ids
stringlengths
6
10
seqs
stringlengths
11
1.02k
texts
stringlengths
108
11.1k
Q969X2
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Function: Transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc onto glycoproteins and glycolipids, forming an alpha-2,6-linkage. Produces branched type disialyl structures by transfer of a sialyl group onto the GalNAc or GlcNAc residue inside backbone core chains having a terminal sialic acid with an alpha-2,3-linkage on Gal. ST6GalNAcVI prefers glycolipids to glycoproteins, predominantly catalyzing the biosynthesis of ganglioside GD1alpha from GM1b . Besides GMb1, MSGG and other glycolipids, it shows activity towards sialyl Lc4Cer generating disialyl Lc4Cer, which can lead to the synthesis of disialyl Lewis a (Le(a)), suggested to be a cancer-associated antigen . Also has activity toward GD1a and GT1b, and can generate DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) (By similarity). Catalytic Activity: CMP-N-acetyl-beta-neuraminate + ganglioside GM1b (d18:1(4E)) = a ganglioside GD1alpha (d18:1(4E)) + CMP + H(+) Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 38068 Sequence Length: 333 Subcellular Location: Golgi apparatus membrane EC: 2.4.99.-
Q92185
MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS
Function: Catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of the ganglioside GM3 to form ganglioside GD3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid . Can catalyze the addition of a second alpha-2,8-sialic acid to GD3 to form GT3 . Can use GM1b, GD1a and GT1b as acceptor substrates to synthesize GD1c, GT1a and GQ1b respectively . Can synthesize unusual tetra- and pentasialylated lactosylceramide derivatives identified as GQ3 (II3Neu5Ac4-Gg2Cer) and GP3 (II3Neu5Ac5-Gg2Cer) in breast cancer cells . Catalytic Activity: an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+) Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 40519 Sequence Length: 356 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.3.8
Q64687
MSPCGRALHTSRGAMAMLARKFPRTRLPVGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLAQRTAWRTNQTSASLFRRQMEDCCDPAHLFAMTKMNSPMGKSLWYDGELLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLKDVGANQTVLFANPNFLRNIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVNMQGDPISHHYYDNVLPFSGYHAMPEEFLQLWYLHKIGALRMQLDPCEEPSPQPTS
Function: Catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of the ganglioside GM3 to form ganglioside GD3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid . Can catalyze the addition of a second alpha-2,8- sialic acid to GD3 to form GT3 . Can use GM1b, GD1a and GT1b as acceptor substrates to synthesize GD1c, GT1a and GQ1b respectively . Catalytic Activity: an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+) Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 40324 Sequence Length: 355 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.3.8
Q6ZXA0
MWGRWRGAGGRRGVAQPVIPQMKLLGGRVPLGASALGLLIVCWFYIFPGGERLPGHKEMIRQVLQFGPRWGRNRSSGDSFRKLLQDCCDPPRLFSMTKANTALGENLWYDGEFFQSLTIDNTTRSLFPQDTPIKLPLKRCSVVGNGGILKNSRCGEQIDEADFVMRCNLPPLSREYTDDVGTKTQLVTVNPSIIDKRFQNLLWSRKSFVESVSVYKQSYVYMPAFSTKRGTDPSLRVYYTLEDFGTNQTVLFANPNFLRNVGKFWKSKGVHSKRLSTGLFMVSAALSLCEEVTIYGFWPFQMDLGGRHISHHYYDNMLPLSGVHAMPEEFLQLWHLHKSGVLQMQLDQCKKDVSSKKPH
Function: Catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of the ganglioside GM3 to form ganglioside GD3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid . Glycosphingolipids are required for convergence extension movements during early development . Can catalyze the addition of a second alpha-2,8- sialic acid to GD3 to form GT3 (By similarity). Can use GM1b, GD1a and GT1b as acceptor substrates to synthesize GD1c, GT1a and GQ1b respectively (By similarity). Catalytic Activity: an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+) Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 40811 Sequence Length: 359 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.3.8
Q6DNG6
MKLQGSRMWLCPRTRLPVGASALGFLILCWLYVFPGYRLPGHKEMVREVLRFGPGWRKNRTEMDSFRKLLQDCCDPPHLFSLTKVNTPLGENLWFDGEFFHSLTIDNSTRSLFPQDTPFKLPLKRCSVVGNGGILKNSRCGEQIDEADFVMRCNLPPLSREYTEDVGTRTQLVTVNPSIIDKRYQNLLWSRKSFVENLRVYQQSYVYMPAFSTKRGTDPSLRVYYTLADFGTNQTVLFANPNFLRNVGKFWKSRGIHSKRLSTGLFMVSAALSLCEEVTIYGFWPFQMDLGGRYISHHYYDNTLPLSGVHAMPEEFLQLWLLHKSGVLQMQLDQCKKDVSSQKPH
Function: Catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of the ganglioside GM3 to form ganglioside GD3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid (By similarity). Glycosphingolipids are required for convergence extension movements during early development (By similarity). Can catalyze the addition of a second alpha-2,8- sialic acid to GD3 to form GT3 (By similarity). Can use GM1b, GD1a and GT1b as acceptor substrates to synthesize GD1c, GT1a and GQ1b respectively (By similarity). Catalytic Activity: an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+) Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 39831 Sequence Length: 345 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.3.8
Q92186
MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT
Function: May transfer sialic acid through alpha-2,8-linkages to the alpha-2,3-linked and alpha-2,6-linked sialic acid of N-linked oligosaccharides of glycoproteins and may be involved in PSA (polysialic acid) expression. Location Topology: Single-pass type II membrane protein Sequence Mass (Da): 42430 Sequence Length: 375 Pathway: Protein modification; protein glycosylation. Subcellular Location: Golgi apparatus membrane EC: 2.4.99.-
Q91Y57
MLLLLLLLLLWGIKGVEGQNPQEVFTLNVERKVVVQEGLCVLVPCNFSYLKKRLTDWTDSDPVHGFWYREGTDRRKDSIVATNNPIRKAVKETRNRFFLLGDPWRNDCSLNIREIRKKDAGLYFFRLERGKTKYNYMWDKMTLVVTALTNTPQILLPETLEAGHPSNLTCSVPWDCGWTAPPIFSWTGTSVSFLSTNTTGSSVLTITPQPQDHGTNLTCQVTLPGTNVSTRMTIRLNVSYAPKNLTVTIYQGADSVSTILKNGSSLPISEGQSLRLICSTDSYPPANLSWSWDNLTLCPSKLSKPGLLELFPVHLKHGGVYTCQAQHALGSQHISLSLSPQSSATLSEMMMGTFVGSGVTALLFLSVCILLLAVRSYRRKPARPAVVAPHPDALKVSVSQNPLVESQADDSSEPLPSILEAAPSSTEEEIHYