary to change one occurrence of '*o*' to some letter, which doesn't occur in the string, for example, {'*b*'}.
In the third test case, it is impossible to make 7 different letters because the length of the string is 6. | ```python
s = input()
n = int(input())
k = set(s)
if len(s) - len(k) < n - len(k):
print('impossible')
else:
print(max(n - len(k), 0))
``` | 3 |
|
255 | A | Greg's Workout | PROGRAMMING | 800 | [
"implementation"
]
| null | null | Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training. | The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises. | Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous. | [
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
]
| [
"biceps\n",
"back\n",
"chest\n"
]
| In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise. | 500 | [
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
]
| 1,632,673,109 | 2,147,483,647 | Python 3 | OK | TESTS | 61 | 124 | 6,963,200 | n=int(input())
a=list(map(int,input().split()))
c,bi,b=0,0,0
for i in range(0,len(a),3):
c=c+a[i]
for i in range(1,len(a),3):
bi=bi+a[i]
for i in range(2,len(a),3):
b=b+a[i]
if(c==max(c,bi,b)):
print("chest")
if(bi==max(c,bi,b)):
print("biceps")
if(b==max(c,bi,b)):
print("back") | Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise. | ```python
n=int(input())
a=list(map(int,input().split()))
c,bi,b=0,0,0
for i in range(0,len(a),3):
c=c+a[i]
for i in range(1,len(a),3):
bi=bi+a[i]
for i in range(2,len(a),3):
b=b+a[i]
if(c==max(c,bi,b)):
print("chest")
if(bi==max(c,bi,b)):
print("biceps")
if(b==max(c,bi,b)):
print("back")
``` | 3 |
|
9 | C | Hexadecimal's Numbers | PROGRAMMING | 1,200 | [
"brute force",
"implementation",
"math"
]
| C. Hexadecimal's Numbers | 1 | 64 | One beautiful July morning a terrible thing happened in Mainframe: a mean virus Megabyte somehow got access to the memory of his not less mean sister Hexadecimal. He loaded there a huge amount of *n* different natural numbers from 1 to *n* to obtain total control over her energy.
But his plan failed. The reason for this was very simple: Hexadecimal didn't perceive any information, apart from numbers written in binary format. This means that if a number in a decimal representation contained characters apart from 0 and 1, it was not stored in the memory. Now Megabyte wants to know, how many numbers were loaded successfully. | Input data contains the only number *n* (1<=≤<=*n*<=≤<=109). | Output the only number — answer to the problem. | [
"10\n"
]
| [
"2"
]
| For *n* = 10 the answer includes numbers 1 and 10. | 0 | [
{
"input": "10",
"output": "2"
},
{
"input": "20",
"output": "3"
},
{
"input": "72",
"output": "3"
},
{
"input": "99",
"output": "3"
},
{
"input": "100",
"output": "4"
},
{
"input": "101",
"output": "5"
},
{
"input": "102",
"output": "5"
},
{
"input": "111",
"output": "7"
},
{
"input": "112",
"output": "7"
},
{
"input": "745",
"output": "7"
},
{
"input": "23536",
"output": "31"
},
{
"input": "1",
"output": "1"
},
{
"input": "1010011",
"output": "83"
},
{
"input": "312410141",
"output": "511"
},
{
"input": "1000000000",
"output": "512"
},
{
"input": "999999999",
"output": "511"
},
{
"input": "111111111",
"output": "511"
},
{
"input": "101010101",
"output": "341"
},
{
"input": "121212121",
"output": "511"
},
{
"input": "106341103",
"output": "383"
},
{
"input": "901556123",
"output": "511"
},
{
"input": "832513432",
"output": "511"
},
{
"input": "3",
"output": "1"
},
{
"input": "732875234",
"output": "511"
},
{
"input": "7",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "11",
"output": "3"
},
{
"input": "12",
"output": "3"
},
{
"input": "13",
"output": "3"
},
{
"input": "101020101",
"output": "351"
},
{
"input": "111100100",
"output": "484"
},
{
"input": "110110101",
"output": "437"
},
{
"input": "100111001",
"output": "313"
},
{
"input": "100100",
"output": "36"
},
{
"input": "110100102",
"output": "421"
}
]
| 1,597,707,989 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 154 | 204,800 | n=input()
resp=0
num=0
for i in range(len(n)):
n=n.replace('2','1')
n=n.replace('3','1')
n=n.replace('4','1')
n=n.replace('5','1')
n=n.replace('6','1')
n=n.replace('7','1')
n=n.replace('8','1')
n=n.replace('9','1')
print (int(n,2))
| Title: Hexadecimal's Numbers
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One beautiful July morning a terrible thing happened in Mainframe: a mean virus Megabyte somehow got access to the memory of his not less mean sister Hexadecimal. He loaded there a huge amount of *n* different natural numbers from 1 to *n* to obtain total control over her energy.
But his plan failed. The reason for this was very simple: Hexadecimal didn't perceive any information, apart from numbers written in binary format. This means that if a number in a decimal representation contained characters apart from 0 and 1, it was not stored in the memory. Now Megabyte wants to know, how many numbers were loaded successfully.
Input Specification:
Input data contains the only number *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
Output the only number — answer to the problem.
Demo Input:
['10\n']
Demo Output:
['2']
Note:
For *n* = 10 the answer includes numbers 1 and 10. | ```python
n=input()
resp=0
num=0
for i in range(len(n)):
n=n.replace('2','1')
n=n.replace('3','1')
n=n.replace('4','1')
n=n.replace('5','1')
n=n.replace('6','1')
n=n.replace('7','1')
n=n.replace('8','1')
n=n.replace('9','1')
print (int(n,2))
``` | 0 |
368 | B | Sereja and Suffixes | PROGRAMMING | 1,100 | [
"data structures",
"dp"
]
| null | null | Sereja has an array *a*, consisting of *n* integers *a*1, *a*2, ..., *a**n*. The boy cannot sit and do nothing, he decided to study an array. Sereja took a piece of paper and wrote out *m* integers *l*1,<=*l*2,<=...,<=*l**m* (1<=≤<=*l**i*<=≤<=*n*). For each number *l**i* he wants to know how many distinct numbers are staying on the positions *l**i*, *l**i*<=+<=1, ..., *n*. Formally, he want to find the number of distinct numbers among *a**l**i*,<=*a**l**i*<=+<=1,<=...,<=*a**n*.?
Sereja wrote out the necessary array elements but the array was so large and the boy was so pressed for time. Help him, find the answer for the described question for each *l**i*. | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105) — the array elements.
Next *m* lines contain integers *l*1,<=*l*2,<=...,<=*l**m*. The *i*-th line contains integer *l**i* (1<=≤<=*l**i*<=≤<=*n*). | Print *m* lines — on the *i*-th line print the answer to the number *l**i*. | [
"10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n"
]
| [
"6\n6\n6\n6\n6\n5\n4\n3\n2\n1\n"
]
| none | 1,000 | [
{
"input": "10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10",
"output": "6\n6\n6\n6\n6\n5\n4\n3\n2\n1"
},
{
"input": "8 3\n8 6 4 3 4 2 4 8\n6\n4\n2",
"output": "3\n4\n5"
},
{
"input": "7 10\n1 3 8 6 2 2 7\n4\n2\n6\n3\n4\n4\n6\n2\n7\n4",
"output": "3\n5\n2\n4\n3\n3\n2\n5\n1\n3"
},
{
"input": "10 2\n2 6 5 7 2 2 3 2 4 8\n1\n2",
"output": "7\n7"
},
{
"input": "7 1\n68346 10956 76708 23018 84063 34833 80407\n1",
"output": "7"
},
{
"input": "2 2\n8 4\n1\n1",
"output": "2\n2"
},
{
"input": "1 5\n5\n1\n1\n1\n1\n1",
"output": "1\n1\n1\n1\n1"
},
{
"input": "4 7\n3 1 4 2\n4\n1\n2\n3\n2\n4\n4",
"output": "1\n4\n3\n2\n3\n1\n1"
},
{
"input": "4 3\n9 1 7 1\n1\n4\n2",
"output": "3\n1\n2"
},
{
"input": "8 3\n9280 6676 2720 6172 8329 10413 3975 1394\n5\n6\n7",
"output": "4\n3\n2"
},
{
"input": "1 1\n1\n1",
"output": "1"
}
]
| 1,667,977,298 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 77 | 0 | # -*- coding: utf-8 -*-
"""
Created on Wed Nov 9 14:38:48 2022
@author: thinkpad
"""
n,m = map(int,input().split())
array = [int(i) for i in input().split()]
l_last = 0
for _ in range(m):
l = int(input())
del array[:l-l_last-1:]
print(array)
text = set(array)
print(text)
print(len(text))
l_last = l | Title: Sereja and Suffixes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja has an array *a*, consisting of *n* integers *a*1, *a*2, ..., *a**n*. The boy cannot sit and do nothing, he decided to study an array. Sereja took a piece of paper and wrote out *m* integers *l*1,<=*l*2,<=...,<=*l**m* (1<=≤<=*l**i*<=≤<=*n*). For each number *l**i* he wants to know how many distinct numbers are staying on the positions *l**i*, *l**i*<=+<=1, ..., *n*. Formally, he want to find the number of distinct numbers among *a**l**i*,<=*a**l**i*<=+<=1,<=...,<=*a**n*.?
Sereja wrote out the necessary array elements but the array was so large and the boy was so pressed for time. Help him, find the answer for the described question for each *l**i*.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105) — the array elements.
Next *m* lines contain integers *l*1,<=*l*2,<=...,<=*l**m*. The *i*-th line contains integer *l**i* (1<=≤<=*l**i*<=≤<=*n*).
Output Specification:
Print *m* lines — on the *i*-th line print the answer to the number *l**i*.
Demo Input:
['10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n']
Demo Output:
['6\n6\n6\n6\n6\n5\n4\n3\n2\n1\n']
Note:
none | ```python
# -*- coding: utf-8 -*-
"""
Created on Wed Nov 9 14:38:48 2022
@author: thinkpad
"""
n,m = map(int,input().split())
array = [int(i) for i in input().split()]
l_last = 0
for _ in range(m):
l = int(input())
del array[:l-l_last-1:]
print(array)
text = set(array)
print(text)
print(len(text))
l_last = l
``` | 0 |
|
664 | A | Complicated GCD | PROGRAMMING | 800 | [
"math",
"number theory"
]
| null | null | Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type! | The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100). | Output one integer — greatest common divisor of all integers from *a* to *b* inclusive. | [
"1 2\n",
"61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n"
]
| [
"1\n",
"61803398874989484820458683436563811772030917980576\n"
]
| none | 500 | [
{
"input": "1 2",
"output": "1"
},
{
"input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576",
"output": "61803398874989484820458683436563811772030917980576"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "100 100000",
"output": "1"
},
{
"input": "12345 67890123456789123457",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158",
"output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158"
},
{
"input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751",
"output": "1"
},
{
"input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794",
"output": "1"
},
{
"input": "10000 1000000000",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "11210171722243 65715435710585778347",
"output": "1"
},
{
"input": "2921881079263974825226940825843 767693191032295360887755303860323261471",
"output": "1"
},
{
"input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085",
"output": "1"
},
{
"input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424",
"output": "1"
},
{
"input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614",
"output": "1"
},
{
"input": "15943150466658398903 15943150466658398903",
"output": "15943150466658398903"
},
{
"input": "410470228200245407491525399055972 410470228200245407491525399055972",
"output": "410470228200245407491525399055972"
},
{
"input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307",
"output": "51894705655711504622197349350106792045098781545973899451307"
},
{
"input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410",
"output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410"
},
{
"input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535",
"output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535"
},
{
"input": "1 2000000000",
"output": "1"
},
{
"input": "13 1928834874",
"output": "1"
},
{
"input": "87 2938984237482934238",
"output": "1"
},
{
"input": "213 413",
"output": "1"
},
{
"input": "3 4",
"output": "1"
}
]
| 1,658,924,533 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | from math import *
def main():
a, b = map(int, fin().split())
if a == b: return fout(a)
elif b//2 == 0: return fout(b//2)
else: return gcd(a, b)
# FastIO
from sys import stdin, stdout
def fin(): return stdin.readline().strip("\r\n")
def fout(s): return stdout.write(str(s)+'\n')
if __name__ == "__main__":
t = 1 or int(fin())
for i in range(t): main() | Title: Complicated GCD
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output Specification:
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
Demo Input:
['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n']
Demo Output:
['1\n', '61803398874989484820458683436563811772030917980576\n']
Note:
none | ```python
from math import *
def main():
a, b = map(int, fin().split())
if a == b: return fout(a)
elif b//2 == 0: return fout(b//2)
else: return gcd(a, b)
# FastIO
from sys import stdin, stdout
def fin(): return stdin.readline().strip("\r\n")
def fout(s): return stdout.write(str(s)+'\n')
if __name__ == "__main__":
t = 1 or int(fin())
for i in range(t): main()
``` | 0 |
|
583 | B | Robot's Task | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
]
| null | null | Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information. | The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information. | Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information. | [
"3\n0 2 0\n",
"5\n4 2 3 0 1\n",
"7\n0 3 1 0 5 2 6\n"
]
| [
"1\n",
"3\n",
"2\n"
]
| In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7. | 1,000 | [
{
"input": "3\n0 2 0",
"output": "1"
},
{
"input": "5\n4 2 3 0 1",
"output": "3"
},
{
"input": "7\n0 3 1 0 5 2 6",
"output": "2"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "0"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "3\n0 2 1",
"output": "1"
},
{
"input": "10\n7 1 9 3 5 8 6 0 2 4",
"output": "9"
},
{
"input": "10\n1 3 5 7 9 8 6 4 2 0",
"output": "9"
},
{
"input": "10\n5 0 0 1 3 2 2 2 5 7",
"output": "1"
},
{
"input": "10\n8 6 5 3 9 7 1 4 2 0",
"output": "8"
},
{
"input": "10\n1 2 4 5 0 1 3 7 1 4",
"output": "2"
},
{
"input": "10\n3 4 8 9 5 1 2 0 6 7",
"output": "6"
},
{
"input": "10\n2 2 0 0 6 2 9 0 2 0",
"output": "2"
},
{
"input": "10\n1 7 5 3 2 6 0 8 4 9",
"output": "8"
},
{
"input": "9\n1 3 8 6 2 4 5 0 7",
"output": "7"
},
{
"input": "9\n1 3 5 7 8 6 4 2 0",
"output": "8"
},
{
"input": "9\n2 4 3 1 3 0 5 4 3",
"output": "3"
},
{
"input": "9\n3 5 6 8 7 0 4 2 1",
"output": "5"
},
{
"input": "9\n2 0 8 1 0 3 0 5 3",
"output": "2"
},
{
"input": "9\n6 2 3 7 4 8 5 1 0",
"output": "4"
},
{
"input": "9\n3 1 5 6 0 3 2 0 0",
"output": "2"
},
{
"input": "9\n2 6 4 1 0 8 5 3 7",
"output": "7"
},
{
"input": "100\n27 20 18 78 93 38 56 2 48 75 36 88 96 57 69 10 25 74 68 86 65 85 66 14 22 12 43 80 99 34 42 63 61 71 77 15 37 54 21 59 23 94 28 30 50 84 62 76 47 16 26 64 82 92 72 53 17 11 41 91 35 83 79 95 67 13 1 7 3 4 73 90 8 19 33 58 98 32 39 45 87 52 60 46 6 44 49 70 51 9 5 29 31 24 40 97 81 0 89 55",
"output": "69"
},
{
"input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "99"
},
{
"input": "100\n13 89 81 0 62 1 59 92 29 13 1 37 2 8 53 15 20 34 12 70 0 85 97 55 84 60 37 54 14 65 22 69 30 22 95 44 59 85 50 80 9 71 91 93 74 21 11 78 28 21 40 81 76 24 26 60 48 85 61 68 89 76 46 73 34 52 98 29 4 38 94 51 5 55 6 27 74 27 38 37 82 70 44 89 51 59 30 37 15 55 63 78 42 39 71 43 4 10 2 13",
"output": "21"
},
{
"input": "100\n1 3 5 7 58 11 13 15 17 19 45 23 25 27 29 31 33 35 37 39 41 43 21 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 81 79 83 85 87 89 91 93 95 97 48 98 96 94 92 90 88 44 84 82 80 78 76 74 72 70 68 66 64 62 60 9 56 54 52 50 99 46 86 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "96"
},
{
"input": "100\n32 47 74 8 14 4 12 68 18 0 44 80 14 38 6 57 4 72 69 3 21 78 74 22 39 32 58 63 34 33 23 6 39 11 6 12 18 4 0 11 20 28 16 1 22 12 57 55 13 48 43 1 50 18 87 6 11 45 38 67 37 14 7 56 6 41 1 55 5 73 78 64 38 18 38 8 37 0 18 61 37 58 58 62 86 5 0 2 15 43 34 61 2 21 15 9 69 1 11 24",
"output": "4"
},
{
"input": "100\n40 3 55 7 6 77 13 46 17 64 21 54 25 27 91 41 1 15 37 82 23 43 42 47 26 95 53 5 11 59 61 9 78 67 69 58 73 0 36 79 60 83 2 87 63 33 71 89 97 99 98 93 56 92 19 88 86 84 39 28 65 20 34 76 51 94 66 12 62 49 96 72 24 52 48 50 44 35 74 31 38 57 81 32 22 80 70 29 30 18 68 16 14 90 10 8 85 4 45 75",
"output": "75"
},
{
"input": "100\n34 16 42 21 84 27 11 7 82 16 95 39 36 64 26 0 38 37 2 2 16 56 16 61 55 42 26 5 61 8 30 20 19 15 9 78 5 34 15 0 3 17 36 36 1 5 4 26 18 0 14 25 7 5 91 7 43 26 79 37 17 27 40 55 66 7 0 2 16 23 68 35 2 5 9 21 1 7 2 9 4 3 22 15 27 6 0 47 5 0 12 9 20 55 36 10 6 8 5 1",
"output": "3"
},
{
"input": "100\n35 53 87 49 13 24 93 20 5 11 31 32 40 52 96 46 1 25 66 69 28 88 84 82 70 9 75 39 26 21 18 29 23 57 90 16 48 22 95 0 58 43 7 73 8 62 63 30 64 92 79 3 6 94 34 12 76 99 67 55 56 97 14 91 68 36 44 78 41 71 86 89 47 74 4 45 98 37 80 33 83 27 42 59 72 54 17 60 51 81 15 77 65 50 10 85 61 19 38 2",
"output": "67"
},
{
"input": "99\n89 96 56 31 32 14 9 66 87 34 69 5 92 54 41 52 46 30 22 26 16 18 20 68 62 73 90 43 79 33 58 98 37 45 10 78 94 51 19 0 91 39 28 47 17 86 3 61 77 7 15 64 55 83 65 71 97 88 6 48 24 11 8 42 81 4 63 93 50 74 35 12 95 27 53 82 29 85 84 60 72 40 36 57 23 13 38 59 49 1 75 44 76 2 21 25 70 80 67",
"output": "75"
},
{
"input": "99\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "98"
},
{
"input": "99\n82 7 6 77 17 28 90 3 68 12 63 60 24 20 4 81 71 85 57 45 11 84 3 91 49 34 89 82 0 50 48 88 36 76 36 5 62 48 20 2 20 45 69 27 37 62 42 31 57 51 92 84 89 25 7 62 12 23 23 56 30 90 27 10 77 58 48 38 56 68 57 15 33 1 34 67 16 47 75 70 69 28 38 16 5 61 85 76 44 90 37 22 77 94 55 1 97 8 69",
"output": "22"
},
{
"input": "99\n1 51 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 42 43 45 47 49 3 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 8 76 74 72 70 68 66 22 62 60 58 56 54 52 0 48 46 44 41 40 38 36 34 32 30 28 26 24 64 20 18 16 14 12 10 78 6 4 2 50",
"output": "96"
},
{
"input": "99\n22 3 19 13 65 87 28 17 41 40 31 21 8 37 29 65 65 53 16 33 13 5 76 4 72 9 2 76 57 72 50 15 75 0 30 13 83 36 12 31 49 51 65 22 48 31 60 15 2 17 6 1 8 0 1 63 3 16 7 7 2 1 47 28 26 21 2 36 1 5 20 25 44 0 2 39 46 30 33 11 15 34 34 4 84 52 0 39 7 3 17 15 6 38 52 64 26 1 0",
"output": "3"
},
{
"input": "99\n24 87 25 82 97 11 37 15 23 19 34 17 76 13 45 89 33 1 27 78 63 43 54 47 49 2 42 41 75 83 61 90 65 67 21 71 60 57 77 62 81 58 85 69 3 91 68 55 72 93 29 94 66 16 88 86 84 53 14 39 35 44 9 70 80 92 56 79 74 5 64 31 52 50 48 46 51 59 40 38 36 96 32 30 28 95 7 22 20 18 26 73 12 10 8 6 4 98 0",
"output": "74"
},
{
"input": "99\n22 14 0 44 6 17 6 6 37 45 0 48 19 8 57 8 10 0 3 12 25 2 5 53 9 49 15 6 38 14 9 40 38 22 27 12 64 10 11 35 89 19 46 39 12 24 48 0 52 1 27 27 24 4 64 24 5 0 67 3 5 39 0 1 13 37 2 8 46 1 28 70 6 79 14 15 33 6 7 34 6 18 4 71 1 55 33 71 18 11 47 23 72 53 65 32 2 7 28",
"output": "3"
},
{
"input": "99\n28 59 73 89 52 27 0 20 36 12 83 95 31 24 54 94 49 14 51 34 50 93 13 1 2 68 63 48 41 81 23 43 18 9 16 38 33 60 62 3 40 85 72 69 90 98 11 37 22 44 35 6 21 39 82 10 64 66 96 42 74 30 8 67 97 46 84 32 17 57 75 71 5 26 4 55 58 29 7 15 45 19 92 91 78 65 88 25 86 80 77 87 79 53 47 70 56 76 61",
"output": "63"
}
]
| 1,443,907,856 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 62 | 0 | n = int(input())
A = list(map(int, input().split()))
ret = 0
for i, a in enumerate(A):
if i < a:
ret += 1
print(ret)
| Title: Robot's Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
Input Specification:
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
Output Specification:
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
Demo Input:
['3\n0 2 0\n', '5\n4 2 3 0 1\n', '7\n0 3 1 0 5 2 6\n']
Demo Output:
['1\n', '3\n', '2\n']
Note:
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7. | ```python
n = int(input())
A = list(map(int, input().split()))
ret = 0
for i, a in enumerate(A):
if i < a:
ret += 1
print(ret)
``` | 0 |
|
41 | A | Translation | PROGRAMMING | 800 | [
"implementation",
"strings"
]
| A. Translation | 2 | 256 | The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. | The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. | If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. | [
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
]
| [
"YES\n",
"NO\n",
"NO\n"
]
| none | 500 | [
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
]
| 1,599,991,356 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 218 | 0 | def solve():
print(["NO", "YES"][input() == input()[::-1]])
def main():
t = 1
#t = int(input())
for _ in range(t):
solve()
if __name__ == "__main__":
main() | Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
def solve():
print(["NO", "YES"][input() == input()[::-1]])
def main():
t = 1
#t = int(input())
for _ in range(t):
solve()
if __name__ == "__main__":
main()
``` | 3.9455 |
867 | A | Between the Offices | PROGRAMMING | 800 | [
"implementation"
]
| null | null | As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. | The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. | Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower). | [
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
]
| [
"NO\n",
"YES\n",
"NO\n",
"YES\n"
]
| In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | 500 | [
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
]
| 1,656,705,745 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 15 | 0 | n = int(input())
lastlocation = " "
locations = input()
StoF = 0
FtoS = 0
for i in (locations):
if i == S:
if lastlocation == "F":
FtoS = FtoS + 1
if i == "F":
if lastlocation == "S":
StoF = StoF + 1
lastlocation = i
if (StoF > FtoS):
print ("YES")
else:
print ("NO")
| Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | ```python
n = int(input())
lastlocation = " "
locations = input()
StoF = 0
FtoS = 0
for i in (locations):
if i == S:
if lastlocation == "F":
FtoS = FtoS + 1
if i == "F":
if lastlocation == "S":
StoF = StoF + 1
lastlocation = i
if (StoF > FtoS):
print ("YES")
else:
print ("NO")
``` | -1 |
|
920 | B | Tea Queue | PROGRAMMING | 1,200 | [
"implementation"
]
| null | null | Recently *n* students from city S moved to city P to attend a programming camp.
They moved there by train. In the evening, all students in the train decided that they want to drink some tea. Of course, no two people can use the same teapot simultaneously, so the students had to form a queue to get their tea.
*i*-th student comes to the end of the queue at the beginning of *l**i*-th second. If there are multiple students coming to the queue in the same moment, then the student with greater index comes after the student with lesser index. Students in the queue behave as follows: if there is nobody in the queue before the student, then he uses the teapot for exactly one second and leaves the queue with his tea; otherwise the student waits for the people before him to get their tea. If at the beginning of *r**i*-th second student *i* still cannot get his tea (there is someone before him in the queue), then he leaves the queue without getting any tea.
For each student determine the second he will use the teapot and get his tea (if he actually gets it). | The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=1000).
Then *t* test cases follow. The first line of each test case contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of students.
Then *n* lines follow. Each line contains two integer *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=5000) — the second *i*-th student comes to the end of the queue, and the second he leaves the queue if he still cannot get his tea.
It is guaranteed that for every condition *l**i*<=-<=1<=≤<=*l**i* holds.
The sum of *n* over all test cases doesn't exceed 1000.
Note that in hacks you have to set *t*<==<=1. | For each test case print *n* integers. *i*-th of them must be equal to the second when *i*-th student gets his tea, or 0 if he leaves without tea. | [
"2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3\n"
]
| [
"1 2 \n1 0 2 \n"
]
| The example contains 2 tests:
1. During 1-st second, students 1 and 2 come to the queue, and student 1 gets his tea. Student 2 gets his tea during 2-nd second. 1. During 1-st second, students 1 and 2 come to the queue, student 1 gets his tea, and student 2 leaves without tea. During 2-nd second, student 3 comes and gets his tea. | 0 | [
{
"input": "2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3",
"output": "1 2 \n1 0 2 "
},
{
"input": "19\n1\n1 1\n1\n1 2\n1\n1 1000\n1\n1 2000\n1\n2 2\n1\n2 3\n1\n2 1000\n1\n2 2000\n1\n1999 1999\n1\n1999 2000\n1\n2000 2000\n2\n1 1\n1 1\n2\n1 1\n1 2\n2\n1 2\n1 1\n2\n1 2000\n1 1\n2\n1 1\n1 2000\n2\n1 2000\n2 2\n2\n2 2000\n2 2\n2\n2 2\n2 2000",
"output": "1 \n1 \n1 \n1 \n2 \n2 \n2 \n2 \n1999 \n1999 \n2000 \n1 0 \n1 2 \n1 0 \n1 0 \n1 2 \n1 2 \n2 0 \n2 3 "
},
{
"input": "1\n11\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 "
},
{
"input": "1\n5\n1 1\n1 2\n1 5\n1 1\n1 1",
"output": "1 2 3 0 0 "
}
]
| 1,517,587,661 | 5,561 | Python 3 | RUNTIME_ERROR | TESTS | 1 | 61 | 5,734,400 | from collections import deque
t = int(input())
for i in range(t):
k = int(input())
a = deque([] for i in range(k))
for j in range(k):
a[j].append(j)
a[j].append([int(x) for x in input().split()])
t1 = a.popleft()
d = deque([t1])
ans = [0] * k
s = t1[1][0]
while d or a:
while len(a) > 0:
if a[0][1][0] <= s:
d.append(a.popleft())
else:
break
while True:
t1 = d.popleft()
if t1[1][1] >= s:
ans[t1[0]] = s
break
s += 1
print(*ans) | Title: Tea Queue
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently *n* students from city S moved to city P to attend a programming camp.
They moved there by train. In the evening, all students in the train decided that they want to drink some tea. Of course, no two people can use the same teapot simultaneously, so the students had to form a queue to get their tea.
*i*-th student comes to the end of the queue at the beginning of *l**i*-th second. If there are multiple students coming to the queue in the same moment, then the student with greater index comes after the student with lesser index. Students in the queue behave as follows: if there is nobody in the queue before the student, then he uses the teapot for exactly one second and leaves the queue with his tea; otherwise the student waits for the people before him to get their tea. If at the beginning of *r**i*-th second student *i* still cannot get his tea (there is someone before him in the queue), then he leaves the queue without getting any tea.
For each student determine the second he will use the teapot and get his tea (if he actually gets it).
Input Specification:
The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=1000).
Then *t* test cases follow. The first line of each test case contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of students.
Then *n* lines follow. Each line contains two integer *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=5000) — the second *i*-th student comes to the end of the queue, and the second he leaves the queue if he still cannot get his tea.
It is guaranteed that for every condition *l**i*<=-<=1<=≤<=*l**i* holds.
The sum of *n* over all test cases doesn't exceed 1000.
Note that in hacks you have to set *t*<==<=1.
Output Specification:
For each test case print *n* integers. *i*-th of them must be equal to the second when *i*-th student gets his tea, or 0 if he leaves without tea.
Demo Input:
['2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3\n']
Demo Output:
['1 2 \n1 0 2 \n']
Note:
The example contains 2 tests:
1. During 1-st second, students 1 and 2 come to the queue, and student 1 gets his tea. Student 2 gets his tea during 2-nd second. 1. During 1-st second, students 1 and 2 come to the queue, student 1 gets his tea, and student 2 leaves without tea. During 2-nd second, student 3 comes and gets his tea. | ```python
from collections import deque
t = int(input())
for i in range(t):
k = int(input())
a = deque([] for i in range(k))
for j in range(k):
a[j].append(j)
a[j].append([int(x) for x in input().split()])
t1 = a.popleft()
d = deque([t1])
ans = [0] * k
s = t1[1][0]
while d or a:
while len(a) > 0:
if a[0][1][0] <= s:
d.append(a.popleft())
else:
break
while True:
t1 = d.popleft()
if t1[1][1] >= s:
ans[t1[0]] = s
break
s += 1
print(*ans)
``` | -1 |
|
258 | A | Little Elephant and Bits | PROGRAMMING | 1,100 | [
"greedy",
"math"
]
| null | null | The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. | The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. | In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. | [
"101\n",
"110010\n"
]
| [
"11\n",
"11010\n"
]
| In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | 500 | [
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
]
| 1,591,912,118 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 9 | 372 | 2,252,800 | n=input()
n=list(n)
a=n.index('0')
n.remove(n[a])
print(''.join(map(str,n)))
| Title: Little Elephant and Bits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | ```python
n=input()
n=list(n)
a=n.index('0')
n.remove(n[a])
print(''.join(map(str,n)))
``` | -1 |
|
456 | A | Laptops | PROGRAMMING | 1,100 | [
"sortings"
]
| null | null | One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct. | If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes). | [
"2\n1 2\n2 1\n"
]
| [
"Happy Alex\n"
]
| none | 500 | [
{
"input": "2\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "2\n1 1\n2 2",
"output": "Poor Alex"
},
{
"input": "3\n2 2\n3 3\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n3 3\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "1\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n2 3\n1 1\n3 2",
"output": "Happy Alex"
},
{
"input": "4\n4 1\n3 2\n2 3\n1 4",
"output": "Happy Alex"
},
{
"input": "2\n2 1\n1 2",
"output": "Happy Alex"
},
{
"input": "3\n3 2\n1 1\n2 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 1\n3 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
}
]
| 1,680,862,009 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 15 | 0 | n = int(input())
a = []
for i in range(n):
a.append(list(map(int, input().split())))
a = list(sorted(a, key=lambda x: [-x[1], x[0]]))
print(a)
if a[0][1] > a[-1][1] and a[0][0] < a[-1][0]:
print('Happy Alex')
else:
print('Poor Alex')
| Title: Laptops
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct.
Output Specification:
If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes).
Demo Input:
['2\n1 2\n2 1\n']
Demo Output:
['Happy Alex\n']
Note:
none | ```python
n = int(input())
a = []
for i in range(n):
a.append(list(map(int, input().split())))
a = list(sorted(a, key=lambda x: [-x[1], x[0]]))
print(a)
if a[0][1] > a[-1][1] and a[0][0] < a[-1][0]:
print('Happy Alex')
else:
print('Poor Alex')
``` | 0 |
|
724 | A | Checking the Calendar | PROGRAMMING | 1,000 | [
"implementation"
]
| null | null | You are given names of two days of the week.
Please, determine whether it is possible that during some non-leap year the first day of some month was equal to the first day of the week you are given, while the first day of the next month was equal to the second day of the week you are given. Both months should belong to one year.
In this problem, we consider the Gregorian calendar to be used. The number of months in this calendar is equal to 12. The number of days in months during any non-leap year is: 31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31.
Names of the days of the week are given with lowercase English letters: "monday", "tuesday", "wednesday", "thursday", "friday", "saturday", "sunday". | The input consists of two lines, each of them containing the name of exactly one day of the week. It's guaranteed that each string in the input is from the set "monday", "tuesday", "wednesday", "thursday", "friday", "saturday", "sunday". | Print "YES" (without quotes) if such situation is possible during some non-leap year. Otherwise, print "NO" (without quotes). | [
"monday\ntuesday\n",
"sunday\nsunday\n",
"saturday\ntuesday\n"
]
| [
"NO\n",
"YES\n",
"YES\n"
]
| In the second sample, one can consider February 1 and March 1 of year 2015. Both these days were Sundays.
In the third sample, one can consider July 1 and August 1 of year 2017. First of these two days is Saturday, while the second one is Tuesday. | 500 | [
{
"input": "monday\ntuesday",
"output": "NO"
},
{
"input": "sunday\nsunday",
"output": "YES"
},
{
"input": "saturday\ntuesday",
"output": "YES"
},
{
"input": "tuesday\nthursday",
"output": "YES"
},
{
"input": "friday\nwednesday",
"output": "NO"
},
{
"input": "sunday\nsaturday",
"output": "NO"
},
{
"input": "monday\nmonday",
"output": "YES"
},
{
"input": "monday\nwednesday",
"output": "YES"
},
{
"input": "monday\nthursday",
"output": "YES"
},
{
"input": "monday\nfriday",
"output": "NO"
},
{
"input": "monday\nsaturday",
"output": "NO"
},
{
"input": "monday\nsunday",
"output": "NO"
},
{
"input": "tuesday\nmonday",
"output": "NO"
},
{
"input": "tuesday\ntuesday",
"output": "YES"
},
{
"input": "tuesday\nwednesday",
"output": "NO"
},
{
"input": "tuesday\nfriday",
"output": "YES"
},
{
"input": "tuesday\nsaturday",
"output": "NO"
},
{
"input": "tuesday\nsunday",
"output": "NO"
},
{
"input": "wednesday\nmonday",
"output": "NO"
},
{
"input": "wednesday\ntuesday",
"output": "NO"
},
{
"input": "wednesday\nwednesday",
"output": "YES"
},
{
"input": "wednesday\nthursday",
"output": "NO"
},
{
"input": "wednesday\nfriday",
"output": "YES"
},
{
"input": "wednesday\nsaturday",
"output": "YES"
},
{
"input": "wednesday\nsunday",
"output": "NO"
},
{
"input": "thursday\nmonday",
"output": "NO"
},
{
"input": "thursday\ntuesday",
"output": "NO"
},
{
"input": "thursday\nwednesday",
"output": "NO"
},
{
"input": "thursday\nthursday",
"output": "YES"
},
{
"input": "thursday\nfriday",
"output": "NO"
},
{
"input": "thursday\nsaturday",
"output": "YES"
},
{
"input": "thursday\nsunday",
"output": "YES"
},
{
"input": "friday\nmonday",
"output": "YES"
},
{
"input": "friday\ntuesday",
"output": "NO"
},
{
"input": "friday\nthursday",
"output": "NO"
},
{
"input": "friday\nsaturday",
"output": "NO"
},
{
"input": "friday\nsunday",
"output": "YES"
},
{
"input": "saturday\nmonday",
"output": "YES"
},
{
"input": "saturday\nwednesday",
"output": "NO"
},
{
"input": "saturday\nthursday",
"output": "NO"
},
{
"input": "saturday\nfriday",
"output": "NO"
},
{
"input": "saturday\nsaturday",
"output": "YES"
},
{
"input": "saturday\nsunday",
"output": "NO"
},
{
"input": "sunday\nmonday",
"output": "NO"
},
{
"input": "sunday\ntuesday",
"output": "YES"
},
{
"input": "sunday\nwednesday",
"output": "YES"
},
{
"input": "sunday\nthursday",
"output": "NO"
},
{
"input": "sunday\nfriday",
"output": "NO"
},
{
"input": "friday\nfriday",
"output": "YES"
},
{
"input": "friday\nsunday",
"output": "YES"
},
{
"input": "monday\nmonday",
"output": "YES"
},
{
"input": "friday\ntuesday",
"output": "NO"
},
{
"input": "thursday\nsaturday",
"output": "YES"
},
{
"input": "tuesday\nfriday",
"output": "YES"
},
{
"input": "sunday\nwednesday",
"output": "YES"
},
{
"input": "monday\nthursday",
"output": "YES"
},
{
"input": "saturday\nsunday",
"output": "NO"
},
{
"input": "friday\nmonday",
"output": "YES"
},
{
"input": "thursday\nthursday",
"output": "YES"
},
{
"input": "wednesday\nfriday",
"output": "YES"
},
{
"input": "thursday\nmonday",
"output": "NO"
},
{
"input": "wednesday\nsunday",
"output": "NO"
},
{
"input": "thursday\nfriday",
"output": "NO"
},
{
"input": "monday\nfriday",
"output": "NO"
},
{
"input": "wednesday\nsaturday",
"output": "YES"
},
{
"input": "thursday\nsunday",
"output": "YES"
},
{
"input": "saturday\nfriday",
"output": "NO"
},
{
"input": "saturday\nmonday",
"output": "YES"
}
]
| 1,476,024,925 | 2,147,483,647 | Python 3 | OK | TESTS | 68 | 78 | 4,608,000 | il=[4,7,7,3,5,1,3,6,2,4,7,2]
id = {"monday":1, "tuesday":2, "wednesday":3, "thursday":4, "friday":5, "saturday":6, "sunday":7}
a,b = id.get(input()),id.get(input())
ans = False
for i in range(11):
if il[i]-a == il[i+1]-b:
ans = True
break
print(["NO","YES"][ans])
| Title: Checking the Calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given names of two days of the week.
Please, determine whether it is possible that during some non-leap year the first day of some month was equal to the first day of the week you are given, while the first day of the next month was equal to the second day of the week you are given. Both months should belong to one year.
In this problem, we consider the Gregorian calendar to be used. The number of months in this calendar is equal to 12. The number of days in months during any non-leap year is: 31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31.
Names of the days of the week are given with lowercase English letters: "monday", "tuesday", "wednesday", "thursday", "friday", "saturday", "sunday".
Input Specification:
The input consists of two lines, each of them containing the name of exactly one day of the week. It's guaranteed that each string in the input is from the set "monday", "tuesday", "wednesday", "thursday", "friday", "saturday", "sunday".
Output Specification:
Print "YES" (without quotes) if such situation is possible during some non-leap year. Otherwise, print "NO" (without quotes).
Demo Input:
['monday\ntuesday\n', 'sunday\nsunday\n', 'saturday\ntuesday\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n']
Note:
In the second sample, one can consider February 1 and March 1 of year 2015. Both these days were Sundays.
In the third sample, one can consider July 1 and August 1 of year 2017. First of these two days is Saturday, while the second one is Tuesday. | ```python
il=[4,7,7,3,5,1,3,6,2,4,7,2]
id = {"monday":1, "tuesday":2, "wednesday":3, "thursday":4, "friday":5, "saturday":6, "sunday":7}
a,b = id.get(input()),id.get(input())
ans = False
for i in range(11):
if il[i]-a == il[i+1]-b:
ans = True
break
print(["NO","YES"][ans])
``` | 3 |
|
963 | A | Alternating Sum | PROGRAMMING | 1,800 | [
"math",
"number theory"
]
| null | null | You are given two integers $a$ and $b$. Moreover, you are given a sequence $s_0, s_1, \dots, s_{n}$. All values in $s$ are integers $1$ or $-1$. It's known that sequence is $k$-periodic and $k$ divides $n+1$. In other words, for each $k \leq i \leq n$ it's satisfied that $s_{i} = s_{i - k}$.
Find out the non-negative remainder of division of $\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}$ by $10^{9} + 9$.
Note that the modulo is unusual! | The first line contains four integers $n, a, b$ and $k$ $(1 \leq n \leq 10^{9}, 1 \leq a, b \leq 10^{9}, 1 \leq k \leq 10^{5})$.
The second line contains a sequence of length $k$ consisting of characters '+' and '-'.
If the $i$-th character (0-indexed) is '+', then $s_{i} = 1$, otherwise $s_{i} = -1$.
Note that only the first $k$ members of the sequence are given, the rest can be obtained using the periodicity property. | Output a single integer — value of given expression modulo $10^{9} + 9$. | [
"2 2 3 3\n+-+\n",
"4 1 5 1\n-\n"
]
| [
"7\n",
"999999228\n"
]
| In the first example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i})$ = $2^{2} 3^{0} - 2^{1} 3^{1} + 2^{0} 3^{2}$ = 7
In the second example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}) = -1^{4} 5^{0} - 1^{3} 5^{1} - 1^{2} 5^{2} - 1^{1} 5^{3} - 1^{0} 5^{4} = -781 \equiv 999999228 \pmod{10^{9} + 9}$. | 500 | [
{
"input": "2 2 3 3\n+-+",
"output": "7"
},
{
"input": "4 1 5 1\n-",
"output": "999999228"
},
{
"input": "1 1 4 2\n-+",
"output": "3"
},
{
"input": "3 1 4 4\n+--+",
"output": "45"
},
{
"input": "5 1 1 6\n++---+",
"output": "0"
},
{
"input": "5 2 2 6\n+--++-",
"output": "0"
},
{
"input": "686653196 115381398 884618610 3\n+-+",
"output": "542231211"
},
{
"input": "608663287 430477711 172252358 8\n-+--+-+-",
"output": "594681696"
},
{
"input": "904132655 827386249 118827660 334\n+++-+++++--+++----+-+-+-+-+--+-+---++--++--++--+-+-+++-+++--+-+-+----+-+-++++-----+--++++------+++-+-+-++-++++++++-+-++-+++--+--++------+--+-+++--++--+---++-++-+-+-++---++-++--+-+-++-+------+-+----+++-+++--+-+-+--+--+--+------+--+---+--+-++--+++---+-+-++--------+-++--++-+-+-+-+-+-+--+-++++-+++--+--++----+--+-++-++--+--+-+-++-+-++++-",
"output": "188208979"
},
{
"input": "234179195 430477711 115381398 12\n++++-+-+-+++",
"output": "549793323"
},
{
"input": "75952547 967294208 907708706 252\n++--++--+++-+-+--++--++++++---+++-++-+-----++++--++-+-++------+-+-+-++-+-+-++++------++---+-++++---+-+-++++--++++++--+-+++-++--+--+---++++---+-+++-+++--+-+--+++++---+--++-++++--++++-+-++-+++-++-----+-+++++----++--+++-+-+++++-+--++-++-+--+-++++--+-+-+-+",
"output": "605712499"
},
{
"input": "74709071 801809249 753674746 18\n++++++-+-+---+-+--",
"output": "13414893"
},
{
"input": "743329 973758 92942 82\n++----+-++++----+--+++---+--++++-+-+---+++++--+--+++++++--++-+++----+--+++++-+--+-",
"output": "299311566"
},
{
"input": "18111 291387 518587 2\n++",
"output": "724471355"
},
{
"input": "996144 218286 837447 1\n-",
"output": "549104837"
},
{
"input": "179358 828426 548710 67\n++++---+--++----+-+-++++----+--+---+------++-+-++++--+----+---+-+--",
"output": "759716474"
},
{
"input": "397521 174985 279760 1\n+",
"output": "25679493"
},
{
"input": "613632 812232 482342 1\n-",
"output": "891965141"
},
{
"input": "936810 183454 647048 1\n+",
"output": "523548992"
},
{
"input": "231531 250371 921383 28\n++-+------+--+--++++--+-+++-",
"output": "134450934"
},
{
"input": "947301 87242 360762 97\n--+++--+++-++--++-++--++--+++---+++--++++--+++++--+-++-++-----+-++-+--++-----+-++-+--++-++-+-----",
"output": "405016159"
},
{
"input": "425583346 814209084 570987274 1\n+",
"output": "63271171"
},
{
"input": "354062556 688076879 786825319 1\n+",
"output": "545304776"
},
{
"input": "206671954 13571766 192250278 1\n+",
"output": "717117421"
},
{
"input": "23047921 621656196 160244047 1\n-",
"output": "101533009"
},
{
"input": "806038018 740585177 987616107 293\n-+++++--++++---++-+--+-+---+-++++--+--+++--++---++++++++--+++++-+-++-+--+----+--+++-+-++-+++-+-+-+----------++-+-+++++++-+-+-+-++---+++-+-+-------+-+-++--++-++-++-++-+---+--++-++--+++--+++-+-+----++--+-+-++-+---+---+-+-+++------+-+++-+---++-+--+++----+++++---++-++--+----+++-+--+++-+------+-++",
"output": "441468166"
},
{
"input": "262060935 184120408 148332034 148\n+--+-------+-+-+--++-+++--++-+-++++++--++-+++-+++--+-------+-+--+++-+-+-+---++-++-+-++---+--+-+-+--+------+++--+--+-+-+---+---+-+-++++---+++--+++---",
"output": "700325386"
},
{
"input": "919350941 654611542 217223605 186\n++-++-+++++-+++--+---+++++++-++-+----+-++--+-++--++--+++-+++---+--+--++-+-+++-+-+++-++---+--+++-+-+++--+-+-------+-++------++---+-+---++-++-++---+-+--+-+--+++++---+--+--++++-++-++--+--++",
"output": "116291420"
},
{
"input": "289455627 906207104 512692624 154\n-------++--+++---++-++------++----------+--+++-+-+++---+---+++--++++++--+-+-+--+---+-+-++-++--+-++--++++---+-+---+-----+--+-+---------+++-++---++-+-+-----",
"output": "48198216"
},
{
"input": "258833760 515657142 791267045 1\n-",
"output": "935800888"
},
{
"input": "691617927 66917103 843055237 8\n--+++---",
"output": "147768186"
},
{
"input": "379582849 362892355 986900829 50\n++-++---+-+++++--++++--+--++--++-----+------++--+-",
"output": "927469713"
},
{
"input": "176799169 363368399 841293419 1\n+",
"output": "746494802"
},
{
"input": "144808247 203038656 166324035 4\n-+-+",
"output": "909066471"
},
{
"input": "477607531 177367565 20080950 2\n++",
"output": "928662830"
},
{
"input": "682074525 289438443 917164266 1\n+",
"output": "28048785"
},
{
"input": "938449224 59852396 219719125 1\n-",
"output": "648647459"
},
{
"input": "395171426 872478622 193568600 147\n+---++---+-+--+++++--+---+-++++-+-++---++++--+--+-+-++-+-++--------++---+++-+---++---+---+-+--+-++++-+++-+-+-++-+--+++-++-+-+-+-++++++-+---+---++--",
"output": "460881399"
},
{
"input": "403493428 317461491 556701240 1\n-",
"output": "936516261"
},
{
"input": "917751169 330191895 532837377 70\n-+-+++++++--++---++-+++++-+++-----+-+++---+--+-+-++-++-+-+-++-++-+----",
"output": "908035409"
},
{
"input": "252089413 552678586 938424519 1\n-",
"output": "627032736"
},
{
"input": "649316142 320010793 200197645 1\n-",
"output": "323650777"
},
{
"input": "116399299 784781190 299072480 5\n++++-",
"output": "754650814"
}
]
| 1,694,544,092 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 4 | 77 | 2,764,800 | M=10**9+9
n,a,b,k=[int(e) for e in input().split()]
seq=[1 if e=='+' else -1 for e in input()]
s=0
x=pow(a,n,M)
y=(pow(a,-1,M)*b)%M
for i in range(k):
s+=x*seq[i]
x*=y
s%=M
x%=M
q=pow(y,k,M)
S=s*(pow(q,(n+1)//k,M)-1)*pow(q-1,-1,M)
print(S%M) | Title: Alternating Sum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two integers $a$ and $b$. Moreover, you are given a sequence $s_0, s_1, \dots, s_{n}$. All values in $s$ are integers $1$ or $-1$. It's known that sequence is $k$-periodic and $k$ divides $n+1$. In other words, for each $k \leq i \leq n$ it's satisfied that $s_{i} = s_{i - k}$.
Find out the non-negative remainder of division of $\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}$ by $10^{9} + 9$.
Note that the modulo is unusual!
Input Specification:
The first line contains four integers $n, a, b$ and $k$ $(1 \leq n \leq 10^{9}, 1 \leq a, b \leq 10^{9}, 1 \leq k \leq 10^{5})$.
The second line contains a sequence of length $k$ consisting of characters '+' and '-'.
If the $i$-th character (0-indexed) is '+', then $s_{i} = 1$, otherwise $s_{i} = -1$.
Note that only the first $k$ members of the sequence are given, the rest can be obtained using the periodicity property.
Output Specification:
Output a single integer — value of given expression modulo $10^{9} + 9$.
Demo Input:
['2 2 3 3\n+-+\n', '4 1 5 1\n-\n']
Demo Output:
['7\n', '999999228\n']
Note:
In the first example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i})$ = $2^{2} 3^{0} - 2^{1} 3^{1} + 2^{0} 3^{2}$ = 7
In the second example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}) = -1^{4} 5^{0} - 1^{3} 5^{1} - 1^{2} 5^{2} - 1^{1} 5^{3} - 1^{0} 5^{4} = -781 \equiv 999999228 \pmod{10^{9} + 9}$. | ```python
M=10**9+9
n,a,b,k=[int(e) for e in input().split()]
seq=[1 if e=='+' else -1 for e in input()]
s=0
x=pow(a,n,M)
y=(pow(a,-1,M)*b)%M
for i in range(k):
s+=x*seq[i]
x*=y
s%=M
x%=M
q=pow(y,k,M)
S=s*(pow(q,(n+1)//k,M)-1)*pow(q-1,-1,M)
print(S%M)
``` | -1 |
|
854 | A | Fraction | PROGRAMMING | 800 | [
"brute force",
"constructive algorithms",
"math"
]
| null | null | Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem. | In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction. | Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum. | [
"3\n",
"4\n",
"12\n"
]
| [
"1 2\n",
"1 3\n",
"5 7\n"
]
| none | 500 | [
{
"input": "3",
"output": "1 2"
},
{
"input": "4",
"output": "1 3"
},
{
"input": "12",
"output": "5 7"
},
{
"input": "34",
"output": "15 19"
},
{
"input": "13",
"output": "6 7"
},
{
"input": "11",
"output": "5 6"
},
{
"input": "24",
"output": "11 13"
},
{
"input": "17",
"output": "8 9"
},
{
"input": "10",
"output": "3 7"
},
{
"input": "69",
"output": "34 35"
},
{
"input": "100",
"output": "49 51"
},
{
"input": "57",
"output": "28 29"
},
{
"input": "1000",
"output": "499 501"
},
{
"input": "999",
"output": "499 500"
},
{
"input": "998",
"output": "497 501"
},
{
"input": "997",
"output": "498 499"
},
{
"input": "996",
"output": "497 499"
},
{
"input": "995",
"output": "497 498"
},
{
"input": "994",
"output": "495 499"
},
{
"input": "5",
"output": "2 3"
},
{
"input": "6",
"output": "1 5"
},
{
"input": "8",
"output": "3 5"
},
{
"input": "9",
"output": "4 5"
},
{
"input": "423",
"output": "211 212"
},
{
"input": "876",
"output": "437 439"
},
{
"input": "29",
"output": "14 15"
}
]
| 1,505,578,705 | 2,147,483,647 | Python 3 | OK | TESTS | 26 | 62 | 0 | n=int(input())
if n%2==1:
print((n-1)//2, (n+1)//2)
else:
if n%4==0:
print(n//2-1, n//2+1)
else:
print(n//2-2, n//2+2) | Title: Fraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya is a big fan of mathematics, especially its part related to fractions. Recently he learned that a fraction is called proper iff its numerator is smaller than its denominator (*a*<=<<=*b*) and that the fraction is called irreducible if its numerator and its denominator are coprime (they do not have positive common divisors except 1).
During his free time, Petya thinks about proper irreducible fractions and converts them to decimals using the calculator. One day he mistakenly pressed addition button (<=+<=) instead of division button (÷) and got sum of numerator and denominator that was equal to *n* instead of the expected decimal notation.
Petya wanted to restore the original fraction, but soon he realized that it might not be done uniquely. That's why he decided to determine maximum possible proper irreducible fraction such that sum of its numerator and denominator equals *n*. Help Petya deal with this problem.
Input Specification:
In the only line of input there is an integer *n* (3<=≤<=*n*<=≤<=1000), the sum of numerator and denominator of the fraction.
Output Specification:
Output two space-separated positive integers *a* and *b*, numerator and denominator of the maximum possible proper irreducible fraction satisfying the given sum.
Demo Input:
['3\n', '4\n', '12\n']
Demo Output:
['1 2\n', '1 3\n', '5 7\n']
Note:
none | ```python
n=int(input())
if n%2==1:
print((n-1)//2, (n+1)//2)
else:
if n%4==0:
print(n//2-1, n//2+1)
else:
print(n//2-2, n//2+2)
``` | 3 |
|
463 | B | Caisa and Pylons | PROGRAMMING | 1,100 | [
"brute force",
"implementation",
"math"
]
| null | null | Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game? | The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons. | Print a single number representing the minimum number of dollars paid by Caisa. | [
"5\n3 4 3 2 4\n",
"3\n4 4 4\n"
]
| [
"4\n",
"4\n"
]
| In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon. | 1,000 | [
{
"input": "5\n3 4 3 2 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730",
"output": "4000"
},
{
"input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621",
"output": "3993"
},
{
"input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "30"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n69",
"output": "69"
}
]
| 1,638,412,235 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 46 | 512,000 | N = int(input())
H = [int(i) for i in input().split()]
cost = 0
energy = 0
h = 0
for i in range(N):
d = h - H[i]
h = H[i]
if energy + d < 0:
cost -= (energy + d)
else:
energy += d
print(cost)
| Title: Caisa and Pylons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
Output Specification:
Print a single number representing the minimum number of dollars paid by Caisa.
Demo Input:
['5\n3 4 3 2 4\n', '3\n4 4 4\n']
Demo Output:
['4\n', '4\n']
Note:
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon. | ```python
N = int(input())
H = [int(i) for i in input().split()]
cost = 0
energy = 0
h = 0
for i in range(N):
d = h - H[i]
h = H[i]
if energy + d < 0:
cost -= (energy + d)
else:
energy += d
print(cost)
``` | 0 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
]
| A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
]
| [
"4\n",
"4\n"
]
| none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
]
| 1,662,788,366 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | boat = input().split( )
if (int(boat[0])*int(boat[1]))%2==0:
print((int(boat[0])*int(boat[1]))/2)
else:
print(int((int(boat[0])*int(boat[1])-1)/2)) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
boat = input().split( )
if (int(boat[0])*int(boat[1]))%2==0:
print((int(boat[0])*int(boat[1]))/2)
else:
print(int((int(boat[0])*int(boat[1])-1)/2))
``` | 0 |
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
]
| A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
]
| [
"NO",
"YES"
]
| none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
]
| 1,680,790,107 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 81 | 124 | 0 | result = [0,0,0]
for i in range(int(input())):
val = [int(j) for j in input().split()]
for k in range(3) : result[k] = result[k] + val[k]
print("YES" if min(result)==max(result)==0 else "NO")
| Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
result = [0,0,0]
for i in range(int(input())):
val = [int(j) for j in input().split()]
for k in range(3) : result[k] = result[k] + val[k]
print("YES" if min(result)==max(result)==0 else "NO")
``` | 3.969 |
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
]
| A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
]
| [
"4\n"
]
| none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
]
| 1,672,974,903 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 46 | 0 | n = input("input n:")
n = int(n)
m = input("input m:")
m = int(m)
a = input("input a:")
a = int(a)
Snm = n * m
Sa = a * a
if 0 == m % a:
temp1 = int(m / a)
else:
temp1 = int(m / a) + 1
if 0 == n % a:
temp2 = int(n / a)
else:
temp2 = int(n / a) + 1
result = temp1*temp2
print(int(result))
| Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
n = input("input n:")
n = int(n)
m = input("input m:")
m = int(m)
a = input("input a:")
a = int(a)
Snm = n * m
Sa = a * a
if 0 == m % a:
temp1 = int(m / a)
else:
temp1 = int(m / a) + 1
if 0 == n % a:
temp2 = int(n / a)
else:
temp2 = int(n / a) + 1
result = temp1*temp2
print(int(result))
``` | -1 |
58 | A | Chat room | PROGRAMMING | 1,000 | [
"greedy",
"strings"
]
| A. Chat room | 1 | 256 | Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. | The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. | If Vasya managed to say hello, print "YES", otherwise print "NO". | [
"ahhellllloou\n",
"hlelo\n"
]
| [
"YES\n",
"NO\n"
]
| none | 500 | [
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
]
| 1,560,962,394 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 109 | 0 | s=input()
flag=0
for i in range(len(s)):
if s[i]=="h":
for j in range(i+1,len(s)):
if s[j]=="e":
for k in range(j+1,len(s)):
if s[k]=="l":
for l in range(k+1,len(s)):
if s[l]=="l":
for m in range(l+1,len(s)):
if s[m]=="o":
flag=1
break
break
break
break
break
if flag:
print("YES")
else:
print("NO") | Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
s=input()
flag=0
for i in range(len(s)):
if s[i]=="h":
for j in range(i+1,len(s)):
if s[j]=="e":
for k in range(j+1,len(s)):
if s[k]=="l":
for l in range(k+1,len(s)):
if s[l]=="l":
for m in range(l+1,len(s)):
if s[m]=="o":
flag=1
break
break
break
break
break
if flag:
print("YES")
else:
print("NO")
``` | 3.9455 |
0 | none | none | none | 0 | [
"none"
]
| null | null | The Fat Rat and his friend Сerealguy have had a bet whether at least a few oats are going to descend to them by some clever construction. The figure below shows the clever construction.
A more formal description of the clever construction is as follows. The clever construction consists of *n* rows with scales. The first row has *n* scales, the second row has (*n*<=-<=1) scales, the *i*-th row has (*n*<=-<=*i*<=+<=1) scales, the last row has exactly one scale. Let's number the scales in each row from the left to the right, starting from 1. Then the value of *w**i*,<=*k* in kilograms (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*<=-<=*i*<=+<=1) is the weight capacity parameter of the *k*-th scale in the *i*-th row.
If a body whose mass is not less than *w**i*,<=*k* falls on the scale with weight capacity *w**i*,<=*k*, then the scale breaks. At that anything that the scale has on it, either falls one level down to the left (if possible) or one level down to the right (if possible). In other words, if the scale *w**i*,<=*k* (*i*<=<<=*n*) breaks, then there are at most two possible variants in which the contents of the scale's pan can fall out: all contents of scale *w**i*,<=*k* falls either on scale *w**i*<=+<=1,<=*k*<=-<=1 (if it exists), or on scale *w**i*<=+<=1,<=*k* (if it exists). If scale *w**n*,<=1 breaks, then all its contents falls right in the Fat Rat's claws. Please note that the scales that are the first and the last in a row, have only one variant of dropping the contents.
Initially, oats are simultaneously put on all scales of the first level. The *i*-th scale has *a**i* kilograms of oats put on it. After that the scales start breaking and the oats start falling down in some way. You can consider everything to happen instantly. That is, the scale breaks instantly and the oats also fall instantly.
The Fat Rat is sure that whatever happens, he will not get the oats from the first level. Cerealguy is sure that there is such a scenario, when the rat gets at least some number of the oats. Help the Fat Rat and the Cerealguy. Determine, which one is right. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=50) — the number of rows with scales.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the masses of the oats in kilograms.
The next *n* lines contain descriptions of the scales: the *i*-th line contains (*n*<=-<=*i*<=+<=1) space-separated integers *w**i*,<=*k* (1<=≤<=*w**i*,<=*k*<=≤<=106) — the weight capacity parameters for the scales that stand on the *i*-th row, in kilograms. | Print "Fat Rat" if the Fat Rat is right, otherwise print "Cerealguy". | [
"1\n1\n2\n",
"2\n2 2\n1 2\n4\n",
"2\n2 2\n1 2\n5\n"
]
| [
"Fat Rat\n",
"Cerealguy\n",
"Fat Rat\n"
]
| Notes to the examples:
- The first example: the scale with weight capacity 2 gets 1. That means that the lower scale don't break. - The second sample: all scales in the top row obviously break. Then the oats fall on the lower row. Their total mass is 4,and that's exactly the weight that the lower scale can "nearly endure". So, as 4 ≥ 4, the scale breaks. | 0 | []
| 1,689,367,312 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | print("_RANDOM_GUESS_1689367311.812892")# 1689367311.812906 | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Fat Rat and his friend Сerealguy have had a bet whether at least a few oats are going to descend to them by some clever construction. The figure below shows the clever construction.
A more formal description of the clever construction is as follows. The clever construction consists of *n* rows with scales. The first row has *n* scales, the second row has (*n*<=-<=1) scales, the *i*-th row has (*n*<=-<=*i*<=+<=1) scales, the last row has exactly one scale. Let's number the scales in each row from the left to the right, starting from 1. Then the value of *w**i*,<=*k* in kilograms (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*k*<=≤<=*n*<=-<=*i*<=+<=1) is the weight capacity parameter of the *k*-th scale in the *i*-th row.
If a body whose mass is not less than *w**i*,<=*k* falls on the scale with weight capacity *w**i*,<=*k*, then the scale breaks. At that anything that the scale has on it, either falls one level down to the left (if possible) or one level down to the right (if possible). In other words, if the scale *w**i*,<=*k* (*i*<=<<=*n*) breaks, then there are at most two possible variants in which the contents of the scale's pan can fall out: all contents of scale *w**i*,<=*k* falls either on scale *w**i*<=+<=1,<=*k*<=-<=1 (if it exists), or on scale *w**i*<=+<=1,<=*k* (if it exists). If scale *w**n*,<=1 breaks, then all its contents falls right in the Fat Rat's claws. Please note that the scales that are the first and the last in a row, have only one variant of dropping the contents.
Initially, oats are simultaneously put on all scales of the first level. The *i*-th scale has *a**i* kilograms of oats put on it. After that the scales start breaking and the oats start falling down in some way. You can consider everything to happen instantly. That is, the scale breaks instantly and the oats also fall instantly.
The Fat Rat is sure that whatever happens, he will not get the oats from the first level. Cerealguy is sure that there is such a scenario, when the rat gets at least some number of the oats. Help the Fat Rat and the Cerealguy. Determine, which one is right.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=50) — the number of rows with scales.
The next line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the masses of the oats in kilograms.
The next *n* lines contain descriptions of the scales: the *i*-th line contains (*n*<=-<=*i*<=+<=1) space-separated integers *w**i*,<=*k* (1<=≤<=*w**i*,<=*k*<=≤<=106) — the weight capacity parameters for the scales that stand on the *i*-th row, in kilograms.
Output Specification:
Print "Fat Rat" if the Fat Rat is right, otherwise print "Cerealguy".
Demo Input:
['1\n1\n2\n', '2\n2 2\n1 2\n4\n', '2\n2 2\n1 2\n5\n']
Demo Output:
['Fat Rat\n', 'Cerealguy\n', 'Fat Rat\n']
Note:
Notes to the examples:
- The first example: the scale with weight capacity 2 gets 1. That means that the lower scale don't break. - The second sample: all scales in the top row obviously break. Then the oats fall on the lower row. Their total mass is 4,and that's exactly the weight that the lower scale can "nearly endure". So, as 4 ≥ 4, the scale breaks. | ```python
print("_RANDOM_GUESS_1689367311.812892")# 1689367311.812906
``` | 0 |
|
677 | A | Vanya and Fence | PROGRAMMING | 800 | [
"implementation"
]
| null | null | Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard? | The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person. | Print a single integer — the minimum possible valid width of the road. | [
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
]
| [
"4\n",
"6\n",
"11\n"
]
| In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11. | 500 | [
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
]
| 1,693,487,157 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 29 | 62 | 0 | n, h = map(int, input().split())
lst = list(map(int, input().split()))
total = 0
for fr in lst:
if fr > h:
total += 1
total += 1
print(total)
| Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11. | ```python
n, h = map(int, input().split())
lst = list(map(int, input().split()))
total = 0
for fr in lst:
if fr > h:
total += 1
total += 1
print(total)
``` | 3 |
|
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
]
| A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
]
| [
"word\nl10n\ni18n\np43s\n"
]
| none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
]
| 1,670,627,624 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | n = input()
if n.isdigit() == True:
print("word")
else:
print(f"{n[0]}{len(n) - 2}{n[-1]}") | Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
n = input()
if n.isdigit() == True:
print("word")
else:
print(f"{n[0]}{len(n) - 2}{n[-1]}")
``` | 0 |
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
]
| A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
]
| [
"4\n",
"4\n"
]
| none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
]
| 1,664,406,297 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 92 | 0 | ba=input()
size = ba.split(" ")
b,a = int(size [0]),int(size[1])
area = b*a
print(area//2) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
ba=input()
size = ba.split(" ")
b,a = int(size [0]),int(size[1])
area = b*a
print(area//2)
``` | 3.977 |
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
]
| A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
]
| [
"word\nl10n\ni18n\np43s\n"
]
| none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
]
| 1,679,057,831 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | mystr=input()
print(mystr[0]+str(len(mystr)-2)+mystr[-1]
| Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
mystr=input()
print(mystr[0]+str(len(mystr)-2)+mystr[-1]
``` | -1 |
381 | A | Sereja and Dima | PROGRAMMING | 800 | [
"greedy",
"implementation",
"two pointers"
]
| null | null | Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her. | The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000. | On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game. | [
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
]
| [
"12 5\n",
"16 12\n"
]
| In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5. | 500 | [
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
]
| 1,685,265,775 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 31 | 0 | n = int(input())
cards = list(map(int, input().split()))
i = 0
j = n - 1
score1 = 0
score2 = 0
round = 0
while i<=j:
round += 1
if round%2 == 1:
if cards[j] > cards[i]:
score1 += cards[j]
j -= 1
else:
score1 += cards[i]
i += 1
else:
if cards[j] > cards[i]:
score2 += cards[j]
j -= 1
else:
score2 += cards[i]
i += 1
print(score1, score2)
| Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5. | ```python
n = int(input())
cards = list(map(int, input().split()))
i = 0
j = n - 1
score1 = 0
score2 = 0
round = 0
while i<=j:
round += 1
if round%2 == 1:
if cards[j] > cards[i]:
score1 += cards[j]
j -= 1
else:
score1 += cards[i]
i += 1
else:
if cards[j] > cards[i]:
score2 += cards[j]
j -= 1
else:
score2 += cards[i]
i += 1
print(score1, score2)
``` | 3 |
|
349 | A | Cinema Line | PROGRAMMING | 1,100 | [
"greedy",
"implementation"
]
| null | null | The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line? | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line. | Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO". | [
"4\n25 25 50 50\n",
"2\n25 100\n",
"4\n50 50 25 25\n"
]
| [
"YES\n",
"NO\n",
"NO\n"
]
| none | 500 | [
{
"input": "4\n25 25 50 50",
"output": "YES"
},
{
"input": "2\n25 100",
"output": "NO"
},
{
"input": "4\n50 50 25 25",
"output": "NO"
},
{
"input": "3\n25 50 100",
"output": "NO"
},
{
"input": "10\n25 25 25 25 25 25 25 25 25 25",
"output": "YES"
},
{
"input": "10\n50 50 50 50 50 50 50 50 50 50",
"output": "NO"
},
{
"input": "10\n100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "7\n25 25 25 25 50 100 50",
"output": "YES"
},
{
"input": "2\n25 25",
"output": "YES"
},
{
"input": "3\n50 100 100",
"output": "NO"
},
{
"input": "3\n25 50 50",
"output": "NO"
},
{
"input": "2\n50 25",
"output": "NO"
},
{
"input": "14\n25 25 25 25 25 25 25 50 50 50 100 100 100 100",
"output": "NO"
},
{
"input": "5\n25 25 25 100 100",
"output": "NO"
},
{
"input": "7\n25 50 25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 25 50 50 50",
"output": "NO"
},
{
"input": "5\n25 25 50 100 50",
"output": "NO"
},
{
"input": "5\n25 25 50 50 100",
"output": "NO"
},
{
"input": "1\n50",
"output": "NO"
}
]
| 1,653,598,460 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 60 | 0 | n=int(input())
l=list(map(int,input().split()))
d={25:0,50:0,100:0}
ans=True
for x in l:
if x==25:
d[25]+=1
if x==50:
d[50]+=1
if d[25]>0:
d[25]-=1
else:
ans=False
break
if x==100:
d[100]+=1
if d[25]>0 and d[50]>0:
d[25]-=1
d[50]-=1
if d[25]>=3:
d[25]-=1
else:
ans=False
break
if ans:
print("YES")
else:
print("NO") | Title: Cinema Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line.
Output Specification:
Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO".
Demo Input:
['4\n25 25 50 50\n', '2\n25 100\n', '4\n50 50 25 25\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
n=int(input())
l=list(map(int,input().split()))
d={25:0,50:0,100:0}
ans=True
for x in l:
if x==25:
d[25]+=1
if x==50:
d[50]+=1
if d[25]>0:
d[25]-=1
else:
ans=False
break
if x==100:
d[100]+=1
if d[25]>0 and d[50]>0:
d[25]-=1
d[50]-=1
if d[25]>=3:
d[25]-=1
else:
ans=False
break
if ans:
print("YES")
else:
print("NO")
``` | 0 |
|
285 | A | Slightly Decreasing Permutations | PROGRAMMING | 1,100 | [
"greedy",
"implementation"
]
| null | null | Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1.
You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*. | The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient. | In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*.
If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists. | [
"5 2\n",
"3 0\n",
"3 2\n"
]
| [
"1 5 2 4 3\n",
"1 2 3\n",
"3 2 1\n"
]
| none | 500 | [
{
"input": "5 2",
"output": "1 5 2 4 3"
},
{
"input": "3 0",
"output": "1 2 3"
},
{
"input": "3 2",
"output": "3 2 1"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "2 0",
"output": "1 2"
},
{
"input": "2 1",
"output": "2 1"
},
{
"input": "10 4",
"output": "10 9 8 7 1 2 3 4 5 6"
},
{
"input": "56893 5084",
"output": "56893 56892 56891 56890 56889 56888 56887 56886 56885 56884 56883 56882 56881 56880 56879 56878 56877 56876 56875 56874 56873 56872 56871 56870 56869 56868 56867 56866 56865 56864 56863 56862 56861 56860 56859 56858 56857 56856 56855 56854 56853 56852 56851 56850 56849 56848 56847 56846 56845 56844 56843 56842 56841 56840 56839 56838 56837 56836 56835 56834 56833 56832 56831 56830 56829 56828 56827 56826 56825 56824 56823 56822 56821 56820 56819 56818 56817 56816 56815 56814 56813 56812 56811 56810 56809 5..."
},
{
"input": "6 3",
"output": "6 5 4 1 2 3"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "310 186",
"output": "310 309 308 307 306 305 304 303 302 301 300 299 298 297 296 295 294 293 292 291 290 289 288 287 286 285 284 283 282 281 280 279 278 277 276 275 274 273 272 271 270 269 268 267 266 265 264 263 262 261 260 259 258 257 256 255 254 253 252 251 250 249 248 247 246 245 244 243 242 241 240 239 238 237 236 235 234 233 232 231 230 229 228 227 226 225 224 223 222 221 220 219 218 217 216 215 214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183..."
},
{
"input": "726 450",
"output": "726 725 724 723 722 721 720 719 718 717 716 715 714 713 712 711 710 709 708 707 706 705 704 703 702 701 700 699 698 697 696 695 694 693 692 691 690 689 688 687 686 685 684 683 682 681 680 679 678 677 676 675 674 673 672 671 670 669 668 667 666 665 664 663 662 661 660 659 658 657 656 655 654 653 652 651 650 649 648 647 646 645 644 643 642 641 640 639 638 637 636 635 634 633 632 631 630 629 628 627 626 625 624 623 622 621 620 619 618 617 616 615 614 613 612 611 610 609 608 607 606 605 604 603 602 601 600 599..."
},
{
"input": "438 418",
"output": "438 437 436 435 434 433 432 431 430 429 428 427 426 425 424 423 422 421 420 419 418 417 416 415 414 413 412 411 410 409 408 407 406 405 404 403 402 401 400 399 398 397 396 395 394 393 392 391 390 389 388 387 386 385 384 383 382 381 380 379 378 377 376 375 374 373 372 371 370 369 368 367 366 365 364 363 362 361 360 359 358 357 356 355 354 353 352 351 350 349 348 347 346 345 344 343 342 341 340 339 338 337 336 335 334 333 332 331 330 329 328 327 326 325 324 323 322 321 320 319 318 317 316 315 314 313 312 311..."
},
{
"input": "854 829",
"output": "854 853 852 851 850 849 848 847 846 845 844 843 842 841 840 839 838 837 836 835 834 833 832 831 830 829 828 827 826 825 824 823 822 821 820 819 818 817 816 815 814 813 812 811 810 809 808 807 806 805 804 803 802 801 800 799 798 797 796 795 794 793 792 791 790 789 788 787 786 785 784 783 782 781 780 779 778 777 776 775 774 773 772 771 770 769 768 767 766 765 764 763 762 761 760 759 758 757 756 755 754 753 752 751 750 749 748 747 746 745 744 743 742 741 740 739 738 737 736 735 734 733 732 731 730 729 728 727..."
},
{
"input": "214 167",
"output": "214 213 212 211 210 209 208 207 206 205 204 203 202 201 200 199 198 197 196 195 194 193 192 191 190 189 188 187 186 185 184 183 182 181 180 179 178 177 176 175 174 173 172 171 170 169 168 167 166 165 164 163 162 161 160 159 158 157 156 155 154 153 152 151 150 149 148 147 146 145 144 143 142 141 140 139 138 137 136 135 134 133 132 131 130 129 128 127 126 125 124 123 122 121 120 119 118 117 116 115 114 113 112 111 110 109 108 107 106 105 104 103 102 101 100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 ..."
},
{
"input": "85705 56268",
"output": "85705 85704 85703 85702 85701 85700 85699 85698 85697 85696 85695 85694 85693 85692 85691 85690 85689 85688 85687 85686 85685 85684 85683 85682 85681 85680 85679 85678 85677 85676 85675 85674 85673 85672 85671 85670 85669 85668 85667 85666 85665 85664 85663 85662 85661 85660 85659 85658 85657 85656 85655 85654 85653 85652 85651 85650 85649 85648 85647 85646 85645 85644 85643 85642 85641 85640 85639 85638 85637 85636 85635 85634 85633 85632 85631 85630 85629 85628 85627 85626 85625 85624 85623 85622 85621 8..."
},
{
"input": "11417 4583",
"output": "11417 11416 11415 11414 11413 11412 11411 11410 11409 11408 11407 11406 11405 11404 11403 11402 11401 11400 11399 11398 11397 11396 11395 11394 11393 11392 11391 11390 11389 11388 11387 11386 11385 11384 11383 11382 11381 11380 11379 11378 11377 11376 11375 11374 11373 11372 11371 11370 11369 11368 11367 11366 11365 11364 11363 11362 11361 11360 11359 11358 11357 11356 11355 11354 11353 11352 11351 11350 11349 11348 11347 11346 11345 11344 11343 11342 11341 11340 11339 11338 11337 11336 11335 11334 11333 1..."
},
{
"input": "53481 20593",
"output": "53481 53480 53479 53478 53477 53476 53475 53474 53473 53472 53471 53470 53469 53468 53467 53466 53465 53464 53463 53462 53461 53460 53459 53458 53457 53456 53455 53454 53453 53452 53451 53450 53449 53448 53447 53446 53445 53444 53443 53442 53441 53440 53439 53438 53437 53436 53435 53434 53433 53432 53431 53430 53429 53428 53427 53426 53425 53424 53423 53422 53421 53420 53419 53418 53417 53416 53415 53414 53413 53412 53411 53410 53409 53408 53407 53406 53405 53404 53403 53402 53401 53400 53399 53398 53397 5..."
},
{
"input": "79193 77281",
"output": "79193 79192 79191 79190 79189 79188 79187 79186 79185 79184 79183 79182 79181 79180 79179 79178 79177 79176 79175 79174 79173 79172 79171 79170 79169 79168 79167 79166 79165 79164 79163 79162 79161 79160 79159 79158 79157 79156 79155 79154 79153 79152 79151 79150 79149 79148 79147 79146 79145 79144 79143 79142 79141 79140 79139 79138 79137 79136 79135 79134 79133 79132 79131 79130 79129 79128 79127 79126 79125 79124 79123 79122 79121 79120 79119 79118 79117 79116 79115 79114 79113 79112 79111 79110 79109 7..."
},
{
"input": "42607 42144",
"output": "42607 42606 42605 42604 42603 42602 42601 42600 42599 42598 42597 42596 42595 42594 42593 42592 42591 42590 42589 42588 42587 42586 42585 42584 42583 42582 42581 42580 42579 42578 42577 42576 42575 42574 42573 42572 42571 42570 42569 42568 42567 42566 42565 42564 42563 42562 42561 42560 42559 42558 42557 42556 42555 42554 42553 42552 42551 42550 42549 42548 42547 42546 42545 42544 42543 42542 42541 42540 42539 42538 42537 42536 42535 42534 42533 42532 42531 42530 42529 42528 42527 42526 42525 42524 42523 4..."
},
{
"input": "100000 0",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "100000 99999",
"output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..."
},
{
"input": "100000 53860",
"output": "100000 99999 99998 99997 99996 99995 99994 99993 99992 99991 99990 99989 99988 99987 99986 99985 99984 99983 99982 99981 99980 99979 99978 99977 99976 99975 99974 99973 99972 99971 99970 99969 99968 99967 99966 99965 99964 99963 99962 99961 99960 99959 99958 99957 99956 99955 99954 99953 99952 99951 99950 99949 99948 99947 99946 99945 99944 99943 99942 99941 99940 99939 99938 99937 99936 99935 99934 99933 99932 99931 99930 99929 99928 99927 99926 99925 99924 99923 99922 99921 99920 99919 99918 99917 99916 ..."
},
{
"input": "4 0",
"output": "1 2 3 4"
},
{
"input": "4 1",
"output": "4 1 2 3"
},
{
"input": "4 2",
"output": "4 3 1 2"
},
{
"input": "4 3",
"output": "4 3 2 1"
},
{
"input": "3 1",
"output": "3 1 2"
}
]
| 1,418,453,598 | 2,147,483,647 | Python 3 | OK | TESTS | 28 | 810 | 307,200 | '''
Created on ١٣/١٢/٢٠١٤
@author: mohamed265
'''
t = input().split()
for i in range(int(t[1])): print(int(t[0]) - i, end=' ')
for i in range(int(t[0]) - int(t[1])): print(i + 1, end=' ') | Title: Slightly Decreasing Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Permutation *p* is an ordered set of integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. We'll denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size or the length of permutation *p*1,<=<=*p*2,<=<=...,<=<=*p**n*.
The decreasing coefficient of permutation *p*1,<=*p*2,<=...,<=*p**n* is the number of such *i* (1<=≤<=*i*<=<<=*n*), that *p**i*<=><=*p**i*<=+<=1.
You have numbers *n* and *k*. Your task is to print the permutation of length *n* with decreasing coefficient *k*.
Input Specification:
The single line contains two space-separated integers: *n*,<=*k* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*k*<=<<=*n*) — the permutation length and the decreasing coefficient.
Output Specification:
In a single line print *n* space-separated integers: *p*1,<=*p*2,<=...,<=*p**n* — the permutation of length *n* with decreasing coefficient *k*.
If there are several permutations that meet this condition, print any of them. It is guaranteed that the permutation with the sought parameters exists.
Demo Input:
['5 2\n', '3 0\n', '3 2\n']
Demo Output:
['1 5 2 4 3\n', '1 2 3\n', '3 2 1\n']
Note:
none | ```python
'''
Created on ١٣/١٢/٢٠١٤
@author: mohamed265
'''
t = input().split()
for i in range(int(t[1])): print(int(t[0]) - i, end=' ')
for i in range(int(t[0]) - int(t[1])): print(i + 1, end=' ')
``` | 3 |
|
844 | A | Diversity | PROGRAMMING | 1,000 | [
"greedy",
"implementation",
"strings"
]
| null | null | Calculate the minimum number of characters you need to change in the string *s*, so that it contains at least *k* different letters, or print that it is impossible.
String *s* consists only of lowercase Latin letters, and it is allowed to change characters only to lowercase Latin letters too. | First line of input contains string *s*, consisting only of lowercase Latin letters (1<=≤<=|*s*|<=≤<=1000, |*s*| denotes the length of *s*).
Second line of input contains integer *k* (1<=≤<=*k*<=≤<=26). | Print single line with a minimum number of necessary changes, or the word «impossible» (without quotes) if it is impossible. | [
"yandex\n6\n",
"yahoo\n5\n",
"google\n7\n"
]
| [
"0\n",
"1\n",
"impossible\n"
]
| In the first test case string contains 6 different letters, so we don't need to change anything.
In the second test case string contains 4 different letters: {'*a*', '*h*', '*o*', '*y*'}. To get 5 different letters it is necessary to change one occurrence of '*o*' to some letter, which doesn't occur in the string, for example, {'*b*'}.
In the third test case, it is impossible to make 7 different letters because the length of the string is 6. | 500 | [
{
"input": "yandex\n6",
"output": "0"
},
{
"input": "yahoo\n5",
"output": "1"
},
{
"input": "google\n7",
"output": "impossible"
},
{
"input": "a\n1",
"output": "0"
},
{
"input": "z\n2",
"output": "impossible"
},
{
"input": "fwgfrwgkuwghfiruhewgirueguhergiqrbvgrgf\n26",
"output": "14"
},
{
"input": "nfevghreuoghrueighoqghbnebvnejbvnbgneluqe\n26",
"output": "12"
},
{
"input": "a\n3",
"output": "impossible"
},
{
"input": "smaxpqplaqqbxuqxalqmbmmgubbpspxhawbxsuqhhegpmmpebqmqpbbeplwaepxmsahuepuhuhwxeqmmlgqubuaxehwuwasgxpqmugbmuawuhwqlswllssueglbxepbmwgs\n1",
"output": "0"
},
{
"input": "cuguccgcugcugucgggggcgcgucgucugcuuuccccuugccg\n4",
"output": "1"
},
{
"input": "fcfccfcfccfcfcffcffffffcfccfccfcffccccfcffffccfccfcffcfcccccffcfffcccffcfccfffffcccfccffffffccfccccf\n20",
"output": "18"
},
{
"input": "swmkwaruyv\n5",
"output": "0"
},
{
"input": "tnbqpsuhkczmejirvyfdolxwga\n22",
"output": "0"
},
{
"input": "abcde\n3",
"output": "0"
},
{
"input": "abb\n1",
"output": "0"
},
{
"input": "aaaa\n1",
"output": "0"
},
{
"input": "abcde\n2",
"output": "0"
},
{
"input": "yandex\n4",
"output": "0"
},
{
"input": "aaabbbccc\n1",
"output": "0"
},
{
"input": "abcd\n2",
"output": "0"
},
{
"input": "asdfgh\n2",
"output": "0"
},
{
"input": "aab\n1",
"output": "0"
},
{
"input": "mynameissako\n5",
"output": "0"
},
{
"input": "abcde\n1",
"output": "0"
},
{
"input": "abcd\n3",
"output": "0"
},
{
"input": "abcdef\n2",
"output": "0"
},
{
"input": "abcdefg\n4",
"output": "0"
},
{
"input": "abc\n1",
"output": "0"
},
{
"input": "asdafjsgljdllgjdgkl\n5",
"output": "0"
},
{
"input": "yaay\n3",
"output": "1"
},
{
"input": "yaay\n4",
"output": "2"
},
{
"input": "zzzzzz\n2",
"output": "1"
}
]
| 1,656,920,946 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 31 | 0 | n = input()
m = int(input())
q = [0 for i in range(26)]
x = 0
if m > len(n):
print('imposible')
else:
for i in range(0, len(n)):
q[ord(n[i]) - 97] += 1
for i in range(0, len(q)):
if q[i] > 1:
x += q[i] - 1
print(x)
# Mon Jul 04 2022 07:49:05 GMT+0000 (Coordinated Universal Time)
| Title: Diversity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Calculate the minimum number of characters you need to change in the string *s*, so that it contains at least *k* different letters, or print that it is impossible.
String *s* consists only of lowercase Latin letters, and it is allowed to change characters only to lowercase Latin letters too.
Input Specification:
First line of input contains string *s*, consisting only of lowercase Latin letters (1<=≤<=|*s*|<=≤<=1000, |*s*| denotes the length of *s*).
Second line of input contains integer *k* (1<=≤<=*k*<=≤<=26).
Output Specification:
Print single line with a minimum number of necessary changes, or the word «impossible» (without quotes) if it is impossible.
Demo Input:
['yandex\n6\n', 'yahoo\n5\n', 'google\n7\n']
Demo Output:
['0\n', '1\n', 'impossible\n']
Note:
In the first test case string contains 6 different letters, so we don't need to change anything.
In the second test case string contains 4 different letters: {'*a*', '*h*', '*o*', '*y*'}. To get 5 different letters it is necessary to change one occurrence of '*o*' to some letter, which doesn't occur in the string, for example, {'*b*'}.
In the third test case, it is impossible to make 7 different letters because the length of the string is 6. | ```python
n = input()
m = int(input())
q = [0 for i in range(26)]
x = 0
if m > len(n):
print('imposible')
else:
for i in range(0, len(n)):
q[ord(n[i]) - 97] += 1
for i in range(0, len(q)):
if q[i] > 1:
x += q[i] - 1
print(x)
# Mon Jul 04 2022 07:49:05 GMT+0000 (Coordinated Universal Time)
``` | 0 |
|
979 | E | Kuro and Topological Parity | PROGRAMMING | 2,400 | [
"dp"
]
| null | null | Kuro has recently won the "Most intelligent cat ever" contest. The three friends then decided to go to Katie's home to celebrate Kuro's winning. After a big meal, they took a small break then started playing games.
Kuro challenged Katie to create a game with only a white paper, a pencil, a pair of scissors and a lot of arrows (you can assume that the number of arrows is infinite). Immediately, Katie came up with the game called Topological Parity.
The paper is divided into $n$ pieces enumerated from $1$ to $n$. Shiro has painted some pieces with some color. Specifically, the $i$-th piece has color $c_{i}$ where $c_{i} = 0$ defines black color, $c_{i} = 1$ defines white color and $c_{i} = -1$ means that the piece hasn't been colored yet.
The rules of the game is simple. Players must put some arrows between some pairs of different pieces in such a way that for each arrow, the number in the piece it starts from is less than the number of the piece it ends at. Also, two different pieces can only be connected by at most one arrow. After that the players must choose the color ($0$ or $1$) for each of the unpainted pieces. The score of a valid way of putting the arrows and coloring pieces is defined as the number of paths of pieces of alternating colors. For example, $[1 \to 0 \to 1 \to 0]$, $[0 \to 1 \to 0 \to 1]$, $[1]$, $[0]$ are valid paths and will be counted. You can only travel from piece $x$ to piece $y$ if and only if there is an arrow from $x$ to $y$.
But Kuro is not fun yet. He loves parity. Let's call his favorite parity $p$ where $p = 0$ stands for "even" and $p = 1$ stands for "odd". He wants to put the arrows and choose colors in such a way that the score has the parity of $p$.
It seems like there will be so many ways which satisfy Kuro. He wants to count the number of them but this could be a very large number. Let's help him with his problem, but print it modulo $10^{9} + 7$. | The first line contains two integers $n$ and $p$ ($1 \leq n \leq 50$, $0 \leq p \leq 1$) — the number of pieces and Kuro's wanted parity.
The second line contains $n$ integers $c_{1}, c_{2}, ..., c_{n}$ ($-1 \leq c_{i} \leq 1$) — the colors of the pieces. | Print a single integer — the number of ways to put the arrows and choose colors so the number of valid paths of alternating colors has the parity of $p$. | [
"3 1\n-1 0 1\n",
"2 1\n1 0\n",
"1 1\n-1\n"
]
| [
"6",
"1",
"2"
]
| In the first example, there are $6$ ways to color the pieces and add the arrows, as are shown in the figure below. The scores are $3, 3, 5$ for the first row and $5, 3, 3$ for the second row, both from left to right. | 2,250 | [
{
"input": "3 1\n-1 0 1",
"output": "6"
},
{
"input": "2 1\n1 0",
"output": "1"
},
{
"input": "1 1\n-1",
"output": "2"
},
{
"input": "1 0\n-1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "5 1\n-1 -1 -1 -1 -1",
"output": "16512"
},
{
"input": "5 0\n-1 -1 -1 -1 -1",
"output": "16256"
},
{
"input": "10 1\n1 1 1 1 0 0 0 1 0 0",
"output": "185921272"
},
{
"input": "50 1\n-1 -1 1 0 1 1 0 -1 1 0 -1 -1 0 0 -1 -1 0 1 1 -1 1 0 -1 1 1 -1 -1 -1 1 -1 -1 0 -1 0 -1 0 0 -1 -1 0 1 -1 0 1 -1 1 0 -1 -1 1",
"output": "803313751"
},
{
"input": "20 1\n0 0 -1 0 1 1 1 1 -1 -1 1 1 1 -1 0 0 1 1 1 0",
"output": "483548109"
},
{
"input": "30 0\n1 0 1 1 0 -1 0 1 -1 0 1 -1 0 -1 1 1 -1 1 0 1 0 -1 1 1 0 1 -1 0 1 1",
"output": "40673917"
},
{
"input": "40 1\n-1 1 1 1 0 -1 -1 1 1 -1 1 1 1 0 0 -1 1 0 1 -1 -1 1 0 1 1 0 1 0 0 -1 -1 1 -1 1 1 1 1 0 -1 0",
"output": "73320910"
},
{
"input": "50 1\n-1 -1 0 -1 1 0 1 0 1 -1 -1 0 0 0 -1 0 0 -1 0 1 -1 0 1 -1 1 -1 1 -1 -1 1 -1 -1 0 1 1 0 0 0 1 -1 -1 1 0 0 -1 0 1 1 0 0",
"output": "772364444"
},
{
"input": "50 1\n-1 -1 -1 -1 -1 0 -1 -1 -1 0 1 0 -1 0 1 -1 -1 -1 1 0 1 -1 0 1 0 1 0 0 1 1 -1 1 -1 -1 1 1 -1 -1 0 -1 -1 1 -1 1 -1 1 1 0 0 -1",
"output": "279519499"
},
{
"input": "3 1\n0 -1 -1",
"output": "18"
},
{
"input": "4 0\n1 -1 1 0",
"output": "64"
},
{
"input": "21 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "29 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "733922348"
},
{
"input": "41 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "3 0\n0 0 0",
"output": "0"
},
{
"input": "38 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "25 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "322050759"
},
{
"input": "30 0\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "549790477"
},
{
"input": "46 0\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "480432768"
},
{
"input": "10 0\n1 0 -1 1 -1 0 0 1 1 0",
"output": "743685088"
},
{
"input": "6 0\n-1 0 -1 1 1 1",
"output": "61440"
},
{
"input": "7 0\n1 0 1 1 -1 1 1",
"output": "2359296"
},
{
"input": "9 0\n0 -1 -1 -1 -1 -1 1 0 -1",
"output": "560111071"
},
{
"input": "6 1\n1 -1 -1 -1 0 0",
"output": "131072"
},
{
"input": "6 0\n0 -1 -1 0 0 -1",
"output": "135168"
},
{
"input": "8 0\n-1 0 1 -1 1 -1 1 1",
"output": "56964601"
},
{
"input": "6 1\n1 1 0 -1 -1 -1",
"output": "133120"
},
{
"input": "22 1\n0 -1 1 0 0 1 1 1 -1 -1 1 1 1 -1 1 1 0 0 -1 0 1 1",
"output": "981309322"
},
{
"input": "47 1\n0 -1 0 1 0 -1 1 -1 1 -1 1 -1 0 0 -1 0 -1 1 -1 -1 0 1 -1 1 0 0 1 -1 0 1 0 1 0 1 0 1 -1 -1 1 -1 -1 -1 0 1 1 0 1",
"output": "716651774"
},
{
"input": "2 1\n0 1",
"output": "1"
},
{
"input": "36 1\n-1 0 0 1 1 0 -1 -1 -1 -1 1 1 0 -1 0 1 0 -1 0 -1 0 1 0 -1 -1 0 1 -1 0 -1 0 -1 1 0 1 1",
"output": "693536347"
},
{
"input": "37 0\n0 -1 0 0 0 -1 0 1 0 0 -1 0 -1 -1 0 1 1 0 -1 -1 -1 -1 1 -1 0 0 0 1 -1 -1 1 -1 1 1 -1 -1 -1",
"output": "915368288"
},
{
"input": "4 1\n1 -1 -1 1",
"output": "120"
},
{
"input": "35 0\n0 0 -1 -1 1 -1 1 -1 1 0 1 0 -1 0 1 1 -1 1 -1 0 0 -1 0 0 1 -1 -1 0 1 1 -1 1 1 1 -1",
"output": "45647242"
},
{
"input": "25 1\n1 0 0 -1 -1 0 1 0 -1 1 0 0 0 -1 0 0 1 -1 -1 1 -1 -1 -1 1 1",
"output": "66699122"
},
{
"input": "36 1\n-1 0 -1 -1 1 0 0 -1 1 0 0 -1 1 -1 1 0 1 0 0 0 1 1 1 0 1 1 0 -1 1 -1 0 0 0 1 1 -1",
"output": "77953873"
},
{
"input": "9 1\n-1 -1 1 1 1 -1 -1 0 1",
"output": "608326411"
},
{
"input": "36 0\n-1 0 0 -1 -1 -1 0 -1 0 1 -1 -1 1 1 -1 1 0 0 1 -1 1 1 -1 0 0 1 1 1 -1 1 1 -1 1 1 1 -1",
"output": "152782818"
},
{
"input": "10 1\n1 1 1 -1 0 -1 -1 1 1 0",
"output": "487370169"
},
{
"input": "7 0\n1 0 -1 1 -1 1 0",
"output": "4194304"
},
{
"input": "2 0\n-1 0",
"output": "3"
},
{
"input": "5 1\n-1 1 0 0 -1",
"output": "1920"
},
{
"input": "2 0\n-1 -1",
"output": "6"
},
{
"input": "4 1\n0 1 -1 -1",
"output": "136"
},
{
"input": "5 0\n-1 0 0 0 1",
"output": "1088"
},
{
"input": "17 0\n0 -1 -1 0 1 -1 0 0 -1 -1 0 -1 -1 -1 0 0 0",
"output": "310296666"
},
{
"input": "10 0\n1 -1 0 1 1 -1 -1 0 1 0",
"output": "487370169"
},
{
"input": "31 0\n1 -1 -1 0 -1 0 -1 -1 0 -1 -1 -1 1 1 0 1 -1 1 1 0 0 -1 0 1 -1 1 0 -1 1 -1 -1",
"output": "304540143"
},
{
"input": "41 1\n0 0 -1 1 -1 -1 1 -1 -1 1 -1 1 -1 1 -1 0 1 1 1 0 0 1 1 -1 0 0 1 0 0 1 1 1 -1 0 -1 1 0 1 1 1 1",
"output": "589337580"
},
{
"input": "37 1\n1 -1 1 -1 -1 -1 0 1 -1 -1 1 0 0 0 1 1 -1 0 -1 1 -1 0 1 -1 -1 -1 -1 -1 0 -1 0 0 -1 0 -1 -1 -1",
"output": "916646835"
},
{
"input": "31 0\n1 0 1 1 0 0 0 -1 -1 -1 -1 -1 0 1 1 1 0 -1 1 -1 -1 1 -1 1 1 0 0 1 1 -1 0",
"output": "253181331"
},
{
"input": "4 1\n1 0 1 0",
"output": "32"
},
{
"input": "26 1\n1 -1 1 1 1 1 -1 1 -1 1 -1 -1 0 -1 -1 -1 1 0 -1 -1 0 1 -1 0 1 0",
"output": "996763118"
},
{
"input": "28 1\n0 0 1 1 -1 1 -1 1 0 -1 -1 -1 0 -1 0 -1 1 0 -1 1 0 -1 -1 0 -1 1 1 -1",
"output": "618844160"
},
{
"input": "24 1\n0 0 0 1 1 0 -1 0 -1 1 -1 -1 0 0 1 1 0 -1 0 0 0 0 1 1",
"output": "189147304"
},
{
"input": "17 0\n-1 0 -1 1 0 0 1 1 -1 -1 -1 -1 -1 1 1 -1 -1",
"output": "555719737"
},
{
"input": "42 1\n0 1 -1 0 -1 0 -1 1 -1 1 0 1 1 -1 0 -1 -1 1 -1 -1 0 -1 1 -1 0 1 0 1 -1 1 -1 1 0 0 -1 0 1 0 1 1 0 0",
"output": "386658717"
},
{
"input": "3 0\n0 -1 -1",
"output": "14"
},
{
"input": "9 1\n0 1 -1 -1 -1 -1 1 1 1",
"output": "755810045"
},
{
"input": "9 0\n1 1 0 0 1 -1 -1 0 0",
"output": "438952513"
},
{
"input": "14 1\n-1 0 0 1 -1 0 0 0 -1 -1 0 -1 0 0",
"output": "829277977"
},
{
"input": "20 0\n1 -1 1 -1 -1 -1 0 1 1 0 1 0 -1 1 1 -1 1 0 1 1",
"output": "841268608"
},
{
"input": "18 0\n1 1 1 -1 0 -1 -1 0 -1 -1 0 0 -1 0 -1 0 -1 1",
"output": "557382306"
},
{
"input": "16 0\n1 -1 0 0 0 -1 -1 -1 0 -1 -1 1 0 0 -1 1",
"output": "807669877"
},
{
"input": "27 1\n-1 0 -1 -1 -1 0 1 -1 1 0 0 -1 0 1 0 0 0 -1 -1 1 -1 -1 -1 0 1 0 0",
"output": "61073361"
},
{
"input": "2 0\n-1 1",
"output": "3"
},
{
"input": "34 1\n1 0 -1 0 0 0 -1 1 0 1 1 1 1 1 1 -1 0 0 1 0 -1 -1 -1 1 -1 -1 -1 1 1 1 -1 1 1 -1",
"output": "132603129"
},
{
"input": "17 0\n1 0 1 1 0 1 1 0 1 1 1 0 1 0 0 -1 0",
"output": "585862415"
},
{
"input": "16 0\n-1 0 0 1 0 0 0 0 -1 -1 -1 -1 1 1 0 1",
"output": "878929813"
},
{
"input": "17 0\n0 0 0 0 0 1 -1 -1 -1 1 -1 1 0 0 1 -1 -1",
"output": "427689083"
},
{
"input": "38 0\n-1 -1 1 1 -1 -1 1 -1 0 1 -1 1 1 1 -1 1 0 1 0 -1 1 -1 -1 0 0 1 -1 -1 0 -1 0 -1 -1 0 1 0 -1 0",
"output": "502273788"
},
{
"input": "33 0\n0 1 -1 -1 -1 1 -1 1 1 -1 -1 -1 -1 0 1 0 -1 0 0 -1 1 -1 -1 0 0 -1 0 0 1 0 1 1 1",
"output": "52976952"
},
{
"input": "32 1\n0 0 1 0 -1 0 1 -1 -1 -1 0 1 0 0 1 0 -1 -1 1 1 1 0 0 1 -1 -1 1 0 0 -1 0 1",
"output": "247728070"
},
{
"input": "6 0\n-1 1 1 -1 -1 -1",
"output": "267264"
},
{
"input": "27 1\n0 -1 1 0 -1 1 1 -1 0 -1 0 0 0 -1 -1 0 0 -1 -1 0 -1 0 -1 0 0 1 1",
"output": "28918236"
},
{
"input": "27 1\n0 -1 -1 1 1 1 -1 1 0 0 1 -1 -1 1 -1 1 1 1 1 1 0 0 0 0 -1 -1 0",
"output": "69931865"
},
{
"input": "17 1\n0 -1 -1 0 0 1 -1 -1 0 0 -1 1 0 -1 1 0 0",
"output": "427689083"
},
{
"input": "34 0\n1 1 1 0 0 0 0 1 0 0 1 -1 1 1 -1 0 -1 1 1 1 0 1 1 -1 0 0 1 -1 -1 0 0 0 -1 -1",
"output": "115086916"
},
{
"input": "31 1\n1 0 0 0 0 0 0 0 -1 0 0 0 1 -1 -1 -1 0 0 -1 0 1 -1 1 0 1 1 1 1 -1 -1 1",
"output": "186475897"
},
{
"input": "48 1\n1 0 0 0 1 -1 1 1 0 -1 0 -1 1 1 0 -1 -1 -1 0 0 0 1 0 1 0 -1 -1 -1 -1 1 0 1 -1 -1 -1 1 -1 0 1 0 0 1 -1 0 -1 0 0 0",
"output": "763606955"
},
{
"input": "5 0\n0 -1 0 0 0",
"output": "768"
},
{
"input": "43 0\n1 0 0 -1 0 -1 0 -1 1 1 -1 1 -1 0 0 1 -1 -1 -1 0 0 -1 1 -1 -1 1 0 0 1 -1 0 -1 -1 -1 -1 -1 1 1 0 -1 -1 -1 0",
"output": "477560567"
},
{
"input": "11 1\n1 0 1 0 -1 1 0 -1 -1 0 0",
"output": "67049563"
},
{
"input": "13 1\n-1 1 0 0 -1 0 -1 1 -1 -1 1 1 0",
"output": "621572676"
}
]
| 1,692,536,320 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 46 | 0 | print("_RANDOM_GUESS_1692536320.6932585")# 1692536320.6932738 | Title: Kuro and Topological Parity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kuro has recently won the "Most intelligent cat ever" contest. The three friends then decided to go to Katie's home to celebrate Kuro's winning. After a big meal, they took a small break then started playing games.
Kuro challenged Katie to create a game with only a white paper, a pencil, a pair of scissors and a lot of arrows (you can assume that the number of arrows is infinite). Immediately, Katie came up with the game called Topological Parity.
The paper is divided into $n$ pieces enumerated from $1$ to $n$. Shiro has painted some pieces with some color. Specifically, the $i$-th piece has color $c_{i}$ where $c_{i} = 0$ defines black color, $c_{i} = 1$ defines white color and $c_{i} = -1$ means that the piece hasn't been colored yet.
The rules of the game is simple. Players must put some arrows between some pairs of different pieces in such a way that for each arrow, the number in the piece it starts from is less than the number of the piece it ends at. Also, two different pieces can only be connected by at most one arrow. After that the players must choose the color ($0$ or $1$) for each of the unpainted pieces. The score of a valid way of putting the arrows and coloring pieces is defined as the number of paths of pieces of alternating colors. For example, $[1 \to 0 \to 1 \to 0]$, $[0 \to 1 \to 0 \to 1]$, $[1]$, $[0]$ are valid paths and will be counted. You can only travel from piece $x$ to piece $y$ if and only if there is an arrow from $x$ to $y$.
But Kuro is not fun yet. He loves parity. Let's call his favorite parity $p$ where $p = 0$ stands for "even" and $p = 1$ stands for "odd". He wants to put the arrows and choose colors in such a way that the score has the parity of $p$.
It seems like there will be so many ways which satisfy Kuro. He wants to count the number of them but this could be a very large number. Let's help him with his problem, but print it modulo $10^{9} + 7$.
Input Specification:
The first line contains two integers $n$ and $p$ ($1 \leq n \leq 50$, $0 \leq p \leq 1$) — the number of pieces and Kuro's wanted parity.
The second line contains $n$ integers $c_{1}, c_{2}, ..., c_{n}$ ($-1 \leq c_{i} \leq 1$) — the colors of the pieces.
Output Specification:
Print a single integer — the number of ways to put the arrows and choose colors so the number of valid paths of alternating colors has the parity of $p$.
Demo Input:
['3 1\n-1 0 1\n', '2 1\n1 0\n', '1 1\n-1\n']
Demo Output:
['6', '1', '2']
Note:
In the first example, there are $6$ ways to color the pieces and add the arrows, as are shown in the figure below. The scores are $3, 3, 5$ for the first row and $5, 3, 3$ for the second row, both from left to right. | ```python
print("_RANDOM_GUESS_1692536320.6932585")# 1692536320.6932738
``` | 0 |
|
558 | A | Lala Land and Apple Trees | PROGRAMMING | 1,100 | [
"brute force",
"implementation",
"sortings"
]
| null | null | Amr lives in Lala Land. Lala Land is a very beautiful country that is located on a coordinate line. Lala Land is famous with its apple trees growing everywhere.
Lala Land has exactly *n* apple trees. Tree number *i* is located in a position *x**i* and has *a**i* apples growing on it. Amr wants to collect apples from the apple trees. Amr currently stands in *x*<==<=0 position. At the beginning, he can choose whether to go right or left. He'll continue in his direction until he meets an apple tree he didn't visit before. He'll take all of its apples and then reverse his direction, continue walking in this direction until he meets another apple tree he didn't visit before and so on. In the other words, Amr reverses his direction when visiting each new apple tree. Amr will stop collecting apples when there are no more trees he didn't visit in the direction he is facing.
What is the maximum number of apples he can collect? | The first line contains one number *n* (1<=≤<=*n*<=≤<=100), the number of apple trees in Lala Land.
The following *n* lines contains two integers each *x**i*, *a**i* (<=-<=105<=≤<=*x**i*<=≤<=105, *x**i*<=≠<=0, 1<=≤<=*a**i*<=≤<=105), representing the position of the *i*-th tree and number of apples on it.
It's guaranteed that there is at most one apple tree at each coordinate. It's guaranteed that no tree grows in point 0. | Output the maximum number of apples Amr can collect. | [
"2\n-1 5\n1 5\n",
"3\n-2 2\n1 4\n-1 3\n",
"3\n1 9\n3 5\n7 10\n"
]
| [
"10",
"9",
"9"
]
| In the first sample test it doesn't matter if Amr chose at first to go left or right. In both cases he'll get all the apples.
In the second sample test the optimal solution is to go left to *x* = - 1, collect apples from there, then the direction will be reversed, Amr has to go to *x* = 1, collect apples from there, then the direction will be reversed and Amr goes to the final tree *x* = - 2.
In the third sample test the optimal solution is to go right to *x* = 1, collect apples from there, then the direction will be reversed and Amr will not be able to collect anymore apples because there are no apple trees to his left. | 500 | [
{
"input": "2\n-1 5\n1 5",
"output": "10"
},
{
"input": "3\n-2 2\n1 4\n-1 3",
"output": "9"
},
{
"input": "3\n1 9\n3 5\n7 10",
"output": "9"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "4\n10000 100000\n-1000 100000\n-2 100000\n-1 100000",
"output": "300000"
},
{
"input": "1\n-1 1",
"output": "1"
},
{
"input": "27\n-30721 24576\n-6620 92252\n88986 24715\n-94356 10509\n-6543 29234\n-68554 69530\n39176 96911\n67266 99669\n95905 51002\n-94093 92134\n65382 23947\n-6525 79426\n-448 67531\n-70083 26921\n-86333 50029\n48924 8036\n-27228 5349\n6022 10691\n-13840 56735\n50398 58794\n-63258 45557\n-27792 77057\n98295 1203\n-51294 18757\n35037 61941\n-30112 13076\n82334 20463",
"output": "1036452"
},
{
"input": "18\n-18697 44186\n56333 51938\n-75688 49735\n77762 14039\n-43996 81060\n69700 49107\n74532 45568\n-94476 203\n-92347 90745\n58921 44650\n57563 63561\n44630 8486\n35750 5999\n3249 34202\n75358 68110\n-33245 60458\n-88148 2342\n87856 85532",
"output": "632240"
},
{
"input": "28\n49728 91049\n-42863 4175\n-89214 22191\n77977 16965\n-42960 87627\n-84329 97494\n89270 75906\n-13695 28908\n-72279 13607\n-97327 87062\n-58682 32094\n39108 99936\n29304 93784\n-63886 48237\n-77359 57648\n-87013 79017\n-41086 35033\n-60613 83555\n-48955 56816\n-20568 26802\n52113 25160\n-88885 45294\n22601 42971\n62693 65662\n-15985 5357\n86671 8522\n-59921 11271\n-79304 25044",
"output": "891593"
},
{
"input": "25\n5704 67795\n6766 31836\n-41715 89987\n76854 9848\n11648 90020\n-79763 10107\n96971 92636\n-64205 71937\n87997 38273\n-9782 57187\n22186 6905\n-41130 40258\n-28403 66579\n19578 43375\n35735 52929\n-52417 89388\n-89430 1939\n9401 43491\n-11228 10112\n-86859 16024\n-51486 33467\n-80578 65080\n-52820 98445\n-89165 7657\n-97106 79422",
"output": "1109655"
},
{
"input": "16\n-41732 47681\n44295 28942\n-75194 99827\n69982 18020\n-75378 22026\n80032 22908\n-34879 41113\n36257 48574\n-35882 84333\n29646 71151\n-86214 80886\n72724 39364\n-42529 60880\n29150 29921\n-8471 80781\n79387 70834",
"output": "847241"
},
{
"input": "3\n-94146 4473\n28707 99079\n-4153 8857",
"output": "112409"
},
{
"input": "3\n-3 3\n-2 2\n-1 1",
"output": "1"
},
{
"input": "2\n100000 3\n-100000 9",
"output": "12"
},
{
"input": "2\n-100000 100000\n100000 99999",
"output": "199999"
}
]
| 1,606,404,863 | 2,147,483,647 | PyPy 3 | OK | TESTS | 46 | 156 | 0 | n=int(input())
pos=[]
neg=[]
for i in range(n):
x,y=map(int,input().split())
if x<0:
neg.append([x,y])
else:
pos.append([x,y])
pos.sort()
neg.sort(reverse=True)
l1=len(pos)
l2=len(neg)
m=min(l1,l2)
tot=0
for i in range(m):
tot+=neg[i][1]+pos[i][1]
if l1>l2:
tot+=pos[m][1]
elif l2>l1:
tot+=neg[m][1]
else:
pass
print(tot)
| Title: Lala Land and Apple Trees
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr lives in Lala Land. Lala Land is a very beautiful country that is located on a coordinate line. Lala Land is famous with its apple trees growing everywhere.
Lala Land has exactly *n* apple trees. Tree number *i* is located in a position *x**i* and has *a**i* apples growing on it. Amr wants to collect apples from the apple trees. Amr currently stands in *x*<==<=0 position. At the beginning, he can choose whether to go right or left. He'll continue in his direction until he meets an apple tree he didn't visit before. He'll take all of its apples and then reverse his direction, continue walking in this direction until he meets another apple tree he didn't visit before and so on. In the other words, Amr reverses his direction when visiting each new apple tree. Amr will stop collecting apples when there are no more trees he didn't visit in the direction he is facing.
What is the maximum number of apples he can collect?
Input Specification:
The first line contains one number *n* (1<=≤<=*n*<=≤<=100), the number of apple trees in Lala Land.
The following *n* lines contains two integers each *x**i*, *a**i* (<=-<=105<=≤<=*x**i*<=≤<=105, *x**i*<=≠<=0, 1<=≤<=*a**i*<=≤<=105), representing the position of the *i*-th tree and number of apples on it.
It's guaranteed that there is at most one apple tree at each coordinate. It's guaranteed that no tree grows in point 0.
Output Specification:
Output the maximum number of apples Amr can collect.
Demo Input:
['2\n-1 5\n1 5\n', '3\n-2 2\n1 4\n-1 3\n', '3\n1 9\n3 5\n7 10\n']
Demo Output:
['10', '9', '9']
Note:
In the first sample test it doesn't matter if Amr chose at first to go left or right. In both cases he'll get all the apples.
In the second sample test the optimal solution is to go left to *x* = - 1, collect apples from there, then the direction will be reversed, Amr has to go to *x* = 1, collect apples from there, then the direction will be reversed and Amr goes to the final tree *x* = - 2.
In the third sample test the optimal solution is to go right to *x* = 1, collect apples from there, then the direction will be reversed and Amr will not be able to collect anymore apples because there are no apple trees to his left. | ```python
n=int(input())
pos=[]
neg=[]
for i in range(n):
x,y=map(int,input().split())
if x<0:
neg.append([x,y])
else:
pos.append([x,y])
pos.sort()
neg.sort(reverse=True)
l1=len(pos)
l2=len(neg)
m=min(l1,l2)
tot=0
for i in range(m):
tot+=neg[i][1]+pos[i][1]
if l1>l2:
tot+=pos[m][1]
elif l2>l1:
tot+=neg[m][1]
else:
pass
print(tot)
``` | 3 |
|
214 | A | System of Equations | PROGRAMMING | 800 | [
"brute force"
]
| null | null | Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system. | A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space. | On a single line print the answer to the problem. | [
"9 3\n",
"14 28\n",
"4 20\n"
]
| [
"1\n",
"1\n",
"0\n"
]
| In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair. | 500 | [
{
"input": "9 3",
"output": "1"
},
{
"input": "14 28",
"output": "1"
},
{
"input": "4 20",
"output": "0"
},
{
"input": "18 198",
"output": "1"
},
{
"input": "22 326",
"output": "1"
},
{
"input": "26 104",
"output": "1"
},
{
"input": "14 10",
"output": "0"
},
{
"input": "8 20",
"output": "0"
},
{
"input": "2 8",
"output": "0"
},
{
"input": "20 11",
"output": "0"
},
{
"input": "57 447",
"output": "1"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "66 296",
"output": "1"
},
{
"input": "75 683",
"output": "1"
},
{
"input": "227 975",
"output": "1"
},
{
"input": "247 499",
"output": "1"
},
{
"input": "266 116",
"output": "1"
},
{
"input": "286 916",
"output": "1"
},
{
"input": "307 341",
"output": "1"
},
{
"input": "451 121",
"output": "1"
},
{
"input": "471 921",
"output": "1"
},
{
"input": "502 346",
"output": "1"
},
{
"input": "535 59",
"output": "1"
},
{
"input": "555 699",
"output": "1"
},
{
"input": "747 351",
"output": "1"
},
{
"input": "790 64",
"output": "1"
},
{
"input": "810 704",
"output": "1"
},
{
"input": "855 225",
"output": "1"
},
{
"input": "902 34",
"output": "1"
},
{
"input": "922 514",
"output": "1"
},
{
"input": "971 131",
"output": "1"
},
{
"input": "991 931",
"output": "1"
},
{
"input": "840 780",
"output": "0"
},
{
"input": "102 595",
"output": "0"
},
{
"input": "139 433",
"output": "0"
},
{
"input": "968 288",
"output": "0"
},
{
"input": "563 354",
"output": "0"
},
{
"input": "994 975",
"output": "0"
},
{
"input": "456 221",
"output": "0"
},
{
"input": "205 210",
"output": "0"
},
{
"input": "1 11",
"output": "0"
},
{
"input": "1000 1000",
"output": "0"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "11 99",
"output": "0"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "11 1",
"output": "0"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "100 452",
"output": "0"
},
{
"input": "420 380",
"output": "0"
},
{
"input": "31 31",
"output": "0"
},
{
"input": "2 6",
"output": "0"
},
{
"input": "112 134",
"output": "0"
},
{
"input": "13 13",
"output": "0"
},
{
"input": "1 571",
"output": "0"
}
]
| 1,630,548,659 | 2,147,483,647 | PyPy 3 | OK | TESTS | 54 | 248 | 21,401,600 | n, m = map(int, input().split())
dem = 0
for x in range(1001):
for y in range(1001):
if x * x + y == n and x + y * y == m: dem += 1
print(dem) | Title: System of Equations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Furik loves math lessons very much, so he doesn't attend them, unlike Rubik. But now Furik wants to get a good mark for math. For that Ms. Ivanova, his math teacher, gave him a new task. Furik solved the task immediately. Can you?
You are given a system of equations:
You should count, how many there are pairs of integers (*a*,<=*b*) (0<=≤<=*a*,<=*b*) which satisfy the system.
Input Specification:
A single line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the parameters of the system. The numbers on the line are separated by a space.
Output Specification:
On a single line print the answer to the problem.
Demo Input:
['9 3\n', '14 28\n', '4 20\n']
Demo Output:
['1\n', '1\n', '0\n']
Note:
In the first sample the suitable pair is integers (3, 0). In the second sample the suitable pair is integers (3, 5). In the third sample there is no suitable pair. | ```python
n, m = map(int, input().split())
dem = 0
for x in range(1001):
for y in range(1001):
if x * x + y == n and x + y * y == m: dem += 1
print(dem)
``` | 3 |
|
144 | A | Arrival of the General | PROGRAMMING | 800 | [
"implementation"
]
| null | null | A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct. | The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different. | Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like. | [
"4\n33 44 11 22\n",
"7\n10 10 58 31 63 40 76\n"
]
| [
"2\n",
"10\n"
]
| In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10) | 500 | [
{
"input": "4\n33 44 11 22",
"output": "2"
},
{
"input": "7\n10 10 58 31 63 40 76",
"output": "10"
},
{
"input": "2\n88 89",
"output": "1"
},
{
"input": "5\n100 95 100 100 88",
"output": "0"
},
{
"input": "7\n48 48 48 48 45 45 45",
"output": "0"
},
{
"input": "10\n68 47 67 29 63 71 71 65 54 56",
"output": "10"
},
{
"input": "15\n77 68 96 60 92 75 61 60 66 79 80 65 60 95 92",
"output": "4"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "20\n30 30 30 14 30 14 30 30 30 14 30 14 14 30 14 14 30 14 14 14",
"output": "0"
},
{
"input": "35\n37 41 46 39 47 39 44 47 44 42 44 43 47 39 46 39 38 42 39 37 40 44 41 42 41 42 39 42 36 36 42 36 42 42 42",
"output": "7"
},
{
"input": "40\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 98 99 99 99 99 99 99 99 99 100 99 99 99 99 99 99",
"output": "47"
},
{
"input": "50\n48 52 44 54 53 56 62 49 39 41 53 39 40 64 53 50 62 48 40 52 51 48 40 52 61 62 62 61 48 64 55 57 56 40 48 58 41 60 60 56 64 50 64 45 48 45 46 63 59 57",
"output": "50"
},
{
"input": "57\n7 24 17 19 6 19 10 11 12 22 14 5 5 11 13 10 24 19 24 24 24 11 21 20 4 14 24 24 18 13 24 3 20 3 3 3 3 9 3 9 22 22 16 3 3 3 15 11 3 3 8 17 10 13 3 14 13",
"output": "3"
},
{
"input": "65\n58 50 35 44 35 37 36 58 38 36 58 56 56 49 48 56 58 43 40 44 52 44 58 58 57 50 43 35 55 39 38 49 53 56 50 42 41 56 34 57 49 38 34 51 56 38 58 40 53 46 48 34 38 43 49 49 58 56 41 43 44 34 38 48 36",
"output": "3"
},
{
"input": "69\n70 48 49 48 49 71 48 53 55 69 48 53 54 58 53 63 48 48 69 67 72 75 71 75 74 74 57 63 65 60 48 48 65 48 48 51 50 49 62 53 76 68 76 56 76 76 64 76 76 57 61 76 73 51 59 76 65 50 69 50 76 67 76 63 62 74 74 58 73",
"output": "73"
},
{
"input": "75\n70 65 64 71 71 64 71 64 68 71 65 64 65 68 71 66 66 69 68 63 69 65 71 69 68 68 71 67 71 65 65 65 71 71 65 69 63 66 62 67 64 63 62 64 67 65 62 69 62 64 69 62 67 64 67 70 64 63 64 64 69 62 62 64 70 62 62 68 67 69 62 64 66 70 68",
"output": "7"
},
{
"input": "84\n92 95 84 85 94 80 90 86 80 92 95 84 86 83 86 83 93 91 95 92 84 88 82 84 84 84 80 94 93 80 94 80 95 83 85 80 95 95 80 84 86 92 83 81 90 87 81 89 92 93 80 87 90 85 93 85 93 94 93 89 94 83 93 91 80 83 90 94 95 80 95 92 85 84 93 94 94 82 91 95 95 89 85 94",
"output": "15"
},
{
"input": "90\n86 87 72 77 82 71 75 78 61 67 79 90 64 94 94 74 85 87 73 76 71 71 60 69 77 73 76 80 82 57 62 57 57 83 76 72 75 87 72 94 77 85 59 82 86 69 62 80 95 73 83 94 79 85 91 68 85 74 93 95 68 75 89 93 83 78 95 78 83 77 81 85 66 92 63 65 75 78 67 91 77 74 59 86 77 76 90 67 70 64",
"output": "104"
},
{
"input": "91\n94 98 96 94 95 98 98 95 98 94 94 98 95 95 99 97 97 94 95 98 94 98 96 98 96 98 97 95 94 94 94 97 94 96 98 98 98 94 96 95 94 95 97 97 97 98 94 98 96 95 98 96 96 98 94 97 96 98 97 95 97 98 94 95 94 94 97 94 96 97 97 93 94 95 95 94 96 98 97 96 94 98 98 96 96 96 96 96 94 96 97",
"output": "33"
},
{
"input": "92\n44 28 32 29 41 41 36 39 40 39 41 35 41 28 35 27 41 34 28 38 43 43 41 38 27 26 28 36 30 29 39 32 35 35 32 30 39 30 37 27 41 41 28 30 43 31 35 33 36 28 44 40 41 35 31 42 37 38 37 34 39 40 27 40 33 33 44 43 34 33 34 34 35 38 38 37 30 39 35 41 45 42 41 32 33 33 31 30 43 41 43 43",
"output": "145"
},
{
"input": "93\n46 32 52 36 39 30 57 63 63 30 32 44 27 59 46 38 40 45 44 62 35 36 51 48 39 58 36 51 51 51 48 58 59 36 29 35 31 49 64 60 34 38 42 56 33 42 52 31 63 34 45 51 35 45 33 53 33 62 31 38 66 29 51 54 28 61 32 45 57 41 36 34 47 36 31 28 67 48 52 46 32 40 64 58 27 53 43 57 34 66 43 39 26",
"output": "76"
},
{
"input": "94\n56 55 54 31 32 42 46 29 24 54 40 40 20 45 35 56 32 33 51 39 26 56 21 56 51 27 29 39 56 52 54 43 43 55 48 51 44 49 52 49 23 19 19 28 20 26 45 33 35 51 42 36 25 25 38 23 21 35 54 50 41 20 37 28 42 20 22 43 37 34 55 21 24 38 19 41 45 34 19 33 44 54 38 31 23 53 35 32 47 40 39 31 20 34",
"output": "15"
},
{
"input": "95\n57 71 70 77 64 64 76 81 81 58 63 75 81 77 71 71 71 60 70 70 69 67 62 64 78 64 69 62 76 76 57 70 68 77 70 68 73 77 79 73 60 57 69 60 74 65 58 75 75 74 73 73 65 75 72 57 81 62 62 70 67 58 76 57 79 81 68 64 58 77 70 59 79 64 80 58 71 59 81 71 80 64 78 80 78 65 70 68 78 80 57 63 64 76 81",
"output": "11"
},
{
"input": "96\n96 95 95 95 96 97 95 97 96 95 98 96 97 95 98 96 98 96 98 96 98 95 96 95 95 95 97 97 95 95 98 98 95 96 96 95 97 96 98 96 95 97 97 95 97 97 95 94 96 96 97 96 97 97 96 94 94 97 95 95 95 96 95 96 95 97 97 95 97 96 95 94 97 97 97 96 97 95 96 94 94 95 97 94 94 97 97 97 95 97 97 95 94 96 95 95",
"output": "13"
},
{
"input": "97\n14 15 12 12 13 15 12 15 12 12 12 12 12 14 15 15 13 12 15 15 12 12 12 13 14 15 15 13 14 15 14 14 14 14 12 13 12 13 13 12 15 12 13 13 15 12 15 13 12 13 13 13 14 13 12 15 14 13 14 15 13 14 14 13 14 12 15 12 14 12 13 14 15 14 13 15 13 12 15 15 15 13 15 15 13 14 16 16 16 13 15 13 15 14 15 15 15",
"output": "104"
},
{
"input": "98\n37 69 35 70 58 69 36 47 41 63 60 54 49 35 55 50 35 53 52 43 35 41 40 49 38 35 48 70 42 35 35 65 56 54 44 59 59 48 51 49 59 67 35 60 69 35 58 50 35 44 48 69 41 58 44 45 35 47 70 61 49 47 37 39 35 51 44 70 72 65 36 41 63 63 48 66 45 50 50 71 37 52 72 67 72 39 72 39 36 64 48 72 69 49 45 72 72 67",
"output": "100"
},
{
"input": "99\n31 31 16 15 19 31 19 22 29 27 12 22 28 30 25 33 26 25 19 22 34 21 17 33 31 22 16 26 22 30 31 17 13 33 13 17 28 25 18 33 27 22 31 22 13 27 20 22 23 15 24 32 29 13 16 20 32 33 14 33 19 27 16 28 25 17 17 28 18 26 32 33 19 23 30 13 14 23 24 28 14 28 22 20 30 14 24 23 17 29 18 28 29 21 28 18 16 24 32",
"output": "107"
},
{
"input": "100\n37 54 39 29 32 49 21 13 34 21 16 42 34 27 16 26 7 34 51 9 11 27 16 40 36 7 48 52 30 42 42 52 51 11 32 26 6 7 28 54 48 51 6 54 42 20 51 48 46 4 4 31 47 6 9 16 8 23 36 50 49 30 47 37 45 24 48 26 8 50 18 24 27 13 39 7 37 34 5 43 42 19 34 23 52 38 35 6 29 11 53 49 21 29 36 22 45 33 51 22",
"output": "50"
},
{
"input": "100\n41 5 20 23 5 47 28 28 64 5 12 14 34 56 22 48 6 52 39 55 62 40 24 54 39 28 56 27 35 51 14 24 38 10 55 20 39 62 52 2 30 55 49 48 15 23 59 44 31 28 66 29 62 59 31 13 28 12 50 45 41 47 29 27 64 66 14 39 62 22 44 63 24 5 63 17 42 7 25 41 49 33 31 51 63 3 37 66 19 9 2 40 16 45 56 21 34 29 39 61",
"output": "59"
},
{
"input": "100\n66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95",
"output": "99"
},
{
"input": "100\n81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "2\n100 99",
"output": "0"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "197"
},
{
"input": "100\n87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87",
"output": "0"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 3 2",
"output": "2"
}
]
| 1,694,968,818 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 60 | 0 | n = int(input())
standing = list(map(int,input().split()))
maxi = max(standing)
mini = min(standing)
position_max, position_min, max_shift, min_shift = 0,0,0,0
myset = set(standing)
for i in range (0, len(standing)):
if standing[i] == maxi:
position_max = i
if standing[i] == mini :
position_min = i
if position_min != len(standing):
min_shift = len(myset) - position_min
# print(maxi, mini,position_min,position_max)
print((position_max-1)+(min_shift)) | Title: Arrival of the General
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
Input Specification:
The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
Output Specification:
Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like.
Demo Input:
['4\n33 44 11 22\n', '7\n10 10 58 31 63 40 76\n']
Demo Output:
['2\n', '10\n']
Note:
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10) | ```python
n = int(input())
standing = list(map(int,input().split()))
maxi = max(standing)
mini = min(standing)
position_max, position_min, max_shift, min_shift = 0,0,0,0
myset = set(standing)
for i in range (0, len(standing)):
if standing[i] == maxi:
position_max = i
if standing[i] == mini :
position_min = i
if position_min != len(standing):
min_shift = len(myset) - position_min
# print(maxi, mini,position_min,position_max)
print((position_max-1)+(min_shift))
``` | 0 |
|
235 | A | LCM Challenge | PROGRAMMING | 1,600 | [
"number theory"
]
| null | null | Some days ago, I learned the concept of LCM (least common multiple). I've played with it for several times and I want to make a big number with it.
But I also don't want to use many numbers, so I'll choose three positive integers (they don't have to be distinct) which are not greater than *n*. Can you help me to find the maximum possible least common multiple of these three integers? | The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the *n* mentioned in the statement. | Print a single integer — the maximum possible LCM of three not necessarily distinct positive integers that are not greater than *n*. | [
"9\n",
"7\n"
]
| [
"504\n",
"210\n"
]
| The least common multiple of some positive integers is the least positive integer which is multiple for each of them.
The result may become very large, 32-bit integer won't be enough. So using 64-bit integers is recommended.
For the last example, we can chose numbers 7, 6, 5 and the LCM of them is 7·6·5 = 210. It is the maximum value we can get. | 500 | [
{
"input": "9",
"output": "504"
},
{
"input": "7",
"output": "210"
},
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "60"
},
{
"input": "6",
"output": "60"
},
{
"input": "33",
"output": "32736"
},
{
"input": "21",
"output": "7980"
},
{
"input": "2",
"output": "2"
},
{
"input": "41",
"output": "63960"
},
{
"input": "29",
"output": "21924"
},
{
"input": "117",
"output": "1560780"
},
{
"input": "149",
"output": "3241644"
},
{
"input": "733",
"output": "392222436"
},
{
"input": "925",
"output": "788888100"
},
{
"input": "509",
"output": "131096004"
},
{
"input": "829",
"output": "567662724"
},
{
"input": "117",
"output": "1560780"
},
{
"input": "605",
"output": "220348260"
},
{
"input": "245",
"output": "14526540"
},
{
"input": "925",
"output": "788888100"
},
{
"input": "213",
"output": "9527916"
},
{
"input": "53",
"output": "140556"
},
{
"input": "341",
"output": "39303660"
},
{
"input": "21",
"output": "7980"
},
{
"input": "605",
"output": "220348260"
},
{
"input": "149",
"output": "3241644"
},
{
"input": "733",
"output": "392222436"
},
{
"input": "117",
"output": "1560780"
},
{
"input": "53",
"output": "140556"
},
{
"input": "245",
"output": "14526540"
},
{
"input": "829",
"output": "567662724"
},
{
"input": "924",
"output": "783776526"
},
{
"input": "508",
"output": "130065780"
},
{
"input": "700",
"output": "341042100"
},
{
"input": "636",
"output": "254839470"
},
{
"input": "20",
"output": "6460"
},
{
"input": "604",
"output": "218891412"
},
{
"input": "796",
"output": "501826260"
},
{
"input": "732",
"output": "389016270"
},
{
"input": "412",
"output": "69256788"
},
{
"input": "700",
"output": "341042100"
},
{
"input": "244",
"output": "14289372"
},
{
"input": "828",
"output": "563559150"
},
{
"input": "508",
"output": "130065780"
},
{
"input": "796",
"output": "501826260"
},
{
"input": "636",
"output": "254839470"
},
{
"input": "924",
"output": "783776526"
},
{
"input": "245",
"output": "14526540"
},
{
"input": "828",
"output": "563559150"
},
{
"input": "21",
"output": "7980"
},
{
"input": "605",
"output": "220348260"
},
{
"input": "636",
"output": "254839470"
},
{
"input": "924",
"output": "783776526"
},
{
"input": "116",
"output": "1507420"
},
{
"input": "700",
"output": "341042100"
},
{
"input": "732",
"output": "389016270"
},
{
"input": "20",
"output": "6460"
},
{
"input": "508",
"output": "130065780"
},
{
"input": "148",
"output": "3154620"
},
{
"input": "828",
"output": "563559150"
},
{
"input": "763116",
"output": "444394078546562430"
},
{
"input": "756604",
"output": "433115377058855412"
},
{
"input": "447244",
"output": "89460162932862372"
},
{
"input": "372636",
"output": "51742503205363470"
},
{
"input": "546924",
"output": "163597318076822526"
},
{
"input": "540412",
"output": "157823524476316788"
},
{
"input": "714700",
"output": "365063922340784100"
},
{
"input": "520731",
"output": "141201007712496270"
},
{
"input": "695019",
"output": "335728459024850814"
},
{
"input": "688507",
"output": "326379736779169710"
},
{
"input": "862795",
"output": "642275489615199390"
},
{
"input": "668827",
"output": "299184742915995150"
},
{
"input": "810411",
"output": "532248411551110590"
},
{
"input": "836603",
"output": "585540171302562606"
},
{
"input": "978187",
"output": "935975171582120670"
},
{
"input": "816923",
"output": "545182335484592526"
},
{
"input": "958507",
"output": "880611813728059710"
},
{
"input": "984699",
"output": "954792870629291694"
},
{
"input": "642635",
"output": "265393998349453470"
},
{
"input": "296604",
"output": "26092892528622606"
},
{
"input": "1000000",
"output": "999996000003000000"
},
{
"input": "8",
"output": "280"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "12"
},
{
"input": "30",
"output": "21924"
},
{
"input": "18",
"output": "4080"
},
{
"input": "12",
"output": "990"
}
]
| 1,592,794,388 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 278 | 0 | from math import sqrt
def isPrime(i):
cut = int(sqrt(i))
for j in range(2, cut+1):
if i%j == 0:
return False
return True
def prime():
lst = []
for i in range(2,100):
if isPrime(i):
lst.append(i)
return lst
def lcm(n):
lst = []
prime_lst = prime()
while len(lst) < 3:
for i in range(10):
if n % prime_lst[i] == 0:
lst.append(n)
prime_lst.pop(i)
n -= 1
return lst[0]*lst[1]*lst[2]
n = int(input())
print(lcm(n))
| Title: LCM Challenge
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some days ago, I learned the concept of LCM (least common multiple). I've played with it for several times and I want to make a big number with it.
But I also don't want to use many numbers, so I'll choose three positive integers (they don't have to be distinct) which are not greater than *n*. Can you help me to find the maximum possible least common multiple of these three integers?
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the *n* mentioned in the statement.
Output Specification:
Print a single integer — the maximum possible LCM of three not necessarily distinct positive integers that are not greater than *n*.
Demo Input:
['9\n', '7\n']
Demo Output:
['504\n', '210\n']
Note:
The least common multiple of some positive integers is the least positive integer which is multiple for each of them.
The result may become very large, 32-bit integer won't be enough. So using 64-bit integers is recommended.
For the last example, we can chose numbers 7, 6, 5 and the LCM of them is 7·6·5 = 210. It is the maximum value we can get. | ```python
from math import sqrt
def isPrime(i):
cut = int(sqrt(i))
for j in range(2, cut+1):
if i%j == 0:
return False
return True
def prime():
lst = []
for i in range(2,100):
if isPrime(i):
lst.append(i)
return lst
def lcm(n):
lst = []
prime_lst = prime()
while len(lst) < 3:
for i in range(10):
if n % prime_lst[i] == 0:
lst.append(n)
prime_lst.pop(i)
n -= 1
return lst[0]*lst[1]*lst[2]
n = int(input())
print(lcm(n))
``` | 0 |
|
672 | A | Summer Camp | PROGRAMMING | 800 | [
"implementation"
]
| null | null | Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1. | The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print. | Print the *n*-th digit of the line. | [
"3\n",
"11\n"
]
| [
"3\n",
"0\n"
]
| In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10. | 500 | [
{
"input": "3",
"output": "3"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "29",
"output": "9"
},
{
"input": "30",
"output": "2"
},
{
"input": "1000",
"output": "3"
},
{
"input": "999",
"output": "9"
},
{
"input": "100",
"output": "5"
},
{
"input": "123",
"output": "6"
},
{
"input": "8",
"output": "8"
},
{
"input": "157",
"output": "3"
},
{
"input": "289",
"output": "1"
},
{
"input": "179",
"output": "4"
},
{
"input": "942",
"output": "0"
},
{
"input": "879",
"output": "9"
},
{
"input": "394",
"output": "1"
},
{
"input": "423",
"output": "7"
},
{
"input": "952",
"output": "3"
},
{
"input": "121",
"output": "5"
},
{
"input": "613",
"output": "2"
},
{
"input": "945",
"output": "1"
},
{
"input": "270",
"output": "6"
},
{
"input": "781",
"output": "2"
},
{
"input": "453",
"output": "7"
},
{
"input": "171",
"output": "0"
},
{
"input": "643",
"output": "2"
},
{
"input": "570",
"output": "6"
},
{
"input": "750",
"output": "6"
},
{
"input": "500",
"output": "0"
},
{
"input": "2",
"output": "2"
},
{
"input": "1",
"output": "1"
},
{
"input": "108",
"output": "5"
},
{
"input": "500",
"output": "0"
},
{
"input": "189",
"output": "9"
},
{
"input": "491",
"output": "0"
},
{
"input": "191",
"output": "0"
}
]
| 1,572,859,726 | 2,147,483,647 | PyPy 3 | OK | TESTS | 37 | 140 | 0 | # cf 672 A 800
def f(n):
if n < 9:
return n
elif n < 10 + (9 * 10 * 2):
# 10
# 123456789101112
# ^|$
x = ((n - 10) // 2) + 10
if n % 2 == 0:
return (x // 10)
else:
return (x % 10)
else: # n = 100 - 1000
# 1-9 (9)
# 10-99 (10-19) - (90 - 99) = 9 * 9 = 81
# 1-9|10-99|
prev = 10 + (9 * 10 * 2)
x = ((n - prev) // 3) + 100
if n % 3 == 0: # 10(0)
return (x % 10)
elif n % 3 == 1: # (1)00
return (x // 100)
elif n % 3 == 2: # 1(0)0
return ((x // 10) % 10)
n = int(input())
ans = f(n)
print(ans)
| Title: Summer Camp
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print.
Output Specification:
Print the *n*-th digit of the line.
Demo Input:
['3\n', '11\n']
Demo Output:
['3\n', '0\n']
Note:
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10. | ```python
# cf 672 A 800
def f(n):
if n < 9:
return n
elif n < 10 + (9 * 10 * 2):
# 10
# 123456789101112
# ^|$
x = ((n - 10) // 2) + 10
if n % 2 == 0:
return (x // 10)
else:
return (x % 10)
else: # n = 100 - 1000
# 1-9 (9)
# 10-99 (10-19) - (90 - 99) = 9 * 9 = 81
# 1-9|10-99|
prev = 10 + (9 * 10 * 2)
x = ((n - prev) // 3) + 100
if n % 3 == 0: # 10(0)
return (x % 10)
elif n % 3 == 1: # (1)00
return (x // 100)
elif n % 3 == 2: # 1(0)0
return ((x // 10) % 10)
n = int(input())
ans = f(n)
print(ans)
``` | 3 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
]
| A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
]
| [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
]
| none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
]
| 1,628,336,639 | 2,147,483,647 | Python 3 | OK | TESTS | 102 | 77 | 6,758,400 | x, y = input(), input()
for cx, cy in zip(x, y):
print("1" if cx != cy else "0", end="") | Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
x, y = input(), input()
for cx, cy in zip(x, y):
print("1" if cx != cy else "0", end="")
``` | 3.968161 |
41 | A | Translation | PROGRAMMING | 800 | [
"implementation",
"strings"
]
| A. Translation | 2 | 256 | The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. | The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. | If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. | [
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
]
| [
"YES\n",
"NO\n",
"NO\n"
]
| none | 500 | [
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
]
| 1,667,806,560 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | string1 = str(input())
string2 = str(input())
# code
# edoc
pointer2 = len(string2) - 1
pointer1 = 0
boolean = True
while pointer2 != -1:
if string2[pointer2] == string1[pointer1]:
print(string2[pointer2], string1[pointer1])
pointer2 -= 1
pointer1 += 1
else:
print("NO")
boolean = False
break
if boolean:
print("YES")
| Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
string1 = str(input())
string2 = str(input())
# code
# edoc
pointer2 = len(string2) - 1
pointer1 = 0
boolean = True
while pointer2 != -1:
if string2[pointer2] == string1[pointer1]:
print(string2[pointer2], string1[pointer1])
pointer2 -= 1
pointer1 += 1
else:
print("NO")
boolean = False
break
if boolean:
print("YES")
``` | 0 |
0 | none | none | none | 0 | [
"none"
]
| null | null | Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once. | The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters. | If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes. | [
"helloworld\nehoolwlroz\n",
"hastalavistababy\nhastalavistababy\n",
"merrychristmas\nchristmasmerry\n"
]
| [
"3\nh e\nl o\nd z\n",
"0\n",
"-1\n"
]
| none | 0 | [
{
"input": "helloworld\nehoolwlroz",
"output": "3\nh e\nl o\nd z"
},
{
"input": "hastalavistababy\nhastalavistababy",
"output": "0"
},
{
"input": "merrychristmas\nchristmasmerry",
"output": "-1"
},
{
"input": "kusyvdgccw\nkusyvdgccw",
"output": "0"
},
{
"input": "bbbbbabbab\naaaaabaaba",
"output": "1\nb a"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx",
"output": "-1"
},
{
"input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc",
"output": "1\nd b"
},
{
"input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd",
"output": "0"
},
{
"input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak",
"output": "5\ng f\nn i\nd h\ne o\nb k"
},
{
"input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc",
"output": "0"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "zz\nzy",
"output": "-1"
},
{
"input": "as\ndf",
"output": "2\na d\ns f"
},
{
"input": "abc\nbca",
"output": "-1"
},
{
"input": "rtfg\nrftg",
"output": "1\nt f"
},
{
"input": "y\ny",
"output": "0"
},
{
"input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz",
"output": "-1"
},
{
"input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm",
"output": "-1"
},
{
"input": "aaaaaa\nabcdef",
"output": "-1"
},
{
"input": "qwerty\nffffff",
"output": "-1"
},
{
"input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh",
"output": "0"
},
{
"input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe",
"output": "-1"
},
{
"input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba",
"output": "0"
},
{
"input": "dbadbddddb\nacbacaaaac",
"output": "-1"
},
{
"input": "dacbdbbbdd\nadbdadddaa",
"output": "-1"
},
{
"input": "bbbbcbcbbc\ndaddbabddb",
"output": "-1"
},
{
"input": "dddddbcdbd\nbcbbbdacdb",
"output": "-1"
},
{
"input": "cbadcbcdaa\nabbbababbb",
"output": "-1"
},
{
"input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk",
"output": "-1"
},
{
"input": "acbbccabaa\nabbbbbabaa",
"output": "-1"
},
{
"input": "ccccaccccc\naaaabaaaac",
"output": "-1"
},
{
"input": "acbacacbbb\nacbacacbbb",
"output": "0"
},
{
"input": "abbababbcc\nccccccccbb",
"output": "-1"
},
{
"input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh",
"output": "-1"
},
{
"input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage",
"output": "-1"
},
{
"input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai",
"output": "-1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "z\na",
"output": "1\nz a"
},
{
"input": "aa\nzz",
"output": "1\na z"
},
{
"input": "az\nza",
"output": "1\na z"
},
{
"input": "aa\nza",
"output": "-1"
},
{
"input": "za\nzz",
"output": "-1"
},
{
"input": "aa\nab",
"output": "-1"
},
{
"input": "hehe\nheeh",
"output": "-1"
},
{
"input": "bd\ncc",
"output": "-1"
},
{
"input": "he\nhh",
"output": "-1"
},
{
"input": "hee\nheh",
"output": "-1"
},
{
"input": "aa\nac",
"output": "-1"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "hello\nehlol",
"output": "-1"
},
{
"input": "ac\naa",
"output": "-1"
},
{
"input": "aaabbb\nbbbaab",
"output": "-1"
},
{
"input": "aa\nfa",
"output": "-1"
},
{
"input": "hg\nee",
"output": "-1"
},
{
"input": "helloworld\nehoolwlrow",
"output": "-1"
},
{
"input": "abb\nbab",
"output": "-1"
},
{
"input": "aaa\naae",
"output": "-1"
},
{
"input": "aba\nbaa",
"output": "-1"
},
{
"input": "aa\nba",
"output": "-1"
},
{
"input": "da\naa",
"output": "-1"
},
{
"input": "aaa\naab",
"output": "-1"
},
{
"input": "xy\nzz",
"output": "-1"
}
]
| 1,517,133,227 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 23 | 62 | 5,632,000 | s1 = input()
s2 = input()
l = len(s1)
ans = {}
flag = True
for i in range(l):
c1 = s1[i]
c2 = s2[i]
if ans.__contains__(c1):
if c2 != ans[c1]:
flag = False
break
else:
if ans.__contains__(c2):
if c1 != ans[c2]:
flag = False
break
else:
ans[c1] = c2
if flag:
res = {}
for key, value in ans.items():
if key != value:
res[key] = value
print(len(res))
for key, value in res.items():
print(key, value)
else:
print(-1)
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
Input Specification:
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
Output Specification:
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
Demo Input:
['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n']
Demo Output:
['3\nh e\nl o\nd z\n', '0\n', '-1\n']
Note:
none | ```python
s1 = input()
s2 = input()
l = len(s1)
ans = {}
flag = True
for i in range(l):
c1 = s1[i]
c2 = s2[i]
if ans.__contains__(c1):
if c2 != ans[c1]:
flag = False
break
else:
if ans.__contains__(c2):
if c1 != ans[c2]:
flag = False
break
else:
ans[c1] = c2
if flag:
res = {}
for key, value in ans.items():
if key != value:
res[key] = value
print(len(res))
for key, value in res.items():
print(key, value)
else:
print(-1)
``` | 0 |
|
55 | B | Smallest number | PROGRAMMING | 1,600 | [
"brute force"
]
| B. Smallest number | 2 | 256 | Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations. | First line contains four integers separated by space: 0<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000 — the original numbers. Second line contains three signs ('+' or '*' each) separated by space — the sequence of the operations in the order of performing. ('+' stands for addition, '*' — multiplication) | Output one integer number — the minimal result which can be obtained.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d). | [
"1 1 1 1\n+ + *\n",
"2 2 2 2\n* * +\n",
"1 2 3 4\n* + +\n"
]
| [
"3\n",
"8\n",
"9\n"
]
| none | 1,000 | [
{
"input": "1 1 1 1\n+ + *",
"output": "3"
},
{
"input": "2 2 2 2\n* * +",
"output": "8"
},
{
"input": "1 2 3 4\n* + +",
"output": "9"
},
{
"input": "15 1 3 1\n* * +",
"output": "18"
},
{
"input": "8 1 7 14\n+ + +",
"output": "30"
},
{
"input": "7 17 3 25\n+ * +",
"output": "63"
},
{
"input": "13 87 4 17\n* * *",
"output": "76908"
},
{
"input": "7 0 8 15\n+ + *",
"output": "0"
},
{
"input": "52 0 43 239\n+ + +",
"output": "334"
},
{
"input": "1000 1000 999 1000\n* * *",
"output": "999000000000"
},
{
"input": "720 903 589 804\n* * *",
"output": "307887168960"
},
{
"input": "631 149 496 892\n* * +",
"output": "445884"
},
{
"input": "220 127 597 394\n* + +",
"output": "28931"
},
{
"input": "214 862 466 795\n+ + +",
"output": "2337"
},
{
"input": "346 290 587 525\n* * *",
"output": "30922279500"
},
{
"input": "323 771 559 347\n+ * *",
"output": "149067730"
},
{
"input": "633 941 836 254\n* + +",
"output": "162559"
},
{
"input": "735 111 769 553\n+ * *",
"output": "92320032"
},
{
"input": "622 919 896 120\n* * +",
"output": "667592"
},
{
"input": "652 651 142 661\n+ + +",
"output": "2106"
},
{
"input": "450 457 975 35\n* * *",
"output": "7017806250"
},
{
"input": "883 954 804 352\n* * +",
"output": "1045740"
},
{
"input": "847 206 949 358\n* + *",
"output": "62660050"
},
{
"input": "663 163 339 76\n+ + +",
"output": "1241"
},
{
"input": "990 330 253 553\n+ * +",
"output": "85033"
},
{
"input": "179 346 525 784\n* * *",
"output": "25492034400"
},
{
"input": "780 418 829 778\n+ + *",
"output": "997766"
},
{
"input": "573 598 791 124\n* * *",
"output": "33608874936"
},
{
"input": "112 823 202 223\n* * +",
"output": "137222"
},
{
"input": "901 166 994 315\n* + *",
"output": "47278294"
},
{
"input": "393 342 840 486\n+ * *",
"output": "178222356"
},
{
"input": "609 275 153 598\n+ + *",
"output": "226746"
},
{
"input": "56 828 386 57\n+ * *",
"output": "3875088"
},
{
"input": "944 398 288 986\n+ + *",
"output": "670464"
},
{
"input": "544 177 162 21\n+ + *",
"output": "18543"
},
{
"input": "105 238 316 265\n+ + +",
"output": "924"
},
{
"input": "31 353 300 911\n* * *",
"output": "2990721900"
},
{
"input": "46 378 310 194\n* * +",
"output": "77528"
},
{
"input": "702 534 357 657\n+ * *",
"output": "259077042"
},
{
"input": "492 596 219 470\n+ + *",
"output": "341202"
},
{
"input": "482 842 982 902\n+ * +",
"output": "407728"
},
{
"input": "827 578 394 351\n* * *",
"output": "66105361764"
},
{
"input": "901 884 426 451\n* + *",
"output": "170223210"
},
{
"input": "210 295 12 795\n* * +",
"output": "71490"
},
{
"input": "40 734 948 202\n+ * *",
"output": "13590560"
},
{
"input": "136 611 963 195\n+ + *",
"output": "240584"
},
{
"input": "695 74 871 760\n+ * +",
"output": "53061"
},
{
"input": "666 884 772 54\n* + +",
"output": "37620"
},
{
"input": "975 785 753 224\n+ * +",
"output": "170432"
},
{
"input": "35 187 126 596\n+ + +",
"output": "944"
},
{
"input": "243 386 431 35\n* + *",
"output": "3298015"
},
{
"input": "229 602 133 635\n* * +",
"output": "222313"
},
{
"input": "916 207 238 891\n+ + *",
"output": "423315"
},
{
"input": "922 145 883 357\n+ + *",
"output": "313490"
},
{
"input": "69 355 762 111\n* + +",
"output": "8776"
},
{
"input": "209 206 34 67\n* + *",
"output": "476374"
},
{
"input": "693 824 375 361\n* * +",
"output": "557339"
},
{
"input": "45 712 635 467\n* + +",
"output": "22362"
},
{
"input": "426 283 179 211\n+ + +",
"output": "1099"
},
{
"input": "802 387 686 12\n+ + +",
"output": "1887"
}
]
| 1,607,695,813 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 280 | 0 | from itertools import permutations
num=list(map(int,input().split()))
ope=list(input())
def f(oper,x,y):
if oper=="*":
return x*y
else:
return x+y
ans=10**12
for a,b,c,d in permutations(num):
ans=min(ans,min(f(ope[2],f(ope[1],f(ope[0],a,b),c),d),f(ope[2],f(ope[0],f(ope[1],a,b),c),d)))
print(ans) | Title: Smallest number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Recently, Vladimir got bad mark in algebra again. To avoid such unpleasant events in future he decided to train his arithmetic skills. He wrote four integer numbers *a*, *b*, *c*, *d* on the blackboard. During each of the next three minutes he took two numbers from the blackboard (not necessarily adjacent) and replaced them with their sum or their product. In the end he got one number. Unfortunately, due to the awful memory he forgot that number, but he remembers four original numbers, sequence of the operations and his surprise because of the very small result. Help Vladimir remember the forgotten number: find the smallest number that can be obtained from the original numbers by the given sequence of operations.
Input Specification:
First line contains four integers separated by space: 0<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000 — the original numbers. Second line contains three signs ('+' or '*' each) separated by space — the sequence of the operations in the order of performing. ('+' stands for addition, '*' — multiplication)
Output Specification:
Output one integer number — the minimal result which can be obtained.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
Demo Input:
['1 1 1 1\n+ + *\n', '2 2 2 2\n* * +\n', '1 2 3 4\n* + +\n']
Demo Output:
['3\n', '8\n', '9\n']
Note:
none | ```python
from itertools import permutations
num=list(map(int,input().split()))
ope=list(input())
def f(oper,x,y):
if oper=="*":
return x*y
else:
return x+y
ans=10**12
for a,b,c,d in permutations(num):
ans=min(ans,min(f(ope[2],f(ope[1],f(ope[0],a,b),c),d),f(ope[2],f(ope[0],f(ope[1],a,b),c),d)))
print(ans)
``` | 0 |
99 | B | Help Chef Gerasim | PROGRAMMING | 1,300 | [
"implementation",
"sortings"
]
| B. Help Chef Gerasim | 0 | 256 | In a far away kingdom young pages help to set the table for the King. As they are terribly mischievous, one needs to keep an eye on the control whether they have set everything correctly. This time the royal chef Gerasim had the impression that the pages have played a prank again: they had poured the juice from one cup to another. Now Gerasim wants to check his hypothesis. The good thing is that chef Gerasim always pour the same number of milliliters of juice to all cups in the royal kitchen. Having thoroughly measured the juice in each cup, Gerasim asked you to write a program that will determine from which cup juice was poured to which one; otherwise, the program should determine that this time the pages set the table diligently.
To simplify your task we shall consider the cups to be bottomless so that the juice never overfills a cup and pours out, however much it can be. Besides, by some strange reason in a far away kingdom one can only pour to a cup or from one cup to another an integer number of milliliters of juice. | The first line contains integer *n* — the number of cups on the royal table (1<=≤<=*n*<=≤<=1000). Next *n* lines contain volumes of juice in each cup — non-negative integers, not exceeding 104. | If the pages didn't pour the juice, print "Exemplary pages." (without the quotes). If you can determine the volume of juice poured during exactly one juice pouring, print "*v* ml. from cup #*a* to cup #*b*." (without the quotes), where *v* represents the volume of poured juice, *a* represents the number of the cup from which the juice was poured (the cups are numbered with consecutive positive integers starting from one in the order in which the cups are described in the input data), *b* represents the number of the cup into which the juice was poured. Finally, if the given juice's volumes cannot be obtained using no more than one pouring (for example, the pages poured the juice from one cup to another more than once or the royal kitchen maids poured the juice into the cups incorrectly), print "Unrecoverable configuration." (without the quotes). | [
"5\n270\n250\n250\n230\n250\n",
"5\n250\n250\n250\n250\n250\n",
"5\n270\n250\n249\n230\n250\n"
]
| [
"20 ml. from cup #4 to cup #1.\n",
"Exemplary pages.\n",
"Unrecoverable configuration.\n"
]
| none | 1,000 | [
{
"input": "5\n270\n250\n250\n230\n250",
"output": "20 ml. from cup #4 to cup #1."
},
{
"input": "5\n250\n250\n250\n250\n250",
"output": "Exemplary pages."
},
{
"input": "5\n270\n250\n249\n230\n250",
"output": "Unrecoverable configuration."
},
{
"input": "4\n200\n190\n210\n200",
"output": "10 ml. from cup #2 to cup #3."
},
{
"input": "4\n1\n2\n3\n4",
"output": "Unrecoverable configuration."
},
{
"input": "1\n0",
"output": "Exemplary pages."
},
{
"input": "2\n0\n0",
"output": "Exemplary pages."
},
{
"input": "2\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "2\n0\n2",
"output": "1 ml. from cup #1 to cup #2."
},
{
"input": "2\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "2\n1\n1",
"output": "Exemplary pages."
},
{
"input": "2\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "2\n2\n0",
"output": "1 ml. from cup #2 to cup #1."
},
{
"input": "2\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "2\n2\n2",
"output": "Exemplary pages."
},
{
"input": "3\n0\n0\n0",
"output": "Exemplary pages."
},
{
"input": "3\n0\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "3\n0\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "3\n0\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "3\n0\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "3\n0\n1\n2",
"output": "1 ml. from cup #1 to cup #3."
},
{
"input": "3\n0\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "3\n0\n2\n1",
"output": "1 ml. from cup #1 to cup #2."
},
{
"input": "3\n0\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "3\n1\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "3\n1\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "3\n1\n0\n2",
"output": "1 ml. from cup #2 to cup #3."
},
{
"input": "3\n1\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "3\n1\n1\n1",
"output": "Exemplary pages."
},
{
"input": "3\n1\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "3\n1\n2\n0",
"output": "1 ml. from cup #3 to cup #2."
},
{
"input": "3\n1\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "3\n1\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "3\n2\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "3\n2\n0\n1",
"output": "1 ml. from cup #2 to cup #1."
},
{
"input": "3\n2\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "3\n2\n1\n0",
"output": "1 ml. from cup #3 to cup #1."
},
{
"input": "3\n2\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "3\n2\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "3\n2\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "3\n2\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "3\n2\n2\n2",
"output": "Exemplary pages."
},
{
"input": "4\n0\n0\n0\n0",
"output": "Exemplary pages."
},
{
"input": "4\n0\n0\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n0\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n0\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n0\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n0\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n0\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n0\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n0\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n1\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n1\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n1\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n1\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n1\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n1\n1\n2",
"output": "1 ml. from cup #1 to cup #4."
},
{
"input": "4\n0\n1\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n1\n2\n1",
"output": "1 ml. from cup #1 to cup #3."
},
{
"input": "4\n0\n1\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n1\n1",
"output": "1 ml. from cup #1 to cup #2."
},
{
"input": "4\n0\n2\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n0\n2\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n0\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n0\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n0\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n0\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n0\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n0\n1\n2",
"output": "1 ml. from cup #2 to cup #4."
},
{
"input": "4\n1\n0\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n0\n2\n1",
"output": "1 ml. from cup #2 to cup #3."
},
{
"input": "4\n1\n0\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n1\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n1\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n1\n0\n2",
"output": "1 ml. from cup #3 to cup #4."
},
{
"input": "4\n1\n1\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n1\n1\n1",
"output": "Exemplary pages."
},
{
"input": "4\n1\n1\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n1\n2\n0",
"output": "1 ml. from cup #4 to cup #3."
},
{
"input": "4\n1\n1\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n1\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n2\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n2\n0\n1",
"output": "1 ml. from cup #3 to cup #2."
},
{
"input": "4\n1\n2\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n2\n1\n0",
"output": "1 ml. from cup #4 to cup #2."
},
{
"input": "4\n1\n2\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n2\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n2\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n2\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n1\n2\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n1\n1",
"output": "1 ml. from cup #2 to cup #1."
},
{
"input": "4\n2\n0\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n0\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n1\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n1\n0\n1",
"output": "1 ml. from cup #3 to cup #1."
},
{
"input": "4\n2\n1\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n1\n1\n0",
"output": "1 ml. from cup #4 to cup #1."
},
{
"input": "4\n2\n1\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n1\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n1\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n1\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n1\n2\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n0\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n0\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n0\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n1\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n1\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n1\n2",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n2\n0",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n2\n1",
"output": "Unrecoverable configuration."
},
{
"input": "4\n2\n2\n2\n2",
"output": "Exemplary pages."
},
{
"input": "27\n5599\n5599\n5599\n5599\n5599\n5599\n5599\n5599\n5599\n5599\n2626\n5599\n5599\n5599\n5599\n5599\n8572\n5599\n5599\n5599\n5599\n5599\n5599\n5599\n5599\n5599\n5599",
"output": "2973 ml. from cup #11 to cup #17."
},
{
"input": "98\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n1204\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n702\n197\n702\n702\n702\n702\n702\n702\n702\n702\n702",
"output": "Unrecoverable configuration."
},
{
"input": "54\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6859\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n5389\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124\n6124",
"output": "735 ml. from cup #37 to cup #29."
},
{
"input": "50\n9636\n9678\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9636\n9596\n9636\n9636\n9636\n9636\n9636\n9636",
"output": "Unrecoverable configuration."
},
{
"input": "19\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n5001\n82\n5001\n9919\n5001\n5001",
"output": "Unrecoverable configuration."
},
{
"input": "74\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n3918\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n5330\n6742\n5330\n5330",
"output": "1412 ml. from cup #36 to cup #72."
}
]
| 1,598,079,490 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | s.add(drink)
if(len(s)>3):
print("Unrecoverable configuration.")
elif(len(s)==1):
print("Exemplary pages.")
elif(len(s)==2):
if(len(L)==2):
if(L[0]+L[1])%2==0:
cup1=1
cup2=2
if(L[0]>L[1]):
cup1=2
cup2=1
print(abs(L[1]-L[0])//2,"ml. from cup #"+str(cup1)+" to cup #"+str(cup2)+".")
else:
print("Unrecoverable configuration.")
else:
mini=min(L)
maxi=max(L)
countmin=0
countmax=0
cup1=0
cup2=0
for i in range(n):
if(L[i]==mini):
countmin+=1
if(L[i]==maxi):
countmax+=1
if(countmin==1 and countmax==1):
for i in range(n):
if(L[i]==mini):
cup1=i+1
if(L[i]==maxi):
cup2=i+1
print(abs(mini-maxi)//2,"ml. from cup #"+str(cup1)+" to cup #"+str(cup2)+".")
else:
print("Unrecoverable configuration.")
| Title: Help Chef Gerasim
Time Limit: 0 seconds
Memory Limit: 256 megabytes
Problem Description:
In a far away kingdom young pages help to set the table for the King. As they are terribly mischievous, one needs to keep an eye on the control whether they have set everything correctly. This time the royal chef Gerasim had the impression that the pages have played a prank again: they had poured the juice from one cup to another. Now Gerasim wants to check his hypothesis. The good thing is that chef Gerasim always pour the same number of milliliters of juice to all cups in the royal kitchen. Having thoroughly measured the juice in each cup, Gerasim asked you to write a program that will determine from which cup juice was poured to which one; otherwise, the program should determine that this time the pages set the table diligently.
To simplify your task we shall consider the cups to be bottomless so that the juice never overfills a cup and pours out, however much it can be. Besides, by some strange reason in a far away kingdom one can only pour to a cup or from one cup to another an integer number of milliliters of juice.
Input Specification:
The first line contains integer *n* — the number of cups on the royal table (1<=≤<=*n*<=≤<=1000). Next *n* lines contain volumes of juice in each cup — non-negative integers, not exceeding 104.
Output Specification:
If the pages didn't pour the juice, print "Exemplary pages." (without the quotes). If you can determine the volume of juice poured during exactly one juice pouring, print "*v* ml. from cup #*a* to cup #*b*." (without the quotes), where *v* represents the volume of poured juice, *a* represents the number of the cup from which the juice was poured (the cups are numbered with consecutive positive integers starting from one in the order in which the cups are described in the input data), *b* represents the number of the cup into which the juice was poured. Finally, if the given juice's volumes cannot be obtained using no more than one pouring (for example, the pages poured the juice from one cup to another more than once or the royal kitchen maids poured the juice into the cups incorrectly), print "Unrecoverable configuration." (without the quotes).
Demo Input:
['5\n270\n250\n250\n230\n250\n', '5\n250\n250\n250\n250\n250\n', '5\n270\n250\n249\n230\n250\n']
Demo Output:
['20 ml. from cup #4 to cup #1.\n', 'Exemplary pages.\n', 'Unrecoverable configuration.\n']
Note:
none | ```python
s.add(drink)
if(len(s)>3):
print("Unrecoverable configuration.")
elif(len(s)==1):
print("Exemplary pages.")
elif(len(s)==2):
if(len(L)==2):
if(L[0]+L[1])%2==0:
cup1=1
cup2=2
if(L[0]>L[1]):
cup1=2
cup2=1
print(abs(L[1]-L[0])//2,"ml. from cup #"+str(cup1)+" to cup #"+str(cup2)+".")
else:
print("Unrecoverable configuration.")
else:
mini=min(L)
maxi=max(L)
countmin=0
countmax=0
cup1=0
cup2=0
for i in range(n):
if(L[i]==mini):
countmin+=1
if(L[i]==maxi):
countmax+=1
if(countmin==1 and countmax==1):
for i in range(n):
if(L[i]==mini):
cup1=i+1
if(L[i]==maxi):
cup2=i+1
print(abs(mini-maxi)//2,"ml. from cup #"+str(cup1)+" to cup #"+str(cup2)+".")
else:
print("Unrecoverable configuration.")
``` | -1 |
493 | B | Vasya and Wrestling | PROGRAMMING | 1,400 | [
"implementation"
]
| null | null | Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won. | The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order. | If the first wrestler wins, print string "first", otherwise print "second" | [
"5\n1\n2\n-3\n-4\n3\n",
"3\n-1\n-2\n3\n",
"2\n4\n-4\n"
]
| [
"second\n",
"first\n",
"second\n"
]
| Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*. | 1,000 | [
{
"input": "5\n1\n2\n-3\n-4\n3",
"output": "second"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "2\n4\n-4",
"output": "second"
},
{
"input": "7\n1\n2\n-3\n4\n5\n-6\n7",
"output": "first"
},
{
"input": "14\n1\n2\n3\n4\n5\n6\n7\n-8\n-9\n-10\n-11\n-12\n-13\n-14",
"output": "second"
},
{
"input": "4\n16\n12\n19\n-98",
"output": "second"
},
{
"input": "5\n-6\n-1\n-1\n5\n3",
"output": "second"
},
{
"input": "11\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1",
"output": "first"
},
{
"input": "1\n-534365",
"output": "second"
},
{
"input": "1\n10253033",
"output": "first"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "8\n1\n-2\n-3\n4\n5\n-6\n-7\n8",
"output": "second"
},
{
"input": "2\n1\n-1",
"output": "second"
},
{
"input": "5\n1\n2\n3\n4\n5",
"output": "first"
},
{
"input": "5\n-1\n-2\n-3\n-4\n-5",
"output": "second"
},
{
"input": "10\n-1\n-2\n-3\n-4\n-5\n5\n4\n3\n2\n1",
"output": "first"
},
{
"input": "131\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n-1\n-1\n2",
"output": "first"
},
{
"input": "6\n-1\n-2\n-3\n1\n2\n3",
"output": "first"
},
{
"input": "3\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "12\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-1000000000",
"output": "first"
},
{
"input": "20\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "5\n1000000000\n1000000000\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "4\n1\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "5\n1000000000\n1000000000\n1000000000\n-1000000000\n-1000000000",
"output": "first"
},
{
"input": "4\n-1\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "11\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "2\n-4\n4",
"output": "first"
},
{
"input": "3\n-12\n3\n9",
"output": "second"
},
{
"input": "3\n9\n1\n-10",
"output": "second"
},
{
"input": "3\n1\n2\n-3",
"output": "second"
},
{
"input": "4\n55\n5\n-5\n-55",
"output": "first"
},
{
"input": "4\n5\n-1\n1\n-5",
"output": "first"
},
{
"input": "2\n-5\n6",
"output": "first"
},
{
"input": "4\n5\n-4\n3\n-40",
"output": "second"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-5",
"output": "first"
},
{
"input": "6\n3\n2\n1\n-3\n-1\n-2",
"output": "first"
},
{
"input": "5\n4\n1\n1\n-3\n-3",
"output": "first"
},
{
"input": "5\n208\n-52\n-52\n-52\n-52",
"output": "first"
},
{
"input": "3\n-100\n-200\n300",
"output": "first"
},
{
"input": "3\n400\n-200\n-200",
"output": "first"
},
{
"input": "3\n208\n-207\n-1",
"output": "first"
},
{
"input": "3\n98888887\n98888888\n-197777775",
"output": "second"
}
]
| 1,626,409,841 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 62 | 6,758,400 | n=int(input())
b=[]
for i in range(n):
a=list(int(input()))
b.append(a)
if (sum(k)(k>0)>=sum(k)(k<0) for k in b):
print("second")
else:
print("first") | Title: Vasya and Wrestling
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
Input Specification:
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
Output Specification:
If the first wrestler wins, print string "first", otherwise print "second"
Demo Input:
['5\n1\n2\n-3\n-4\n3\n', '3\n-1\n-2\n3\n', '2\n4\n-4\n']
Demo Output:
['second\n', 'first\n', 'second\n']
Note:
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*. | ```python
n=int(input())
b=[]
for i in range(n):
a=list(int(input()))
b.append(a)
if (sum(k)(k>0)>=sum(k)(k<0) for k in b):
print("second")
else:
print("first")
``` | -1 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
]
| A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
]
| [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
]
| none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
]
| 1,662,325,516 | 2,147,483,647 | Python 3 | OK | TESTS | 102 | 46 | 0 | x=input()
y=input()
out=''
for n in range(len(x)):
if x[n]==y[n]:
out+='0'
else:
out+='1'
print(out)
| Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
x=input()
y=input()
out=''
for n in range(len(x)):
if x[n]==y[n]:
out+='0'
else:
out+='1'
print(out)
``` | 3.9885 |
758 | A | Holiday Of Equality | PROGRAMMING | 800 | [
"implementation",
"math"
]
| null | null | In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury.
Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland).
You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them. | The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen. | In the only line print the integer *S* — the minimum number of burles which are had to spend. | [
"5\n0 1 2 3 4\n",
"5\n1 1 0 1 1\n",
"3\n1 3 1\n",
"1\n12\n"
]
| [
"10",
"1",
"4",
"0"
]
| In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4.
In the second example it is enough to give one burle to the third citizen.
In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3.
In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles. | 500 | [
{
"input": "5\n0 1 2 3 4",
"output": "10"
},
{
"input": "5\n1 1 0 1 1",
"output": "1"
},
{
"input": "3\n1 3 1",
"output": "4"
},
{
"input": "1\n12",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "14\n52518 718438 358883 462189 853171 592966 225788 46977 814826 295697 676256 561479 56545 764281",
"output": "5464380"
},
{
"input": "21\n842556 216391 427181 626688 775504 168309 851038 448402 880826 73697 593338 519033 135115 20128 424606 939484 846242 756907 377058 241543 29353",
"output": "9535765"
},
{
"input": "3\n1 3 2",
"output": "3"
},
{
"input": "3\n2 1 3",
"output": "3"
},
{
"input": "3\n2 3 1",
"output": "3"
},
{
"input": "3\n3 1 2",
"output": "3"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n228503",
"output": "0"
},
{
"input": "2\n32576 550340",
"output": "517764"
},
{
"input": "3\n910648 542843 537125",
"output": "741328"
},
{
"input": "4\n751720 572344 569387 893618",
"output": "787403"
},
{
"input": "6\n433864 631347 597596 794426 713555 231193",
"output": "1364575"
},
{
"input": "9\n31078 645168 695751 126111 375934 150495 838412 434477 993107",
"output": "4647430"
},
{
"input": "30\n315421 772664 560686 654312 151528 356749 351486 707462 820089 226682 546700 136028 824236 842130 578079 337807 665903 764100 617900 822937 992759 591749 651310 742085 767695 695442 17967 515106 81059 186025",
"output": "13488674"
},
{
"input": "45\n908719 394261 815134 419990 926993 383792 772842 277695 527137 655356 684956 695716 273062 550324 106247 399133 442382 33076 462920 294674 846052 817752 421365 474141 290471 358990 109812 74492 543281 169434 919692 786809 24028 197184 310029 801476 699355 429672 51343 374128 776726 850380 293868 981569 550763",
"output": "21993384"
},
{
"input": "56\n100728 972537 13846 385421 756708 184642 259487 319707 376662 221694 675284 972837 499419 13846 38267 289898 901299 831197 954715 197515 514102 910423 127555 883934 362472 870788 538802 741008 973434 448124 391526 363321 947321 544618 68006 782313 955075 741981 815027 723297 585059 718114 700739 413489 454091 736144 308999 98065 3716 347323 9635 289003 986510 607065 60236 273351",
"output": "26984185"
},
{
"input": "70\n644488 5444 150441 714420 602059 335330 510670 196555 546346 740011 509449 850947 692874 524857 750434 952985 223744 374727 896124 753037 367352 679050 560202 172728 569291 778616 332116 286927 843598 372698 244906 498046 900681 709791 420904 724593 864493 813094 791377 39998 296710 625656 403891 579231 706693 984045 16901 574259 562265 761104 930361 256045 124461 538980 573508 372148 988722 108592 784354 55302 232524 277205 782251 299943 436488 743389 324618 742543 266915 99642",
"output": "32816391"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1000000",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "99000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000",
"output": "99000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1000000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "99000000"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "3\n5 0 0",
"output": "10"
},
{
"input": "5\n2 10 0 0 0",
"output": "38"
}
]
| 1,684,783,229 | 2,147,483,647 | Python 3 | OK | TESTS | 41 | 46 | 0 | n=int(input())
a=list(map(int,input().split()))
q=0
for a1 in a:
if a1<max(a):
q+=max(a)-a1
print(q) | Title: Holiday Of Equality
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland it is the holiday of equality. In honor of the holiday the king decided to equalize the welfare of all citizens in Berland by the expense of the state treasury.
Totally in Berland there are *n* citizens, the welfare of each of them is estimated as the integer in *a**i* burles (burle is the currency in Berland).
You are the royal treasurer, which needs to count the minimum charges of the kingdom on the king's present. The king can only give money, he hasn't a power to take away them.
Input Specification:
The first line contains the integer *n* (1<=≤<=*n*<=≤<=100) — the number of citizens in the kingdom.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (0<=≤<=*a**i*<=≤<=106) — the welfare of the *i*-th citizen.
Output Specification:
In the only line print the integer *S* — the minimum number of burles which are had to spend.
Demo Input:
['5\n0 1 2 3 4\n', '5\n1 1 0 1 1\n', '3\n1 3 1\n', '1\n12\n']
Demo Output:
['10', '1', '4', '0']
Note:
In the first example if we add to the first citizen 4 burles, to the second 3, to the third 2 and to the fourth 1, then the welfare of all citizens will equal 4.
In the second example it is enough to give one burle to the third citizen.
In the third example it is necessary to give two burles to the first and the third citizens to make the welfare of citizens equal 3.
In the fourth example it is possible to give nothing to everyone because all citizens have 12 burles. | ```python
n=int(input())
a=list(map(int,input().split()))
q=0
for a1 in a:
if a1<max(a):
q+=max(a)-a1
print(q)
``` | 3 |
|
129 | A | Cookies | PROGRAMMING | 900 | [
"implementation"
]
| null | null | Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even? | The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag. | Print in the only line the only number — the sought number of ways. If there are no such ways print 0. | [
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
]
| [
"1\n",
"8\n",
"1\n"
]
| In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies. | 500 | [
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
]
| 1,643,705,146 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | n=int(input())
arr=list(map(int,input().strip().split()))[:n]
ans=0
x=sum(arr)
for i in arr:
if (x-i)&1==0:
ans+=1 | Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies. | ```python
n=int(input())
arr=list(map(int,input().strip().split()))[:n]
ans=0
x=sum(arr)
for i in arr:
if (x-i)&1==0:
ans+=1
``` | 0 |
|
144 | A | Arrival of the General | PROGRAMMING | 800 | [
"implementation"
]
| null | null | A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct. | The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different. | Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like. | [
"4\n33 44 11 22\n",
"7\n10 10 58 31 63 40 76\n"
]
| [
"2\n",
"10\n"
]
| In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10) | 500 | [
{
"input": "4\n33 44 11 22",
"output": "2"
},
{
"input": "7\n10 10 58 31 63 40 76",
"output": "10"
},
{
"input": "2\n88 89",
"output": "1"
},
{
"input": "5\n100 95 100 100 88",
"output": "0"
},
{
"input": "7\n48 48 48 48 45 45 45",
"output": "0"
},
{
"input": "10\n68 47 67 29 63 71 71 65 54 56",
"output": "10"
},
{
"input": "15\n77 68 96 60 92 75 61 60 66 79 80 65 60 95 92",
"output": "4"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "20\n30 30 30 14 30 14 30 30 30 14 30 14 14 30 14 14 30 14 14 14",
"output": "0"
},
{
"input": "35\n37 41 46 39 47 39 44 47 44 42 44 43 47 39 46 39 38 42 39 37 40 44 41 42 41 42 39 42 36 36 42 36 42 42 42",
"output": "7"
},
{
"input": "40\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 98 99 99 99 99 99 99 99 99 100 99 99 99 99 99 99",
"output": "47"
},
{
"input": "50\n48 52 44 54 53 56 62 49 39 41 53 39 40 64 53 50 62 48 40 52 51 48 40 52 61 62 62 61 48 64 55 57 56 40 48 58 41 60 60 56 64 50 64 45 48 45 46 63 59 57",
"output": "50"
},
{
"input": "57\n7 24 17 19 6 19 10 11 12 22 14 5 5 11 13 10 24 19 24 24 24 11 21 20 4 14 24 24 18 13 24 3 20 3 3 3 3 9 3 9 22 22 16 3 3 3 15 11 3 3 8 17 10 13 3 14 13",
"output": "3"
},
{
"input": "65\n58 50 35 44 35 37 36 58 38 36 58 56 56 49 48 56 58 43 40 44 52 44 58 58 57 50 43 35 55 39 38 49 53 56 50 42 41 56 34 57 49 38 34 51 56 38 58 40 53 46 48 34 38 43 49 49 58 56 41 43 44 34 38 48 36",
"output": "3"
},
{
"input": "69\n70 48 49 48 49 71 48 53 55 69 48 53 54 58 53 63 48 48 69 67 72 75 71 75 74 74 57 63 65 60 48 48 65 48 48 51 50 49 62 53 76 68 76 56 76 76 64 76 76 57 61 76 73 51 59 76 65 50 69 50 76 67 76 63 62 74 74 58 73",
"output": "73"
},
{
"input": "75\n70 65 64 71 71 64 71 64 68 71 65 64 65 68 71 66 66 69 68 63 69 65 71 69 68 68 71 67 71 65 65 65 71 71 65 69 63 66 62 67 64 63 62 64 67 65 62 69 62 64 69 62 67 64 67 70 64 63 64 64 69 62 62 64 70 62 62 68 67 69 62 64 66 70 68",
"output": "7"
},
{
"input": "84\n92 95 84 85 94 80 90 86 80 92 95 84 86 83 86 83 93 91 95 92 84 88 82 84 84 84 80 94 93 80 94 80 95 83 85 80 95 95 80 84 86 92 83 81 90 87 81 89 92 93 80 87 90 85 93 85 93 94 93 89 94 83 93 91 80 83 90 94 95 80 95 92 85 84 93 94 94 82 91 95 95 89 85 94",
"output": "15"
},
{
"input": "90\n86 87 72 77 82 71 75 78 61 67 79 90 64 94 94 74 85 87 73 76 71 71 60 69 77 73 76 80 82 57 62 57 57 83 76 72 75 87 72 94 77 85 59 82 86 69 62 80 95 73 83 94 79 85 91 68 85 74 93 95 68 75 89 93 83 78 95 78 83 77 81 85 66 92 63 65 75 78 67 91 77 74 59 86 77 76 90 67 70 64",
"output": "104"
},
{
"input": "91\n94 98 96 94 95 98 98 95 98 94 94 98 95 95 99 97 97 94 95 98 94 98 96 98 96 98 97 95 94 94 94 97 94 96 98 98 98 94 96 95 94 95 97 97 97 98 94 98 96 95 98 96 96 98 94 97 96 98 97 95 97 98 94 95 94 94 97 94 96 97 97 93 94 95 95 94 96 98 97 96 94 98 98 96 96 96 96 96 94 96 97",
"output": "33"
},
{
"input": "92\n44 28 32 29 41 41 36 39 40 39 41 35 41 28 35 27 41 34 28 38 43 43 41 38 27 26 28 36 30 29 39 32 35 35 32 30 39 30 37 27 41 41 28 30 43 31 35 33 36 28 44 40 41 35 31 42 37 38 37 34 39 40 27 40 33 33 44 43 34 33 34 34 35 38 38 37 30 39 35 41 45 42 41 32 33 33 31 30 43 41 43 43",
"output": "145"
},
{
"input": "93\n46 32 52 36 39 30 57 63 63 30 32 44 27 59 46 38 40 45 44 62 35 36 51 48 39 58 36 51 51 51 48 58 59 36 29 35 31 49 64 60 34 38 42 56 33 42 52 31 63 34 45 51 35 45 33 53 33 62 31 38 66 29 51 54 28 61 32 45 57 41 36 34 47 36 31 28 67 48 52 46 32 40 64 58 27 53 43 57 34 66 43 39 26",
"output": "76"
},
{
"input": "94\n56 55 54 31 32 42 46 29 24 54 40 40 20 45 35 56 32 33 51 39 26 56 21 56 51 27 29 39 56 52 54 43 43 55 48 51 44 49 52 49 23 19 19 28 20 26 45 33 35 51 42 36 25 25 38 23 21 35 54 50 41 20 37 28 42 20 22 43 37 34 55 21 24 38 19 41 45 34 19 33 44 54 38 31 23 53 35 32 47 40 39 31 20 34",
"output": "15"
},
{
"input": "95\n57 71 70 77 64 64 76 81 81 58 63 75 81 77 71 71 71 60 70 70 69 67 62 64 78 64 69 62 76 76 57 70 68 77 70 68 73 77 79 73 60 57 69 60 74 65 58 75 75 74 73 73 65 75 72 57 81 62 62 70 67 58 76 57 79 81 68 64 58 77 70 59 79 64 80 58 71 59 81 71 80 64 78 80 78 65 70 68 78 80 57 63 64 76 81",
"output": "11"
},
{
"input": "96\n96 95 95 95 96 97 95 97 96 95 98 96 97 95 98 96 98 96 98 96 98 95 96 95 95 95 97 97 95 95 98 98 95 96 96 95 97 96 98 96 95 97 97 95 97 97 95 94 96 96 97 96 97 97 96 94 94 97 95 95 95 96 95 96 95 97 97 95 97 96 95 94 97 97 97 96 97 95 96 94 94 95 97 94 94 97 97 97 95 97 97 95 94 96 95 95",
"output": "13"
},
{
"input": "97\n14 15 12 12 13 15 12 15 12 12 12 12 12 14 15 15 13 12 15 15 12 12 12 13 14 15 15 13 14 15 14 14 14 14 12 13 12 13 13 12 15 12 13 13 15 12 15 13 12 13 13 13 14 13 12 15 14 13 14 15 13 14 14 13 14 12 15 12 14 12 13 14 15 14 13 15 13 12 15 15 15 13 15 15 13 14 16 16 16 13 15 13 15 14 15 15 15",
"output": "104"
},
{
"input": "98\n37 69 35 70 58 69 36 47 41 63 60 54 49 35 55 50 35 53 52 43 35 41 40 49 38 35 48 70 42 35 35 65 56 54 44 59 59 48 51 49 59 67 35 60 69 35 58 50 35 44 48 69 41 58 44 45 35 47 70 61 49 47 37 39 35 51 44 70 72 65 36 41 63 63 48 66 45 50 50 71 37 52 72 67 72 39 72 39 36 64 48 72 69 49 45 72 72 67",
"output": "100"
},
{
"input": "99\n31 31 16 15 19 31 19 22 29 27 12 22 28 30 25 33 26 25 19 22 34 21 17 33 31 22 16 26 22 30 31 17 13 33 13 17 28 25 18 33 27 22 31 22 13 27 20 22 23 15 24 32 29 13 16 20 32 33 14 33 19 27 16 28 25 17 17 28 18 26 32 33 19 23 30 13 14 23 24 28 14 28 22 20 30 14 24 23 17 29 18 28 29 21 28 18 16 24 32",
"output": "107"
},
{
"input": "100\n37 54 39 29 32 49 21 13 34 21 16 42 34 27 16 26 7 34 51 9 11 27 16 40 36 7 48 52 30 42 42 52 51 11 32 26 6 7 28 54 48 51 6 54 42 20 51 48 46 4 4 31 47 6 9 16 8 23 36 50 49 30 47 37 45 24 48 26 8 50 18 24 27 13 39 7 37 34 5 43 42 19 34 23 52 38 35 6 29 11 53 49 21 29 36 22 45 33 51 22",
"output": "50"
},
{
"input": "100\n41 5 20 23 5 47 28 28 64 5 12 14 34 56 22 48 6 52 39 55 62 40 24 54 39 28 56 27 35 51 14 24 38 10 55 20 39 62 52 2 30 55 49 48 15 23 59 44 31 28 66 29 62 59 31 13 28 12 50 45 41 47 29 27 64 66 14 39 62 22 44 63 24 5 63 17 42 7 25 41 49 33 31 51 63 3 37 66 19 9 2 40 16 45 56 21 34 29 39 61",
"output": "59"
},
{
"input": "100\n66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95",
"output": "99"
},
{
"input": "100\n81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "2\n100 99",
"output": "0"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "197"
},
{
"input": "100\n87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87",
"output": "0"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 3 2",
"output": "2"
}
]
| 1,688,111,497 | 2,147,483,647 | Python 3 | OK | TESTS | 39 | 92 | 0 | t=int(input())
n=[int(i) for i in input().split()]
ma=max(n)
mi=min(n)
ima=0
imi=0
z=0
for i in range(t):
if ma==n[i] and z==0:
z+=1
ima=i+1
if mi==n[i]:
imi=i+1
if ima>imi:
print(abs(ima-1)+abs(imi-t)-1)
else:
print(abs(ima-1)+abs(imi-t)) | Title: Arrival of the General
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
Input Specification:
The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
Output Specification:
Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like.
Demo Input:
['4\n33 44 11 22\n', '7\n10 10 58 31 63 40 76\n']
Demo Output:
['2\n', '10\n']
Note:
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10) | ```python
t=int(input())
n=[int(i) for i in input().split()]
ma=max(n)
mi=min(n)
ima=0
imi=0
z=0
for i in range(t):
if ma==n[i] and z==0:
z+=1
ima=i+1
if mi==n[i]:
imi=i+1
if ima>imi:
print(abs(ima-1)+abs(imi-t)-1)
else:
print(abs(ima-1)+abs(imi-t))
``` | 3 |
|
262 | A | Roma and Lucky Numbers | PROGRAMMING | 800 | [
"implementation"
]
| null | null | Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers.
Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem. | The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has.
The numbers in the lines are separated by single spaces. | In a single line print a single integer — the answer to the problem. | [
"3 4\n1 2 4\n",
"3 2\n447 44 77\n"
]
| [
"3\n",
"2\n"
]
| In the first sample all numbers contain at most four lucky digits, so the answer is 3.
In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2. | 500 | [
{
"input": "3 4\n1 2 4",
"output": "3"
},
{
"input": "3 2\n447 44 77",
"output": "2"
},
{
"input": "2 2\n507978501 180480073",
"output": "2"
},
{
"input": "9 6\n655243746 167613748 1470546 57644035 176077477 56984809 44677 215706823 369042089",
"output": "9"
},
{
"input": "6 100\n170427799 37215529 675016434 168544291 683447134 950090227",
"output": "6"
},
{
"input": "4 2\n194041605 706221269 69909135 257655784",
"output": "3"
},
{
"input": "4 2\n9581849 67346651 530497 272158241",
"output": "4"
},
{
"input": "3 47\n378261451 163985731 230342101",
"output": "3"
},
{
"input": "2 3\n247776868 480572137",
"output": "1"
},
{
"input": "7 77\n366496749 549646417 278840199 119255907 33557677 379268590 150378796",
"output": "7"
},
{
"input": "40 31\n32230963 709031779 144328646 513494529 36547831 416998222 84161665 318773941 170724397 553666286 368402971 48581613 31452501 368026285 47903381 939151438 204145360 189920160 288159400 133145006 314295423 450219949 160203213 358403181 478734385 29331901 31051111 110710191 567314089 139695685 111511396 87708701 317333277 103301481 110400517 634446253 481551313 39202255 105948 738066085",
"output": "40"
},
{
"input": "1 8\n55521105",
"output": "1"
},
{
"input": "49 3\n34644511 150953622 136135827 144208961 359490601 86708232 719413689 188605873 64330753 488776302 104482891 63360106 437791390 46521319 70778345 339141601 136198441 292941209 299339510 582531183 555958105 437904637 74219097 439816011 236010407 122674666 438442529 186501223 63932449 407678041 596993853 92223251 849265278 480265849 30983497 330283357 186901672 20271344 794252593 123774176 27851201 52717531 479907210 196833889 149331196 82147847 255966471 278600081 899317843",
"output": "44"
},
{
"input": "26 2\n330381357 185218042 850474297 483015466 296129476 1205865 538807493 103205601 160403321 694220263 416255901 7245756 507755361 88187633 91426751 1917161 58276681 59540376 576539745 595950717 390256887 105690055 607818885 28976353 488947089 50643601",
"output": "22"
},
{
"input": "38 1\n194481717 126247087 815196361 106258801 381703249 283859137 15290101 40086151 213688513 577996947 513899717 371428417 107799271 11136651 5615081 323386401 381128815 34217126 17709913 520702093 201694245 570931849 169037023 417019726 282437316 7417126 271667553 11375851 185087449 410130883 383045677 5764771 905017051 328584026 215330671 299553233 15838255 234532105",
"output": "20"
},
{
"input": "44 9\n683216389 250581469 130029957 467020047 188395565 206237982 63257361 68314981 732878407 563579660 199133851 53045209 665723851 16273169 10806790 556633156 350593410 474645249 478790761 708234243 71841230 18090541 19836685 146373571 17947452 534010506 46933264 377035021 311636557 75193963 54321761 12759959 71120181 548816939 23608621 31876417 107672995 72575155 369667956 20574379 210596751 532163173 75726739 853719629",
"output": "44"
},
{
"input": "8 6\n204157376 10514197 65483881 347219841 263304577 296402721 11739011 229776191",
"output": "8"
},
{
"input": "38 29\n333702889 680931737 61137217 203030505 68728281 11414209 642645708 590904616 3042901 607198177 189041074 700764043 813035201 198341461 126403544 401436841 420826465 45046581 20249976 46978855 46397957 706610773 24701041 57954481 51603266 593109701 385569073 178982291 582152863 287317968 1474090 34825141 432421977 130257781 151516903 540852403 548392 117246529",
"output": "38"
},
{
"input": "19 3\n562569697 549131571 50676718 84501863 74567295 702372009 365895280 451459937 40378543 167666701 158635641 53639293 442332661 825055617 100109161 326616021 862332843 533271196 4791547",
"output": "18"
},
{
"input": "1 1\n44",
"output": "0"
},
{
"input": "1 1\n4",
"output": "1"
},
{
"input": "10 3\n444 447 774 777 7777 4447 4 7 7 4",
"output": "8"
}
]
| 1,599,366,037 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 218 | 0 | n, k = map(int, input().split())
nums = list(input().split())
count = 0
for i in range(n):
if nums[i].count("4")+nums[i].count("7") <= k:
count += 1
print(count) | Title: Roma and Lucky Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers.
Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem.
Input Specification:
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has.
The numbers in the lines are separated by single spaces.
Output Specification:
In a single line print a single integer — the answer to the problem.
Demo Input:
['3 4\n1 2 4\n', '3 2\n447 44 77\n']
Demo Output:
['3\n', '2\n']
Note:
In the first sample all numbers contain at most four lucky digits, so the answer is 3.
In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2. | ```python
n, k = map(int, input().split())
nums = list(input().split())
count = 0
for i in range(n):
if nums[i].count("4")+nums[i].count("7") <= k:
count += 1
print(count)
``` | 3 |
|
637 | B | Chat Order | PROGRAMMING | 1,200 | [
"*special",
"binary search",
"constructive algorithms",
"data structures",
"sortings"
]
| null | null | Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus. | The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10. | Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom. | [
"4\nalex\nivan\nroman\nivan\n",
"8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n"
]
| [
"ivan\nroman\nalex\n",
"alina\nmaria\nekaterina\ndarya\n"
]
| In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex | 1,000 | [
{
"input": "4\nalex\nivan\nroman\nivan",
"output": "ivan\nroman\nalex"
},
{
"input": "8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina",
"output": "alina\nmaria\nekaterina\ndarya"
},
{
"input": "1\nwdi",
"output": "wdi"
},
{
"input": "2\nypg\nypg",
"output": "ypg"
},
{
"input": "3\nexhll\nexhll\narruapexj",
"output": "arruapexj\nexhll"
},
{
"input": "3\nfv\nle\nle",
"output": "le\nfv"
},
{
"input": "8\nm\nm\nm\nm\nm\nm\nm\nm",
"output": "m"
},
{
"input": "10\nr\nr\ni\nw\nk\nr\nb\nu\nu\nr",
"output": "r\nu\nb\nk\nw\ni"
},
{
"input": "7\ne\nfau\ncmk\nnzs\nby\nwx\ntjmok",
"output": "tjmok\nwx\nby\nnzs\ncmk\nfau\ne"
},
{
"input": "6\nklrj\nwe\nklrj\nwe\nwe\nwe",
"output": "we\nklrj"
},
{
"input": "8\nzncybqmh\naeebef\nzncybqmh\nn\naeebef\nzncybqmh\nzncybqmh\nzncybqmh",
"output": "zncybqmh\naeebef\nn"
},
{
"input": "30\nkqqcbs\nvap\nkymomn\nj\nkqqcbs\nfuzlzoum\nkymomn\ndbh\nfuzlzoum\nkymomn\nvap\nvlgzs\ndbh\nvlgzs\nbvy\ndbh\nkymomn\nkymomn\neoqql\nkymomn\nkymomn\nkqqcbs\nvlgzs\nkqqcbs\nkqqcbs\nfuzlzoum\nvlgzs\nrylgdoo\nvlgzs\nrylgdoo",
"output": "rylgdoo\nvlgzs\nfuzlzoum\nkqqcbs\nkymomn\neoqql\ndbh\nbvy\nvap\nj"
},
{
"input": "40\nji\nv\nv\nns\nji\nn\nji\nv\nfvy\nvje\nns\nvje\nv\nhas\nv\nusm\nhas\nfvy\nvje\nkdb\nn\nv\nji\nji\nn\nhas\nv\nji\nkdb\nr\nvje\nns\nv\nusm\nn\nvje\nhas\nns\nhas\nn",
"output": "n\nhas\nns\nvje\nusm\nv\nr\nkdb\nji\nfvy"
},
{
"input": "50\njcg\nvle\njopb\nepdb\nnkef\nfv\nxj\nufe\nfuy\noqta\ngbc\nyuz\nec\nyji\nkuux\ncwm\ntq\nnno\nhp\nzry\nxxpp\ntjvo\ngyz\nkwo\nvwqz\nyaqc\njnj\nwoav\nqcv\ndcu\ngc\nhovn\nop\nevy\ndc\ntrpu\nyb\nuzfa\npca\noq\nnhxy\nsiqu\nde\nhphy\nc\nwovu\nf\nbvv\ndsik\nlwyg",
"output": "lwyg\ndsik\nbvv\nf\nwovu\nc\nhphy\nde\nsiqu\nnhxy\noq\npca\nuzfa\nyb\ntrpu\ndc\nevy\nop\nhovn\ngc\ndcu\nqcv\nwoav\njnj\nyaqc\nvwqz\nkwo\ngyz\ntjvo\nxxpp\nzry\nhp\nnno\ntq\ncwm\nkuux\nyji\nec\nyuz\ngbc\noqta\nfuy\nufe\nxj\nfv\nnkef\nepdb\njopb\nvle\njcg"
},
{
"input": "100\nvhh\nvhh\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh",
"output": "vhh\nfa"
},
{
"input": "2\naa\nbb",
"output": "bb\naa"
},
{
"input": "2\naa\na",
"output": "a\naa"
},
{
"input": "3\naa\naa\naa",
"output": "aa"
},
{
"input": "5\naa\na\naa\na\naa",
"output": "aa\na"
},
{
"input": "7\naaaa\naaaa\naaa\na\naa\naaaaaaa\naaa",
"output": "aaa\naaaaaaa\naa\na\naaaa"
},
{
"input": "5\na\naa\naaa\naaaa\na",
"output": "a\naaaa\naaa\naa"
},
{
"input": "12\naaaaa\naaaaaa\naaaa\naaaaaa\naa\naaaa\naaaa\naaaaaa\na\naaa\naaaaaaaa\naa",
"output": "aa\naaaaaaaa\naaa\na\naaaaaa\naaaa\naaaaa"
},
{
"input": "3\na\naa\naaa",
"output": "aaa\naa\na"
},
{
"input": "9\nzzz\nzzzzz\nzzz\nzzzz\nzz\nzzzz\nzzzzz\nzzzz\nzzzzzzz",
"output": "zzzzzzz\nzzzz\nzzzzz\nzz\nzzz"
}
]
| 1,598,729,114 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 10 | 109 | 0 | n = int(input())
names = [input() for name in range(n)]
result = ""
for name in names[::-1]:
if name not in result:
result += name + "\n"
print(result[:len(result)-1])
| Title: Chat Order
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
Output Specification:
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
Demo Input:
['4\nalex\nivan\nroman\nivan\n', '8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n']
Demo Output:
['ivan\nroman\nalex\n', 'alina\nmaria\nekaterina\ndarya\n']
Note:
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex | ```python
n = int(input())
names = [input() for name in range(n)]
result = ""
for name in names[::-1]:
if name not in result:
result += name + "\n"
print(result[:len(result)-1])
``` | 0 |
|
282 | A | Bit++ | PROGRAMMING | 800 | [
"implementation"
]
| null | null | The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed). | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order. | Print a single integer — the final value of *x*. | [
"1\n++X\n",
"2\nX++\n--X\n"
]
| [
"1\n",
"0\n"
]
| none | 500 | [
{
"input": "1\n++X",
"output": "1"
},
{
"input": "2\nX++\n--X",
"output": "0"
},
{
"input": "3\n++X\n++X\n++X",
"output": "3"
},
{
"input": "2\n--X\n--X",
"output": "-2"
},
{
"input": "5\n++X\n--X\n++X\n--X\n--X",
"output": "-1"
},
{
"input": "28\nX--\n++X\nX++\nX++\nX++\n--X\n--X\nX++\nX--\n++X\nX++\n--X\nX--\nX++\nX--\n++X\n++X\nX++\nX++\nX++\nX++\n--X\n++X\n--X\n--X\n--X\n--X\nX++",
"output": "4"
},
{
"input": "94\nX++\nX++\n++X\n++X\nX--\n--X\nX++\n--X\nX++\n++X\nX++\n++X\n--X\n--X\n++X\nX++\n--X\nX--\nX--\n--X\nX--\nX--\n--X\n++X\n--X\nX--\nX--\nX++\n++X\n--X\nX--\n++X\n--X\n--X\nX--\nX--\nX++\nX++\nX--\nX++\nX--\nX--\nX--\n--X\nX--\nX--\nX--\nX++\n++X\nX--\n++X\nX++\n--X\n--X\n--X\n--X\n++X\nX--\n--X\n--X\n++X\nX--\nX--\nX++\n++X\nX++\n++X\n--X\n--X\nX--\n++X\nX--\nX--\n++X\n++X\n++X\n++X\nX++\n++X\n--X\nX++\n--X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\nX--\nX--\n--X\n++X\nX++",
"output": "-10"
},
{
"input": "56\n--X\nX--\n--X\n--X\nX--\nX--\n--X\nX++\n++X\n--X\nX++\nX--\n--X\n++X\n--X\nX--\nX--\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\n++X\nX++\nX++\n--X\nX++\nX--\n--X\nX--\n--X\nX++\n++X\n--X\n++X\nX++\nX--\n--X\n--X\n++X\nX--\nX--\n--X\nX--\n--X\nX++\n--X\n++X\n--X",
"output": "-14"
},
{
"input": "59\nX--\n--X\nX++\n++X\nX--\n--X\n--X\n++X\n++X\n++X\n++X\nX++\n++X\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX++\n--X\n++X\nX++\n--X\n--X\nX++\nX++\n--X\nX++\nX++\nX++\nX--\nX--\n--X\nX++\nX--\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\nX--\n++X\n--X\nX++\nX++\nX--\nX++\n++X\nX--\nX++\nX--\nX--\n++X",
"output": "3"
},
{
"input": "87\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\nX--\n++X\n--X\n--X\nX++\n--X\nX--\nX++\n++X\n--X\n++X\n++X\n--X\n++X\n--X\nX--\n++X\n++X\nX--\nX++\nX++\n--X\n--X\n++X\nX--\n--X\n++X\n--X\nX++\n--X\n--X\nX--\n++X\n++X\n--X\nX--\nX--\nX--\nX--\nX--\nX++\n--X\n++X\n--X\nX++\n++X\nX++\n++X\n--X\nX++\n++X\nX--\n--X\nX++\n++X\nX++\nX++\n--X\n--X\n++X\n--X\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX--\n--X\n++X\n++X",
"output": "-5"
},
{
"input": "101\nX++\nX++\nX++\n++X\n--X\nX--\nX++\nX--\nX--\n--X\n--X\n++X\nX++\n++X\n++X\nX--\n--X\n++X\nX++\nX--\n++X\n--X\n--X\n--X\n++X\n--X\n++X\nX++\nX++\n++X\n--X\nX++\nX--\nX++\n++X\n++X\nX--\nX--\nX--\nX++\nX++\nX--\nX--\nX++\n++X\n++X\n++X\n--X\n--X\n++X\nX--\nX--\n--X\n++X\nX--\n++X\nX++\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n++X\n--X\nX++\n++X\nX--\n++X\nX--\n++X\nX++\nX--\n++X\nX++\n--X\nX++\nX++\n++X\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\n++X\n++X\n--X\nX--\nX--\nX--\nX--\n--X\n--X\n--X\n++X\n--X\n--X",
"output": "1"
},
{
"input": "63\n--X\nX--\n++X\n--X\n++X\nX++\n--X\n--X\nX++\n--X\n--X\nX++\nX--\nX--\n--X\n++X\nX--\nX--\nX++\n++X\nX++\nX++\n--X\n--X\n++X\nX--\nX--\nX--\n++X\nX++\nX--\n--X\nX--\n++X\n++X\nX++\n++X\nX++\nX++\n--X\nX--\n++X\nX--\n--X\nX--\nX--\nX--\n++X\n++X\n++X\n++X\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n++X\nX--\n++X\n++X\nX--",
"output": "1"
},
{
"input": "45\n--X\n++X\nX--\n++X\n++X\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX++\n++X\nX--\n++X\n++X\nX--\nX++\nX--\n--X\nX--\n++X\n++X\n--X\n--X\nX--\nX--\n--X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\nX--\n++X\n++X\nX++\nX++\n++X\n++X\nX++",
"output": "-3"
},
{
"input": "21\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX--\nX++\nX--\nX--\nX--\nX++\n++X\nX++\n++X\n--X\nX--\n--X\nX++\n++X",
"output": "1"
},
{
"input": "100\n--X\n++X\nX++\n++X\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\n++X\nX--\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n++X\nX++\n++X\nX--\n--X\n++X\nX--\n--X\n++X\n++X\nX--\nX++\nX++\nX++\n++X\n--X\n++X\nX++\nX--\n++X\n++X\n--X\n++X\nX--\nX--\nX--\nX++\nX--\nX--\nX++\nX++\n--X\nX++\nX++\n--X\nX--\n--X\n++X\n--X\n++X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\n++X\nX++\nX--\nX++\nX--\nX++\nX++\n--X\nX--\nX--\n++X\nX--\n--X\n--X\nX++\n--X\n--X\nX--\nX--\n++X\n++X\nX--\n++X\nX++\n--X\n++X\n++X\nX++\n--X\n--X\nX++",
"output": "8"
},
{
"input": "17\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n--X\nX--\nX++\nX--\n--X\n--X\nX--\n++X\nX--\nX++",
"output": "-1"
},
{
"input": "77\n++X\nX++\n--X\nX--\n--X\n--X\nX--\nX++\nX--\nX++\nX--\n++X\n--X\n--X\n--X\n--X\n++X\nX--\nX++\nX--\n--X\nX--\n--X\nX--\n++X\n--X\n++X\n++X\nX++\nX++\nX--\n--X\nX--\nX--\nX++\n--X\n--X\n++X\nX--\nX--\n++X\nX++\nX--\n++X\n--X\nX++\nX--\n++X\n++X\n++X\nX--\nX--\nX--\n--X\n++X\n++X\n++X\nX++\n--X\n--X\n++X\n--X\nX--\nX++\n++X\nX++\n++X\nX--\nX++\nX++\n--X\nX++\nX++\nX++\n--X\nX++\nX--",
"output": "-5"
},
{
"input": "21\nX--\n++X\n--X\nX--\n++X\nX--\n++X\nX--\n--X\n++X\nX++\n++X\nX++\n++X\nX--\n--X\nX++\nX++\nX--\n++X\nX--",
"output": "1"
},
{
"input": "1\nX--",
"output": "-1"
}
]
| 1,697,700,736 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 15 | 0 | code = []
n = int(input())
for i in range(n):
code.append(input())
print(code)
value = 0
for j in code:
if j == "X++" or j == "++X":
value += 1
elif j =="X--" or j == "--X":
value -= 1
print(value) | Title: Bit++
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order.
Output Specification:
Print a single integer — the final value of *x*.
Demo Input:
['1\n++X\n', '2\nX++\n--X\n']
Demo Output:
['1\n', '0\n']
Note:
none | ```python
code = []
n = int(input())
for i in range(n):
code.append(input())
print(code)
value = 0
for j in code:
if j == "X++" or j == "++X":
value += 1
elif j =="X--" or j == "--X":
value -= 1
print(value)
``` | 0 |
|
863 | B | Kayaking | PROGRAMMING | 1,500 | [
"brute force",
"greedy",
"sortings"
]
| null | null | Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability! | The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000). | Print minimum possible total instability. | [
"2\n1 2 3 4\n",
"4\n1 3 4 6 3 4 100 200\n"
]
| [
"1\n",
"5\n"
]
| none | 0 | [
{
"input": "2\n1 2 3 4",
"output": "1"
},
{
"input": "4\n1 3 4 6 3 4 100 200",
"output": "5"
},
{
"input": "3\n305 139 205 406 530 206",
"output": "102"
},
{
"input": "3\n610 750 778 6 361 407",
"output": "74"
},
{
"input": "5\n97 166 126 164 154 98 221 7 51 47",
"output": "35"
},
{
"input": "50\n1 1 2 2 1 3 2 2 1 1 1 1 2 3 3 1 2 1 3 3 2 1 2 3 1 1 2 1 3 1 3 1 3 3 3 1 1 1 3 3 2 2 2 2 3 2 2 2 2 3 1 3 3 3 3 1 3 3 1 3 3 3 3 2 3 1 3 3 1 1 1 3 1 2 2 2 1 1 1 3 1 2 3 2 1 3 3 2 2 1 3 1 3 1 2 2 1 2 3 2",
"output": "0"
},
{
"input": "50\n5 5 5 5 4 2 2 3 2 2 4 1 5 5 1 2 4 2 4 2 5 2 2 2 2 3 2 4 2 5 5 4 3 1 2 3 3 5 4 2 2 5 2 4 5 5 4 4 1 5 5 3 2 2 5 1 3 3 2 4 4 5 1 2 3 4 4 1 3 3 3 5 1 2 4 4 4 4 2 5 2 5 3 2 4 5 5 2 1 1 2 4 5 3 2 1 2 4 4 4",
"output": "1"
},
{
"input": "50\n499 780 837 984 481 526 944 482 862 136 265 605 5 631 974 967 574 293 969 467 573 845 102 224 17 873 648 120 694 996 244 313 404 129 899 583 541 314 525 496 443 857 297 78 575 2 430 137 387 319 382 651 594 411 845 746 18 232 6 289 889 81 174 175 805 1000 799 950 475 713 951 685 729 925 262 447 139 217 788 514 658 572 784 185 112 636 10 251 621 218 210 89 597 553 430 532 264 11 160 476",
"output": "368"
},
{
"input": "50\n873 838 288 87 889 364 720 410 565 651 577 356 740 99 549 592 994 385 777 435 486 118 887 440 749 533 356 790 413 681 267 496 475 317 88 660 374 186 61 437 729 860 880 538 277 301 667 180 60 393 955 540 896 241 362 146 74 680 734 767 851 337 751 860 542 735 444 793 340 259 495 903 743 961 964 966 87 275 22 776 368 701 835 732 810 735 267 988 352 647 924 183 1 924 217 944 322 252 758 597",
"output": "393"
},
{
"input": "50\n297 787 34 268 439 629 600 398 425 833 721 908 830 636 64 509 420 647 499 675 427 599 396 119 798 742 577 355 22 847 389 574 766 453 196 772 808 261 106 844 726 975 173 992 874 89 775 616 678 52 69 591 181 573 258 381 665 301 589 379 362 146 790 842 765 100 229 916 938 97 340 793 758 177 736 396 247 562 571 92 923 861 165 748 345 703 431 930 101 761 862 595 505 393 126 846 431 103 596 21",
"output": "387"
},
{
"input": "50\n721 631 587 746 692 406 583 90 388 16 161 948 921 70 387 426 39 398 517 724 879 377 906 502 359 950 798 408 846 718 911 845 57 886 9 668 537 632 344 762 19 193 658 447 870 173 98 156 592 519 183 539 274 393 962 615 551 626 148 183 769 763 829 120 796 761 14 744 537 231 696 284 581 688 611 826 703 145 224 600 965 613 791 275 984 375 402 281 851 580 992 8 816 454 35 532 347 250 242 637",
"output": "376"
},
{
"input": "50\n849 475 37 120 754 183 758 374 543 198 896 691 11 607 198 343 761 660 239 669 628 259 223 182 216 158 20 565 454 884 137 923 156 22 310 77 267 707 582 169 120 308 439 309 59 152 206 696 210 177 296 887 559 22 154 553 142 247 491 692 473 572 461 206 532 319 503 164 328 365 541 366 300 392 486 257 863 432 877 404 520 69 418 99 519 239 374 927 601 103 226 316 423 219 240 26 455 101 184 61",
"output": "351"
},
{
"input": "3\n1 2 10 11 100 100",
"output": "1"
},
{
"input": "17\n814 744 145 886 751 1000 272 914 270 529 467 164 410 369 123 424 991 12 702 582 561 858 746 950 598 393 606 498 648 686 455 873 728 858",
"output": "318"
},
{
"input": "45\n476 103 187 696 463 457 588 632 763 77 391 721 95 124 378 812 980 193 694 898 859 572 721 274 605 264 929 615 257 918 42 493 1 3 697 349 990 800 82 535 382 816 943 735 11 272 562 323 653 370 766 332 666 130 704 604 645 717 267 255 37 470 925 941 376 611 332 758 504 40 477 263 708 434 38 596 650 990 714 662 572 467 949 799 648 581 545 828 508 636",
"output": "355"
},
{
"input": "2\n55 5 25 51",
"output": "4"
},
{
"input": "25\n89 50 640 463 858 301 522 241 923 378 892 822 550 17 42 66 706 779 657 840 273 222 444 459 94 925 437 159 182 727 92 851 742 215 653 891 782 533 29 128 133 883 317 475 165 994 802 434 744 973",
"output": "348"
},
{
"input": "4\n35 48 71 44 78 79 57 48",
"output": "10"
},
{
"input": "3\n58 89 73 15 5 47",
"output": "21"
},
{
"input": "2\n1 20 99 100",
"output": "1"
}
]
| 1,570,279,333 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 140 | 0 | n=int(input())
l=[int(i) for i in input().split()]
#n-1 2 carriers and
# 2 1 carriers
l.sort()
mini=10**100
for i in range(2*n):
for j in range(i+1,2*n):
inst=0
l1=[l[k] for k in range(2*n) if k!=i and k!=j]
for i in range(1,len(l1),2):
inst+=(l1[i]-l1[i-1])
mini=min(mini,inst)
print(mini) | Title: Kayaking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
Input Specification:
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
Output Specification:
Print minimum possible total instability.
Demo Input:
['2\n1 2 3 4\n', '4\n1 3 4 6 3 4 100 200\n']
Demo Output:
['1\n', '5\n']
Note:
none | ```python
n=int(input())
l=[int(i) for i in input().split()]
#n-1 2 carriers and
# 2 1 carriers
l.sort()
mini=10**100
for i in range(2*n):
for j in range(i+1,2*n):
inst=0
l1=[l[k] for k in range(2*n) if k!=i and k!=j]
for i in range(1,len(l1),2):
inst+=(l1[i]-l1[i-1])
mini=min(mini,inst)
print(mini)
``` | 0 |
|
500 | A | New Year Transportation | PROGRAMMING | 1,000 | [
"dfs and similar",
"graphs",
"implementation"
]
| null | null | New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system. | The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World. | If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO". | [
"8 4\n1 2 1 2 1 2 1\n",
"8 5\n1 2 1 2 1 1 1\n"
]
| [
"YES\n",
"NO\n"
]
| In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit. | 500 | [
{
"input": "8 4\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "8 5\n1 2 1 2 1 1 1",
"output": "NO"
},
{
"input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1",
"output": "YES"
},
{
"input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1",
"output": "YES"
},
{
"input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1",
"output": "NO"
},
{
"input": "10 3\n8 3 5 4 2 3 2 2 1",
"output": "NO"
},
{
"input": "10 9\n8 3 5 4 2 3 2 2 1",
"output": "YES"
},
{
"input": "3 2\n1 1",
"output": "YES"
},
{
"input": "3 2\n2 1",
"output": "NO"
},
{
"input": "4 2\n2 1 1",
"output": "NO"
},
{
"input": "4 4\n2 2 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "3 3\n1 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 1 1",
"output": "YES"
},
{
"input": "3 3\n2 1",
"output": "YES"
},
{
"input": "4 4\n1 1 1",
"output": "YES"
},
{
"input": "8 8\n1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "5 5\n1 1 1 1",
"output": "YES"
}
]
| 1,648,363,301 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 34 | 77 | 6,758,400 | #──────▄▀▄─────▄▀▄
#─────▄█░░▀▀▀▀▀░░█▄
#─▄▄──█░░░░░░░░░░░█──▄▄
#█▄▄█─█░░▀░░┬░░▀░░█─█▄▄█
n,z = map(int,input().split())
l = list(map(int,input().split()))
m = []
for i in range(n-1):
m.append(i+l[i])
been = [False]*n
from collections import deque
d = deque()
d.append(m[0])
been[0] = True
while len(d) != 0:
a = d.popleft()
if been[a] == False:
been[a] = True
if a == n-1:
pass
else:
d.append(m[a])
if been[z-1]:
print('YES')
else:
print('NO')
| Title: New Year Transportation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
Input Specification:
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
Output Specification:
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
Demo Input:
['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit. | ```python
#──────▄▀▄─────▄▀▄
#─────▄█░░▀▀▀▀▀░░█▄
#─▄▄──█░░░░░░░░░░░█──▄▄
#█▄▄█─█░░▀░░┬░░▀░░█─█▄▄█
n,z = map(int,input().split())
l = list(map(int,input().split()))
m = []
for i in range(n-1):
m.append(i+l[i])
been = [False]*n
from collections import deque
d = deque()
d.append(m[0])
been[0] = True
while len(d) != 0:
a = d.popleft()
if been[a] == False:
been[a] = True
if a == n-1:
pass
else:
d.append(m[a])
if been[z-1]:
print('YES')
else:
print('NO')
``` | 3 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
]
| A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
]
| [
"4\n",
"4\n"
]
| none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
]
| 1,634,115,984 | 2,147,483,647 | PyPy 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include<stdio.h>
int main()
{
int m,c=0,n;
scanf("%d%d",&m,&n);
printf("%d",(m*n)/2);
return 0;
} | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
#include<stdio.h>
int main()
{
int m,c=0,n;
scanf("%d%d",&m,&n);
printf("%d",(m*n)/2);
return 0;
}
``` | -1 |
5 | C | Longest Regular Bracket Sequence | PROGRAMMING | 1,900 | [
"constructive algorithms",
"data structures",
"dp",
"greedy",
"sortings",
"strings"
]
| C. Longest Regular Bracket Sequence | 2 | 256 | This is yet another problem dealing with regular bracket sequences.
We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well. | The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106. | Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1". | [
")((())))(()())\n",
"))(\n"
]
| [
"6 2\n",
"0 1\n"
]
| none | 0 | [
{
"input": ")((())))(()())",
"output": "6 2"
},
{
"input": "))(",
"output": "0 1"
},
{
"input": "()(())()",
"output": "8 1"
},
{
"input": "((((()(((",
"output": "2 1"
},
{
"input": "))))()())))",
"output": "4 1"
},
{
"input": "(()())()(())()()())())()((()(()(())()()())((()(())()(()()()()))()(())()(((()())()(()((())()(())(()))",
"output": "28 1"
},
{
"input": ")(()(((((())))))(((()))))))((()(((((((())())()))))((((((((())))((((((())))))(()((((()))))(()))))))))",
"output": "68 1"
},
{
"input": "())(((((())())((((()))(())))())())(((()(()()()())(())()))((()(())())()()))()(()())))))(()))((())((((",
"output": "80 1"
},
{
"input": "))(((((((()((((())(((((((((()()))))(()())()((())())))((((()))(()()()))))(()()))())))))((())())()))((",
"output": "92 1"
}
]
| 1,670,510,671 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 2 | 154 | 2,764,800 | def solve(st):
start = [0]*len(st)
extension = [0]*len(st)
frequency = [0]*len(st)
stack =[]
ans = 0
for i in range(len(st)):
char = st[i]
if char == '(':
stack.append(i)
else:
if len(stack) == 0:
start[i] = extension[i] = -1
else:
idx = stack[-1]
stack.pop()
start[i] = extension[i] = idx
if idx > 0 and st[idx - 1] ==')' and start[idx - 1] >= 0:
extension[i] = extension[idx - 1]
length = i - extension[i] + 1
frequency[length] += 1
ans = max(ans, length)
frequency[0] = 1
print(ans, frequency[ans])
solve(input()) | Title: Longest Regular Bracket Sequence
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
This is yet another problem dealing with regular bracket sequences.
We should remind you that a bracket sequence is called regular, if by inserting «+» and «1» into it we can get a correct mathematical expression. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
You are given a string of «(» and «)» characters. You are to find its longest substring that is a regular bracket sequence. You are to find the number of such substrings as well.
Input Specification:
The first line of the input file contains a non-empty string, consisting of «(» and «)» characters. Its length does not exceed 106.
Output Specification:
Print the length of the longest substring that is a regular bracket sequence, and the number of such substrings. If there are no such substrings, write the only line containing "0 1".
Demo Input:
[')((())))(()())\n', '))(\n']
Demo Output:
['6 2\n', '0 1\n']
Note:
none | ```python
def solve(st):
start = [0]*len(st)
extension = [0]*len(st)
frequency = [0]*len(st)
stack =[]
ans = 0
for i in range(len(st)):
char = st[i]
if char == '(':
stack.append(i)
else:
if len(stack) == 0:
start[i] = extension[i] = -1
else:
idx = stack[-1]
stack.pop()
start[i] = extension[i] = idx
if idx > 0 and st[idx - 1] ==')' and start[idx - 1] >= 0:
extension[i] = extension[idx - 1]
length = i - extension[i] + 1
frequency[length] += 1
ans = max(ans, length)
frequency[0] = 1
print(ans, frequency[ans])
solve(input())
``` | -1 |
379 | A | New Year Candles | PROGRAMMING | 1,000 | [
"implementation"
]
| null | null | Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number. | The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000). | Print a single integer — the number of hours Vasily can light up the room for. | [
"4 2\n",
"6 3\n"
]
| [
"7\n",
"8\n"
]
| Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours. | 500 | [
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
]
| 1,695,988,129 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 31 | 0 | a,b=map(int,input().split())
innitial=a
times=0
lefts=0
while a>1:
if a % b==0:
times+=int(a/b)
a=int(a/b)
else:
times+=int(a//b)
a=int(a//b)
lefts+=a%b
lefts+=1
left=lefts
while left>1:
lefts=left
left=0
while lefts>1:
if lefts % b==0:
times+=int(lefts/b)
lefts=int(lefts/b)
else:
times+=int((lefts-left%b)/2)
lefts=int((lefts-left%b)/2)
left+=left%b
left+=1
print(times+innitial) | Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours. | ```python
a,b=map(int,input().split())
innitial=a
times=0
lefts=0
while a>1:
if a % b==0:
times+=int(a/b)
a=int(a/b)
else:
times+=int(a//b)
a=int(a//b)
lefts+=a%b
lefts+=1
left=lefts
while left>1:
lefts=left
left=0
while lefts>1:
if lefts % b==0:
times+=int(lefts/b)
lefts=int(lefts/b)
else:
times+=int((lefts-left%b)/2)
lefts=int((lefts-left%b)/2)
left+=left%b
left+=1
print(times+innitial)
``` | 0 |
|
552 | D | Vanya and Triangles | PROGRAMMING | 1,900 | [
"brute force",
"combinatorics",
"data structures",
"geometry",
"math",
"sortings"
]
| null | null | Vanya got bored and he painted *n* distinct points on the plane. After that he connected all the points pairwise and saw that as a result many triangles were formed with vertices in the painted points. He asks you to count the number of the formed triangles with the non-zero area. | The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of the points painted on the plane.
Next *n* lines contain two integers each *x**i*,<=*y**i* (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100) — the coordinates of the *i*-th point. It is guaranteed that no two given points coincide. | In the first line print an integer — the number of triangles with the non-zero area among the painted points. | [
"4\n0 0\n1 1\n2 0\n2 2\n",
"3\n0 0\n1 1\n2 0\n",
"1\n1 1\n"
]
| [
"3\n",
"1\n",
"0\n"
]
| Note to the first sample test. There are 3 triangles formed: (0, 0) - (1, 1) - (2, 0); (0, 0) - (2, 2) - (2, 0); (1, 1) - (2, 2) - (2, 0).
Note to the second sample test. There is 1 triangle formed: (0, 0) - (1, 1) - (2, 0).
Note to the third sample test. A single point doesn't form a single triangle. | 2,000 | [
{
"input": "4\n0 0\n1 1\n2 0\n2 2",
"output": "3"
},
{
"input": "3\n0 0\n1 1\n2 0",
"output": "1"
},
{
"input": "1\n1 1",
"output": "0"
},
{
"input": "5\n0 0\n1 1\n2 2\n3 3\n4 4",
"output": "0"
},
{
"input": "5\n0 0\n1 1\n2 3\n3 6\n4 10",
"output": "10"
},
{
"input": "4\n-100 -100\n-100 100\n100 -100\n100 100",
"output": "4"
},
{
"input": "5\n-100 -100\n-100 100\n100 -100\n100 100\n0 0",
"output": "8"
},
{
"input": "4\n1 -100\n2 -100\n100 -99\n99 -99",
"output": "4"
},
{
"input": "25\n26 -54\n16 56\n-42 -51\n92 -58\n100 52\n57 -98\n-84 -28\n-71 12\n21 -82\n-3 -30\n72 94\n-66 96\n-50 -41\n-77 -41\n-42 -55\n-13 12\n0 -99\n-50 -5\n65 -48\n-96 -80\n73 -92\n72 59\n53 -66\n-67 -75\n2 56",
"output": "2300"
},
{
"input": "5\n-62 -69\n3 -48\n54 54\n8 94\n83 94",
"output": "10"
},
{
"input": "33\n0 81\n20 -16\n-71 38\n-45 28\n-8 -40\n34 -49\n43 -10\n-40 19\n14 -50\n-95 8\n-21 85\n64 98\n-97 -82\n19 -83\n39 -99\n43 71\n67 43\n-54 57\n-7 24\n83 -76\n54 -88\n-43 -9\n-75 24\n74 32\n-68 -1\n71 84\n88 80\n52 67\n-64 21\n-85 97\n33 13\n41 -28\n0 74",
"output": "5456"
},
{
"input": "61\n37 -96\n36 -85\n30 -53\n-98 -40\n2 3\n-88 -69\n88 -26\n78 -69\n48 -3\n-41 66\n-93 -58\n-51 59\n21 -2\n65 29\n-3 35\n-98 46\n42 38\n0 -99\n46 84\n39 -48\n-15 81\n-15 51\n-77 74\n81 -58\n26 -35\n-14 20\n73 74\n-45 83\n90 22\n-8 53\n1 -52\n20 58\n39 -22\n60 -10\n52 22\n-46 6\n8 8\n14 9\n38 -45\n82 13\n43 4\n-25 21\n50 -16\n31 -12\n76 -13\n-82 -2\n-5 -56\n87 -31\n9 -36\n-100 92\n-10 39\n-16 2\n62 -39\n-36 60\n14 21\n-62 40\n98 43\n-54 66\n-34 46\n-47 -65\n21 44",
"output": "35985"
},
{
"input": "9\n-41 -22\n95 53\n81 -61\n22 -74\n-79 38\n-56 -32\n100 -32\n-37 -94\n-59 -9",
"output": "84"
},
{
"input": "33\n21 -99\n11 85\n80 -77\n-31 59\n32 6\n24 -52\n-32 -47\n57 18\n76 -36\n96 -38\n-59 -12\n-98 -32\n-52 32\n-73 -87\n-51 -40\n34 -55\n69 46\n-88 -67\n-68 65\n60 -11\n-45 -41\n91 -21\n45 21\n-75 49\n58 65\n-20 81\n-24 29\n66 -71\n-25 50\n96 74\n-43 -47\n34 -86\n81 14",
"output": "5455"
},
{
"input": "61\n83 52\n28 91\n-45 -68\n-84 -8\n-59 -28\n-98 -72\n38 -38\n-51 -96\n-66 11\n-76 45\n95 45\n-89 5\n-60 -66\n73 26\n9 94\n-5 -80\n44 41\n66 -22\n61 26\n-58 -84\n62 -73\n18 63\n44 71\n32 -41\n-50 -69\n-30 17\n61 47\n45 70\n-97 76\n-27 31\n2 -12\n-87 -75\n-80 -82\n-47 50\n45 -23\n71 54\n79 -7\n35 22\n19 -53\n-65 -72\n-69 68\n-53 48\n-73 -15\n29 38\n-49 -47\n12 -30\n-21 -59\n-28 -11\n-73 -60\n99 74\n32 30\n-9 -7\n-82 95\n58 -32\n39 64\n-42 9\n-21 -76\n39 33\n-63 59\n-66 41\n-54 -69",
"output": "35985"
},
{
"input": "62\n-53 -58\n29 89\n-92 15\n-91 -19\n96 23\n-1 -57\n-83 11\n56 -95\n-39 -47\n-75 77\n52 -95\n-13 -12\n-51 80\n32 -78\n94 94\n-51 81\n53 -28\n-83 -78\n76 -25\n91 -60\n-40 -27\n55 86\n-26 1\n-41 89\n61 -23\n81 31\n-21 82\n-12 47\n20 36\n-95 54\n-81 73\n-19 -83\n52 51\n-60 68\n-58 35\n60 -38\n-98 32\n-10 60\n88 -5\n78 -57\n-12 -43\n-83 36\n51 -63\n-89 -5\n-62 -42\n-29 78\n73 62\n-88 -55\n34 38\n88 -26\n-26 -89\n40 -26\n46 63\n74 -66\n-61 -61\n82 -53\n-75 -62\n-99 -52\n-15 30\n38 -52\n-83 -75\n-31 -38",
"output": "37814"
},
{
"input": "2\n0 0\n1 1",
"output": "0"
},
{
"input": "50\n0 -26\n0 -64\n0 63\n0 -38\n0 47\n0 31\n0 -72\n0 60\n0 -15\n0 -36\n0 50\n0 -77\n0 -89\n0 5\n0 83\n0 -52\n0 -21\n0 39\n0 51\n0 -11\n0 -69\n0 57\n0 -58\n0 64\n0 85\n0 -61\n0 0\n0 69\n0 -83\n0 24\n0 -91\n0 -33\n0 -79\n0 -39\n0 -98\n0 45\n0 4\n0 -8\n0 96\n0 35\n0 9\n0 53\n0 90\n0 15\n0 -19\n0 -48\n0 -56\n0 38\n0 92\n0 76",
"output": "0"
},
{
"input": "20\n12 16\n19 13\n19 15\n20 3\n5 20\n8 3\n9 18\n2 15\n2 3\n16 8\n14 18\n16 20\n13 17\n0 15\n10 12\n10 6\n18 8\n6 1\n6 2\n0 6",
"output": "1130"
},
{
"input": "5\n0 0\n1 1\n2 4\n3 8\n4 16",
"output": "10"
},
{
"input": "3\n-100 -100\n0 0\n100 100",
"output": "0"
},
{
"input": "20\n-2 1\n5 1\n1 -1\n1 4\n-5 -5\n3 1\n-5 -3\n-2 3\n-3 4\n5 -4\n-4 5\n3 3\n1 0\n-4 -4\n3 0\n4 -1\n-3 0\n-2 2\n-2 -5\n-5 -4",
"output": "1109"
},
{
"input": "3\n1 1\n3 3\n2 2",
"output": "0"
},
{
"input": "10\n-52 25\n55 76\n97 88\n92 3\n-98 77\n45 90\n6 85\n-68 -38\n-74 -55\n-48 60",
"output": "120"
},
{
"input": "10\n-1 32\n0 88\n-1 69\n0 62\n-1 52\n0 16\n0 19\n-1 58\n0 38\n0 67",
"output": "96"
},
{
"input": "20\n-100 -100\n-99 -99\n-98 -96\n-97 -91\n-96 -84\n-95 -75\n-94 -64\n-93 -51\n-92 -36\n-91 -19\n100 100\n99 99\n98 96\n97 91\n96 84\n95 75\n94 64\n93 51\n92 36\n91 19",
"output": "1136"
}
]
| 1,674,285,347 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 6 | 4,000 | 9,728,000 | import math
from math import sqrt, inf
import queue
# -------- info --------
# https://codeforces.com/profile/Wolxy
# -------- sys --------
def dis(from_loc, to_loc, euclidean = True) -> int:
result = 0
if euclidean:
for i in range(min(len(from_loc), len(to_loc))):
result += (from_loc[i] - to_loc[i]) * (from_loc[i] - to_loc[i])
else:
for i in range(min(len(from_loc), len(to_loc))):
result += from_loc[i] - to_loc[i]
return result
def product(from_loc, first_loc, second_loc) -> int:
vector1 = (first_loc[0] - from_loc[0], first_loc[1] - from_loc[1])
vector2 = (second_loc[0] - from_loc[0], second_loc[1] - from_loc[1])
return vector1[0] * vector2[1] - vector2[0] * vector1[1]
# -------- functions[clearable] --------
# -------- solve[clearable] --------
def solve() -> None:
n = int(input())
ls = []
for _ in range(n):
ls.append(tuple(map(int, input().split(' '))))
count = 0
for i in range(n):
for j in range(i + 1, n):
for k in range(j + 1, n):
if product(ls[i], ls[j], ls[k]) != 0:
count += 1
print(count)
# -------- main --------
T = 1
# T = int(input())
for _ in range(T):
solve()
| Title: Vanya and Triangles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got bored and he painted *n* distinct points on the plane. After that he connected all the points pairwise and saw that as a result many triangles were formed with vertices in the painted points. He asks you to count the number of the formed triangles with the non-zero area.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of the points painted on the plane.
Next *n* lines contain two integers each *x**i*,<=*y**i* (<=-<=100<=≤<=*x**i*,<=*y**i*<=≤<=100) — the coordinates of the *i*-th point. It is guaranteed that no two given points coincide.
Output Specification:
In the first line print an integer — the number of triangles with the non-zero area among the painted points.
Demo Input:
['4\n0 0\n1 1\n2 0\n2 2\n', '3\n0 0\n1 1\n2 0\n', '1\n1 1\n']
Demo Output:
['3\n', '1\n', '0\n']
Note:
Note to the first sample test. There are 3 triangles formed: (0, 0) - (1, 1) - (2, 0); (0, 0) - (2, 2) - (2, 0); (1, 1) - (2, 2) - (2, 0).
Note to the second sample test. There is 1 triangle formed: (0, 0) - (1, 1) - (2, 0).
Note to the third sample test. A single point doesn't form a single triangle. | ```python
import math
from math import sqrt, inf
import queue
# -------- info --------
# https://codeforces.com/profile/Wolxy
# -------- sys --------
def dis(from_loc, to_loc, euclidean = True) -> int:
result = 0
if euclidean:
for i in range(min(len(from_loc), len(to_loc))):
result += (from_loc[i] - to_loc[i]) * (from_loc[i] - to_loc[i])
else:
for i in range(min(len(from_loc), len(to_loc))):
result += from_loc[i] - to_loc[i]
return result
def product(from_loc, first_loc, second_loc) -> int:
vector1 = (first_loc[0] - from_loc[0], first_loc[1] - from_loc[1])
vector2 = (second_loc[0] - from_loc[0], second_loc[1] - from_loc[1])
return vector1[0] * vector2[1] - vector2[0] * vector1[1]
# -------- functions[clearable] --------
# -------- solve[clearable] --------
def solve() -> None:
n = int(input())
ls = []
for _ in range(n):
ls.append(tuple(map(int, input().split(' '))))
count = 0
for i in range(n):
for j in range(i + 1, n):
for k in range(j + 1, n):
if product(ls[i], ls[j], ls[k]) != 0:
count += 1
print(count)
# -------- main --------
T = 1
# T = int(input())
for _ in range(T):
solve()
``` | 0 |
|
230 | B | T-primes | PROGRAMMING | 1,300 | [
"binary search",
"implementation",
"math",
"number theory"
]
| null | null | We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not. | The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier. | Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't. | [
"3\n4 5 6\n"
]
| [
"YES\nNO\nNO\n"
]
| The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO". | 500 | [
{
"input": "3\n4 5 6",
"output": "YES\nNO\nNO"
},
{
"input": "2\n48 49",
"output": "NO\nYES"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "NO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO"
},
{
"input": "1\n36",
"output": "NO"
},
{
"input": "1\n999966000289",
"output": "YES"
},
{
"input": "1\n999993399999",
"output": "NO"
},
{
"input": "9\n111 121 131 111 121 131 111 121 131",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nNO"
},
{
"input": "1\n1",
"output": "NO"
},
{
"input": "1\n10",
"output": "NO"
},
{
"input": "1\n976197352729",
"output": "NO"
},
{
"input": "1\n1000000000000",
"output": "NO"
},
{
"input": "1\n9",
"output": "YES"
},
{
"input": "6\n549755813888 847288609443 762939453125 678223072849 285311670611 137858491849",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "3\n223092870 6469693230 200560490130",
"output": "NO\nNO\nNO"
},
{
"input": "2\n81 25",
"output": "NO\nYES"
},
{
"input": "1\n16",
"output": "NO"
},
{
"input": "22\n1 2 3 4 5 6 7 8 9 10 12752041 64 121 144 27550356289 124 24657 23756 135153365 25235235235 42351351 81",
"output": "NO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "1\n225",
"output": "NO"
},
{
"input": "1\n1521",
"output": "NO"
},
{
"input": "1\n81",
"output": "NO"
}
]
| 1,697,012,948 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 62 | 0 | #刚好有三个因数:必须为完全平方数
#分析:只有一个质因数
import math
n=int(input())
#埃氏筛
def is_prime(num):
#初始默认为素数
global bool_p
bool_p=[0]*(num+1)
i=2
while i*i<=num:
if bool_p[i]==0:
for j in range(i+i,num+1,i):
bool_p[j]=1
i+=1
bool_t=[0]*n#默认都是NO
nums=[int(i) for i in input().split()]
max_n=max(nums)
##square={i**2:i for i in range(2,math.ceil(math.sqrt(max_n))+1)} #本行可优化
#print(square)
#直接用最大的数字开根
is_prime(int(math.sqrt(max_n))+1)
for i in range(n):
#判断是否为完全平方数
sqrt_num=math.sqrt(nums[i])
#print(sqrt_num)
if (int(sqrt_num))**2 == nums[i]:
if not bool_p[int(sqrt_num)]:
print("YES")
else:
print("NO")
else:
print("NO")
| Title: T-primes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not.
Input Specification:
The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't.
Demo Input:
['3\n4 5 6\n']
Demo Output:
['YES\nNO\nNO\n']
Note:
The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO". | ```python
#刚好有三个因数:必须为完全平方数
#分析:只有一个质因数
import math
n=int(input())
#埃氏筛
def is_prime(num):
#初始默认为素数
global bool_p
bool_p=[0]*(num+1)
i=2
while i*i<=num:
if bool_p[i]==0:
for j in range(i+i,num+1,i):
bool_p[j]=1
i+=1
bool_t=[0]*n#默认都是NO
nums=[int(i) for i in input().split()]
max_n=max(nums)
##square={i**2:i for i in range(2,math.ceil(math.sqrt(max_n))+1)} #本行可优化
#print(square)
#直接用最大的数字开根
is_prime(int(math.sqrt(max_n))+1)
for i in range(n):
#判断是否为完全平方数
sqrt_num=math.sqrt(nums[i])
#print(sqrt_num)
if (int(sqrt_num))**2 == nums[i]:
if not bool_p[int(sqrt_num)]:
print("YES")
else:
print("NO")
else:
print("NO")
``` | 0 |
|
49 | B | Sum | PROGRAMMING | 1,500 | [
"math"
]
| B. Sum | 2 | 256 | Vasya studies positional numeral systems. Unfortunately, he often forgets to write the base of notation in which the expression is written. Once he saw a note in his notebook saying *a*<=+<=*b*<==<=?, and that the base of the positional notation wasn’t written anywhere. Now Vasya has to choose a base *p* and regard the expression as written in the base *p* positional notation. Vasya understood that he can get different results with different bases, and some bases are even invalid. For example, expression 78<=+<=87 in the base 16 positional notation is equal to *FF*16, in the base 15 positional notation it is equal to 11015, in the base 10 one — to 16510, in the base 9 one — to 1769, and in the base 8 or lesser-based positional notations the expression is invalid as all the numbers should be strictly less than the positional notation base. Vasya got interested in what is the length of the longest possible expression value. Help him to find this length.
The length of a number should be understood as the number of numeric characters in it. For example, the length of the longest answer for 78<=+<=87<==<=? is 3. It is calculated like that in the base 15 (11015), base 10 (16510), base 9 (1769) positional notations, for example, and in some other ones. | The first letter contains two space-separated numbers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=1000) which represent the given summands. | Print a single number — the length of the longest answer. | [
"78 87\n",
"1 1\n"
]
| [
"3\n",
"2\n"
]
| none | 1,000 | [
{
"input": "78 87",
"output": "3"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "9 7",
"output": "2"
},
{
"input": "11 11",
"output": "3"
},
{
"input": "43 21",
"output": "3"
},
{
"input": "84 89",
"output": "3"
},
{
"input": "12 34",
"output": "3"
},
{
"input": "99 11",
"output": "3"
},
{
"input": "11 99",
"output": "3"
},
{
"input": "99 99",
"output": "3"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "1 3",
"output": "2"
},
{
"input": "2 1",
"output": "2"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "3 1",
"output": "2"
},
{
"input": "3 2",
"output": "2"
},
{
"input": "3 3",
"output": "2"
},
{
"input": "1 466",
"output": "3"
},
{
"input": "1 1000",
"output": "4"
},
{
"input": "1 999",
"output": "4"
},
{
"input": "149 1",
"output": "3"
},
{
"input": "999 1",
"output": "4"
},
{
"input": "1000 1",
"output": "4"
},
{
"input": "998 998",
"output": "4"
},
{
"input": "998 999",
"output": "4"
},
{
"input": "998 1000",
"output": "4"
},
{
"input": "999 998",
"output": "4"
},
{
"input": "999 999",
"output": "4"
},
{
"input": "999 1000",
"output": "4"
},
{
"input": "1000 998",
"output": "4"
},
{
"input": "1000 999",
"output": "4"
},
{
"input": "1000 1000",
"output": "5"
},
{
"input": "1000 539",
"output": "4"
},
{
"input": "999 619",
"output": "4"
},
{
"input": "2 511",
"output": "3"
},
{
"input": "877 2",
"output": "3"
},
{
"input": "379 999",
"output": "4"
},
{
"input": "247 1000",
"output": "4"
},
{
"input": "555 555",
"output": "4"
},
{
"input": "208 997",
"output": "4"
},
{
"input": "633 581",
"output": "4"
},
{
"input": "411 517",
"output": "4"
},
{
"input": "836 101",
"output": "4"
},
{
"input": "262 685",
"output": "4"
},
{
"input": "39 269",
"output": "3"
},
{
"input": "464 205",
"output": "4"
},
{
"input": "890 789",
"output": "4"
},
{
"input": "667 373",
"output": "4"
},
{
"input": "840 975",
"output": "4"
},
{
"input": "810 413",
"output": "4"
},
{
"input": "133 851",
"output": "4"
},
{
"input": "104 938",
"output": "4"
},
{
"input": "427 376",
"output": "4"
},
{
"input": "398 815",
"output": "4"
},
{
"input": "721 253",
"output": "4"
},
{
"input": "692 339",
"output": "4"
},
{
"input": "15 778",
"output": "3"
},
{
"input": "986 216",
"output": "4"
},
{
"input": "450 277",
"output": "3"
},
{
"input": "333 1",
"output": "4"
},
{
"input": "499 499",
"output": "3"
},
{
"input": "79 1",
"output": "2"
},
{
"input": "87 1",
"output": "2"
},
{
"input": "47 8",
"output": "2"
},
{
"input": "87 8",
"output": "3"
},
{
"input": "1 11",
"output": "3"
}
]
| 1,676,377,913 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 67 | 124 | 0 | l=input().split(' ')
a,b=int(l[0]),int(l[1])
def sum_base(base, *args):
def numberToBase(n, b):
if n == 0:
return [0]
digits = []
while n:
digits.append(int(n % b))
n //= b
# at this point, digits[::-1] is the list of digits of n at base b
return int(''.join(map(str, digits[::-1]))) # convert a list of digits into a int
# first, convert all number to base 10 and take the sum
sum_base10 = sum([int(str(number), base) for number in args])
# second, convert the base10 sum into base b with the function numberToBase define above
return numberToBase(sum_base10, base)
biggest_numeral = '0'
for item in str(a) + str(b):
if item > biggest_numeral:
biggest_numeral = item
if '0' <= biggest_numeral <= '9':
biggest_numeral = int(biggest_numeral)
else:
biggest_numeral = ord(biggest_numeral) - ord('A') + 10
print( len(
str(
sum_base(biggest_numeral + 1,a,b)
)
))
| Title: Sum
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya studies positional numeral systems. Unfortunately, he often forgets to write the base of notation in which the expression is written. Once he saw a note in his notebook saying *a*<=+<=*b*<==<=?, and that the base of the positional notation wasn’t written anywhere. Now Vasya has to choose a base *p* and regard the expression as written in the base *p* positional notation. Vasya understood that he can get different results with different bases, and some bases are even invalid. For example, expression 78<=+<=87 in the base 16 positional notation is equal to *FF*16, in the base 15 positional notation it is equal to 11015, in the base 10 one — to 16510, in the base 9 one — to 1769, and in the base 8 or lesser-based positional notations the expression is invalid as all the numbers should be strictly less than the positional notation base. Vasya got interested in what is the length of the longest possible expression value. Help him to find this length.
The length of a number should be understood as the number of numeric characters in it. For example, the length of the longest answer for 78<=+<=87<==<=? is 3. It is calculated like that in the base 15 (11015), base 10 (16510), base 9 (1769) positional notations, for example, and in some other ones.
Input Specification:
The first letter contains two space-separated numbers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=1000) which represent the given summands.
Output Specification:
Print a single number — the length of the longest answer.
Demo Input:
['78 87\n', '1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
l=input().split(' ')
a,b=int(l[0]),int(l[1])
def sum_base(base, *args):
def numberToBase(n, b):
if n == 0:
return [0]
digits = []
while n:
digits.append(int(n % b))
n //= b
# at this point, digits[::-1] is the list of digits of n at base b
return int(''.join(map(str, digits[::-1]))) # convert a list of digits into a int
# first, convert all number to base 10 and take the sum
sum_base10 = sum([int(str(number), base) for number in args])
# second, convert the base10 sum into base b with the function numberToBase define above
return numberToBase(sum_base10, base)
biggest_numeral = '0'
for item in str(a) + str(b):
if item > biggest_numeral:
biggest_numeral = item
if '0' <= biggest_numeral <= '9':
biggest_numeral = int(biggest_numeral)
else:
biggest_numeral = ord(biggest_numeral) - ord('A') + 10
print( len(
str(
sum_base(biggest_numeral + 1,a,b)
)
))
``` | 3.969 |
770 | A | New Password | PROGRAMMING | 800 | [
"*special",
"implementation"
]
| null | null | Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions. | The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists. | Print any password which satisfies all conditions given by Innokentiy. | [
"4 3\n",
"6 6\n",
"5 2\n"
]
| [
"java\n",
"python\n",
"phphp\n"
]
| In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests. | 500 | [
{
"input": "4 3",
"output": "abca"
},
{
"input": "6 6",
"output": "abcdef"
},
{
"input": "5 2",
"output": "ababa"
},
{
"input": "3 2",
"output": "aba"
},
{
"input": "10 2",
"output": "ababababab"
},
{
"input": "26 13",
"output": "abcdefghijklmabcdefghijklm"
},
{
"input": "100 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "100 10",
"output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij"
},
{
"input": "3 3",
"output": "abc"
},
{
"input": "6 3",
"output": "abcabc"
},
{
"input": "10 3",
"output": "abcabcabca"
},
{
"input": "50 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab"
},
{
"input": "90 2",
"output": "ababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "6 2",
"output": "ababab"
},
{
"input": "99 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc"
},
{
"input": "4 2",
"output": "abab"
},
{
"input": "100 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "40 22",
"output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr"
},
{
"input": "13 8",
"output": "abcdefghabcde"
},
{
"input": "16 15",
"output": "abcdefghijklmnoa"
},
{
"input": "17 17",
"output": "abcdefghijklmnopq"
},
{
"input": "19 4",
"output": "abcdabcdabcdabcdabc"
},
{
"input": "100 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv"
},
{
"input": "100 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy"
},
{
"input": "26 26",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "27 26",
"output": "abcdefghijklmnopqrstuvwxyza"
},
{
"input": "2 2",
"output": "ab"
},
{
"input": "26 25",
"output": "abcdefghijklmnopqrstuvwxya"
},
{
"input": "99 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababa"
},
{
"input": "99 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu"
},
{
"input": "4 4",
"output": "abcd"
},
{
"input": "5 3",
"output": "abcab"
},
{
"input": "5 4",
"output": "abcda"
},
{
"input": "5 5",
"output": "abcde"
},
{
"input": "24 22",
"output": "abcdefghijklmnopqrstuvab"
},
{
"input": "26 14",
"output": "abcdefghijklmnabcdefghijkl"
},
{
"input": "26 15",
"output": "abcdefghijklmnoabcdefghijk"
},
{
"input": "30 12",
"output": "abcdefghijklabcdefghijklabcdef"
},
{
"input": "35 4",
"output": "abcdabcdabcdabcdabcdabcdabcdabcdabc"
},
{
"input": "79 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "79 14",
"output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi"
},
{
"input": "85 13",
"output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg"
},
{
"input": "90 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno"
},
{
"input": "90 19",
"output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn"
},
{
"input": "26 24",
"output": "abcdefghijklmnopqrstuvwxab"
},
{
"input": "100 17",
"output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno"
},
{
"input": "26 2",
"output": "ababababababababababababab"
}
]
| 1,666,692,641 | 2,147,483,647 | Python 3 | OK | TESTS | 47 | 46 | 0 | n,k = map(int,input().split(" "))
chars = ""
password = ""
for i in range(97,97+k):
chars += chr(i)
pointer = 0
for i in range(n):
password += chars[pointer]
if pointer == len(chars)-1:
pointer = pointer % len(chars)-1
else:
pointer += 1
print(password) | Title: New Password
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
Input Specification:
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists.
Output Specification:
Print any password which satisfies all conditions given by Innokentiy.
Demo Input:
['4 3\n', '6 6\n', '5 2\n']
Demo Output:
['java\n', 'python\n', 'phphp\n']
Note:
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests. | ```python
n,k = map(int,input().split(" "))
chars = ""
password = ""
for i in range(97,97+k):
chars += chr(i)
pointer = 0
for i in range(n):
password += chars[pointer]
if pointer == len(chars)-1:
pointer = pointer % len(chars)-1
else:
pointer += 1
print(password)
``` | 3 |
|
380 | C | Sereja and Brackets | PROGRAMMING | 2,000 | [
"data structures",
"schedules"
]
| null | null | Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")".
Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries.
You can find the definitions for a subsequence and a correct bracket sequence in the notes. | The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query. | Print the answer to each question on a single line. Print the answers in the order they go in the input. | [
"())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n"
]
| [
"0\n0\n2\n10\n4\n6\n6\n"
]
| A subsequence of length |*x*| of string *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">|*s*|</sub> (where |*s*| is the length of string *s*) is string *x* = *s*<sub class="lower-index">*k*<sub class="lower-index">1</sub></sub>*s*<sub class="lower-index">*k*<sub class="lower-index">2</sub></sub>... *s*<sub class="lower-index">*k*<sub class="lower-index">|*x*|</sub></sub> (1 ≤ *k*<sub class="lower-index">1</sub> < *k*<sub class="lower-index">2</sub> < ... < *k*<sub class="lower-index">|*x*|</sub> ≤ |*s*|).
A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not.
For the third query required sequence will be «()».
For the fourth query required sequence will be «()(())(())». | 1,500 | [
{
"input": "())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10",
"output": "0\n0\n2\n10\n4\n6\n6"
},
{
"input": "(((((()((((((((((()((()(((((\n1\n8 15",
"output": "0"
},
{
"input": "((()((())(((((((((()(()(()(((((((((((((((()(()((((((((((((((()(((((((((((((((((((()(((\n39\n28 56\n39 46\n57 63\n29 48\n51 75\n14 72\n5 70\n51 73\n10 64\n31 56\n50 54\n15 78\n78 82\n1 11\n1 70\n1 19\n10 22\n13 36\n3 10\n34 40\n51 76\n64 71\n36 75\n24 71\n1 63\n5 14\n46 67\n32 56\n39 43\n43 56\n61 82\n2 78\n1 21\n10 72\n49 79\n12 14\n53 79\n15 31\n7 47",
"output": "4\n4\n2\n4\n2\n12\n16\n2\n12\n4\n0\n12\n0\n6\n18\n6\n2\n6\n6\n0\n2\n0\n6\n8\n18\n4\n2\n4\n2\n2\n2\n18\n8\n12\n2\n0\n2\n6\n12"
},
{
"input": "))(()))))())())))))())((()()))))()))))))))))))\n9\n26 42\n21 22\n6 22\n7 26\n43 46\n25 27\n32 39\n22 40\n2 45",
"output": "4\n0\n6\n8\n0\n2\n2\n10\n20"
},
{
"input": "(()((((()(())((((((((()((((((()((((\n71\n15 29\n17 18\n5 26\n7 10\n16 31\n26 35\n2 30\n16 24\n2 24\n7 12\n15 18\n12 13\n25 30\n1 30\n12 13\n16 20\n6 35\n20 28\n18 23\n9 31\n12 35\n14 17\n8 16\n3 10\n12 33\n7 19\n2 33\n7 17\n21 27\n10 30\n29 32\n9 28\n18 32\n28 31\n31 33\n4 26\n15 27\n10 17\n8 14\n11 28\n8 23\n17 33\n4 14\n3 6\n6 34\n19 23\n4 21\n16 27\n14 27\n6 19\n31 32\n29 32\n9 17\n1 21\n2 31\n18 29\n16 26\n15 18\n4 5\n13 20\n9 28\n18 30\n1 32\n2 9\n16 24\n1 20\n4 15\n16 23\n19 34\n5 22\n5 23",
"output": "2\n0\n8\n2\n4\n2\n10\n2\n10\n4\n0\n0\n0\n10\n0\n0\n10\n2\n2\n8\n4\n0\n6\n2\n4\n6\n12\n6\n2\n6\n2\n6\n4\n2\n0\n8\n2\n4\n6\n4\n8\n4\n6\n0\n10\n2\n6\n2\n2\n6\n0\n2\n4\n8\n12\n2\n2\n0\n0\n0\n6\n2\n12\n4\n2\n8\n6\n2\n4\n6\n8"
},
{
"input": "(((())((((()()((((((()((()(((((((((((()((\n6\n20 37\n28 32\n12 18\n7 25\n21 33\n4 5",
"output": "4\n0\n2\n6\n4\n2"
},
{
"input": "(((()((((()()()(()))((((()(((()))()((((()))()((())\n24\n37 41\n13 38\n31 34\n14 16\n29 29\n12 46\n1 26\n15 34\n8 47\n11 23\n6 32\n2 22\n9 27\n17 40\n6 15\n4 49\n12 33\n3 48\n22 47\n19 48\n10 27\n23 25\n4 44\n27 48",
"output": "2\n16\n0\n2\n0\n26\n16\n12\n30\n8\n18\n14\n14\n12\n6\n34\n16\n32\n18\n18\n12\n0\n30\n16"
},
{
"input": ")()((((((((((((((((()(((()()(()((((((()(((((((()()))((((())(((((((((()(((((((((\n51\n29 53\n31 69\n54 59\n3 52\n26 46\n14 62\n6 54\n39 56\n17 27\n46 74\n60 72\n18 26\n38 46\n4 27\n22 52\n44 49\n42 77\n2 20\n39 57\n61 70\n33 54\n10 30\n67 70\n46 66\n17 77\n5 52\n33 77\n26 32\n1 72\n40 78\n38 68\n19 47\n30 53\n19 29\n52 71\n1 11\n22 53\n17 42\n2 51\n4 12\n24 76\n22 34\n21 69\n11 69\n36 52\n17 31\n57 58\n54 62\n23 71\n5 46\n51 53",
"output": "12\n14\n4\n18\n6\n22\n18\n8\n4\n12\n2\n4\n2\n4\n16\n2\n14\n2\n8\n2\n10\n6\n2\n10\n24\n18\n16\n4\n26\n14\n14\n10\n12\n6\n6\n2\n16\n10\n18\n0\n22\n6\n20\n22\n10\n8\n2\n4\n22\n10\n0"
},
{
"input": "(\n1\n1 1",
"output": "0"
},
{
"input": ")\n1\n1 1",
"output": "0"
},
{
"input": "()\n1\n1 2",
"output": "2"
},
{
"input": ")(\n1\n1 2",
"output": "0"
}
]
| 1,689,933,041 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 12 | 1,000 | 183,705,600 | def merge(v1, v2):
t = min(v1[1], v2[2])
a = v1[0] + v2[0] + t
b = v1[1] + v2[1] - t
c = v1[2] + v2[2] - t
return (a, b, c)
def build_tree(s, tree, v, tl, tr):
if tl == tr:
if s[tl - 1] == '(':
tree[v] = (0, 1, 0)
else:
tree[v] = (0, 0, 1)
else:
tm = (tl + tr) // 2
build_tree(s, tree, 2 * v, tl, tm)
build_tree(s, tree, 2 * v + 1, tm + 1, tr)
tree[v] = merge(tree[2 * v], tree[2 * v + 1])
def query(tree, v, tl, tr, l, r):
if l > r:
return (0, 0, 0)
if l == tl and r == tr:
return tree[v]
tm = (tl + tr) // 2
return merge(query(tree, 2 * v, tl, tm, l, min(r, tm)),
query(tree, 2 * v + 1, tm + 1, tr, max(l, tm + 1), r))
s = input().strip()
n = len(s)
q = int(input())
queries = []
for i in range(q):
l, r = map(int, input().split())
queries.append((l, r))
tree = [(0, 0, 0)] * (4 * n)
build_tree(s, tree, 1, 1, n)
for l, r in queries:
print(query(tree, 1, 1, n, l, r)[0] * 2)
| Title: Sereja and Brackets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja has a bracket sequence *s*1,<=*s*2,<=...,<=*s**n*, or, in other words, a string *s* of length *n*, consisting of characters "(" and ")".
Sereja needs to answer *m* queries, each of them is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). The answer to the *i*-th query is the length of the maximum correct bracket subsequence of sequence *s**l**i*,<=*s**l**i*<=+<=1,<=...,<=*s**r**i*. Help Sereja answer all queries.
You can find the definitions for a subsequence and a correct bracket sequence in the notes.
Input Specification:
The first line contains a sequence of characters *s*1,<=*s*2,<=...,<=*s**n* (1<=≤<=*n*<=≤<=106) without any spaces. Each character is either a "(" or a ")". The second line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains a pair of integers. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th query.
Output Specification:
Print the answer to each question on a single line. Print the answers in the order they go in the input.
Demo Input:
['())(())(())(\n7\n1 1\n2 3\n1 2\n1 12\n8 12\n5 11\n2 10\n']
Demo Output:
['0\n0\n2\n10\n4\n6\n6\n']
Note:
A subsequence of length |*x*| of string *s* = *s*<sub class="lower-index">1</sub>*s*<sub class="lower-index">2</sub>... *s*<sub class="lower-index">|*s*|</sub> (where |*s*| is the length of string *s*) is string *x* = *s*<sub class="lower-index">*k*<sub class="lower-index">1</sub></sub>*s*<sub class="lower-index">*k*<sub class="lower-index">2</sub></sub>... *s*<sub class="lower-index">*k*<sub class="lower-index">|*x*|</sub></sub> (1 ≤ *k*<sub class="lower-index">1</sub> < *k*<sub class="lower-index">2</sub> < ... < *k*<sub class="lower-index">|*x*|</sub> ≤ |*s*|).
A correct bracket sequence is a bracket sequence that can be transformed into a correct aryphmetic expression by inserting characters "1" and "+" between the characters of the string. For example, bracket sequences "()()", "(())" are correct (the resulting expressions "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not.
For the third query required sequence will be «()».
For the fourth query required sequence will be «()(())(())». | ```python
def merge(v1, v2):
t = min(v1[1], v2[2])
a = v1[0] + v2[0] + t
b = v1[1] + v2[1] - t
c = v1[2] + v2[2] - t
return (a, b, c)
def build_tree(s, tree, v, tl, tr):
if tl == tr:
if s[tl - 1] == '(':
tree[v] = (0, 1, 0)
else:
tree[v] = (0, 0, 1)
else:
tm = (tl + tr) // 2
build_tree(s, tree, 2 * v, tl, tm)
build_tree(s, tree, 2 * v + 1, tm + 1, tr)
tree[v] = merge(tree[2 * v], tree[2 * v + 1])
def query(tree, v, tl, tr, l, r):
if l > r:
return (0, 0, 0)
if l == tl and r == tr:
return tree[v]
tm = (tl + tr) // 2
return merge(query(tree, 2 * v, tl, tm, l, min(r, tm)),
query(tree, 2 * v + 1, tm + 1, tr, max(l, tm + 1), r))
s = input().strip()
n = len(s)
q = int(input())
queries = []
for i in range(q):
l, r = map(int, input().split())
queries.append((l, r))
tree = [(0, 0, 0)] * (4 * n)
build_tree(s, tree, 1, 1, n)
for l, r in queries:
print(query(tree, 1, 1, n, l, r)[0] * 2)
``` | 0 |
|
80 | A | Panoramix's Prediction | PROGRAMMING | 800 | [
"brute force"
]
| A. Panoramix's Prediction | 2 | 256 | A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix? | The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4. | Print YES, if *m* is the next prime number after *n*, or NO otherwise. | [
"3 5\n",
"7 11\n",
"7 9\n"
]
| [
"YES",
"YES",
"NO"
]
| none | 500 | [
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
]
| 1,678,198,796 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 4 | 154 | 0 | n = [int(_) for _ in input().split()]
prime_numbers = 0
for num in range(n[0], n[1] + 1):
if num > 1:
# Iterate from 2 to n / 2
for i in range(2, int(num / 2) + 1):
# If num is divisible by any number between
# 2 and n / 2, it is not prime
if (num % i) == 0:
break
else:
prime_numbers += 1
if prime_numbers == 2:
print("YES")
else:
print("NO")
| Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none | ```python
n = [int(_) for _ in input().split()]
prime_numbers = 0
for num in range(n[0], n[1] + 1):
if num > 1:
# Iterate from 2 to n / 2
for i in range(2, int(num / 2) + 1):
# If num is divisible by any number between
# 2 and n / 2, it is not prime
if (num % i) == 0:
break
else:
prime_numbers += 1
if prime_numbers == 2:
print("YES")
else:
print("NO")
``` | 0 |
656 | G | You're a Professional | PROGRAMMING | 1,900 | [
"*special"
]
| null | null | A simple recommendation system would recommend a user things liked by a certain number of their friends. In this problem you will implement part of such a system.
You are given user's friends' opinions about a list of items. You are also given a threshold *T* — the minimal number of "likes" necessary for an item to be recommended to the user.
Output the number of items in the list liked by at least *T* of user's friends. | The first line of the input will contain three space-separated integers: the number of friends *F* (1<=≤<=*F*<=≤<=10), the number of items *I* (1<=≤<=*I*<=≤<=10) and the threshold *T* (1<=≤<=*T*<=≤<=*F*).
The following *F* lines of input contain user's friends' opinions. *j*-th character of *i*-th line is 'Y' if *i*-th friend likes *j*-th item, and 'N' otherwise. | Output an integer — the number of items liked by at least *T* of user's friends. | [
"3 3 2\nYYY\nNNN\nYNY\n",
"4 4 1\nNNNY\nNNYN\nNYNN\nYNNN\n"
]
| [
"2\n",
"4\n"
]
| none | 0 | [
{
"input": "3 3 2\nYYY\nNNN\nYNY",
"output": "2"
},
{
"input": "4 4 1\nNNNY\nNNYN\nNYNN\nYNNN",
"output": "4"
},
{
"input": "3 5 2\nNYNNY\nYNNNN\nNNYYN",
"output": "0"
},
{
"input": "1 10 1\nYYYNYNNYNN",
"output": "5"
},
{
"input": "10 1 5\nY\nN\nN\nN\nY\nN\nN\nY\nN\nN",
"output": "0"
},
{
"input": "10 10 1\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN\nNNNNNNNNNN",
"output": "0"
},
{
"input": "10 10 10\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY\nYYYYYYYYYY",
"output": "10"
},
{
"input": "8 9 1\nNYNNYYYYN\nNNNYNYNNY\nYYNYNYNNN\nNYYYNYNNN\nYNYNYNYYN\nYYNNYYYYY\nYYYYNYNYY\nNYYNNYYYY",
"output": "9"
},
{
"input": "5 2 3\nNN\nNY\nYY\nNN\nNY",
"output": "1"
},
{
"input": "6 4 5\nYNNY\nNYYY\nNNNY\nYNYN\nYYYN\nYNNY",
"output": "0"
},
{
"input": "6 1 3\nY\nY\nY\nY\nY\nN",
"output": "1"
},
{
"input": "6 2 2\nYN\nNN\nYN\nNN\nYN\nNN",
"output": "1"
},
{
"input": "2 4 2\nNYNY\nNYNY",
"output": "2"
},
{
"input": "9 6 3\nNYYYYN\nNNNYYN\nYYYYYY\nNYNNNN\nYNNYNY\nNNNNNY\nYNNYNN\nYYYYNY\nNNYYYY",
"output": "6"
},
{
"input": "6 9 6\nYYYYNYNNN\nYNNYNNNYN\nNYYYNNNYY\nNYYYNNNNY\nYYNYNNNYY\nYYYNYYNNN",
"output": "0"
},
{
"input": "9 7 8\nYNNNNYN\nNNNYYNN\nNNYYYNY\nNYYNYYY\nNNYYNYN\nNYYYNNY\nYYNYNYY\nNYYYYYY\nNNYYNYN",
"output": "0"
},
{
"input": "9 1 6\nN\nN\nY\nN\nY\nY\nY\nY\nY",
"output": "1"
},
{
"input": "7 7 2\nNNYNNYN\nNNNYYNY\nNNNYYNY\nYNNNNNY\nNNYNYYY\nYYNNYYN\nNNYYYNY",
"output": "6"
},
{
"input": "8 4 2\nYNYY\nYNYY\nYNNN\nNNNN\nNYNN\nYNNN\nNNYN\nNYNN",
"output": "4"
},
{
"input": "9 10 7\nNNYNNYYYYY\nYNYYNYYNYN\nNYNYYNNNNY\nYYYYYYYYYN\nYYNYNYYNNN\nYYYNNYYYYY\nNYYYYYNNNN\nNYNNYYYYNN\nYYYYYNNYYY",
"output": "2"
},
{
"input": "6 4 2\nNNNN\nNYYY\nNYNN\nNYNN\nYNNY\nNNNN",
"output": "2"
},
{
"input": "3 1 1\nN\nY\nN",
"output": "1"
},
{
"input": "7 1 3\nY\nY\nY\nN\nY\nY\nY",
"output": "1"
},
{
"input": "9 8 7\nNYYNNNYY\nYYYNYNNN\nYNYNYNNY\nNYYYNNNY\nNYYYYNYN\nNNNNYYNN\nYNYYYYYY\nNNYNYNYY\nNYYNNYYY",
"output": "1"
},
{
"input": "9 5 9\nYYYYN\nYYYNN\nNNYNN\nNNYYY\nYNNNN\nNYNNN\nYYYYN\nYNYYN\nNNNYN",
"output": "0"
},
{
"input": "8 4 1\nYYYN\nNNNN\nNYNY\nYNNY\nYNYY\nYNYN\nYNNY\nNNYN",
"output": "4"
},
{
"input": "7 9 5\nYNNYYYYNN\nYNYYYNNYY\nYNYYYYYNN\nYYNYYNYYN\nNNYYNNNYY\nYYNYNYYNN\nYYNNYYNYN",
"output": "3"
},
{
"input": "5 8 3\nNYYYNNNN\nYNNNNNYY\nYNYYYNYY\nNNNNNYNN\nYYYYYYYY",
"output": "5"
},
{
"input": "5 10 4\nYYYYNNNNYN\nYYYNYYYNNY\nNNNYNYNYNY\nYNYNNNNNNY\nNNYNYNYNYY",
"output": "2"
},
{
"input": "6 9 6\nNYYNNYNYN\nYNYNYNNNN\nNNYNNYYYY\nNNYNNNYNY\nNYYYNNYNY\nNNYYNNNYN",
"output": "1"
},
{
"input": "4 4 1\nYNYY\nNNNY\nYNNN\nNNYN",
"output": "3"
},
{
"input": "1 3 1\nYYN",
"output": "2"
},
{
"input": "10 4 5\nNNYN\nYYNY\nYYNY\nNYYN\nYNYY\nYNYY\nYYNN\nYNYN\nYYYY\nYYNY",
"output": "4"
}
]
| 1,532,988,280 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 0 | 0 | 'kitten'
f,l,t=map(int,input().split())
s=[input() for _ in range(f)]
a=0
for j in range(l):
c=0
for i in range(f):
c+=s[i][j]=='Y';
a+=c>=t
print(a) | Title: You're a Professional
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A simple recommendation system would recommend a user things liked by a certain number of their friends. In this problem you will implement part of such a system.
You are given user's friends' opinions about a list of items. You are also given a threshold *T* — the minimal number of "likes" necessary for an item to be recommended to the user.
Output the number of items in the list liked by at least *T* of user's friends.
Input Specification:
The first line of the input will contain three space-separated integers: the number of friends *F* (1<=≤<=*F*<=≤<=10), the number of items *I* (1<=≤<=*I*<=≤<=10) and the threshold *T* (1<=≤<=*T*<=≤<=*F*).
The following *F* lines of input contain user's friends' opinions. *j*-th character of *i*-th line is 'Y' if *i*-th friend likes *j*-th item, and 'N' otherwise.
Output Specification:
Output an integer — the number of items liked by at least *T* of user's friends.
Demo Input:
['3 3 2\nYYY\nNNN\nYNY\n', '4 4 1\nNNNY\nNNYN\nNYNN\nYNNN\n']
Demo Output:
['2\n', '4\n']
Note:
none | ```python
'kitten'
f,l,t=map(int,input().split())
s=[input() for _ in range(f)]
a=0
for j in range(l):
c=0
for i in range(f):
c+=s[i][j]=='Y';
a+=c>=t
print(a)
``` | 0 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.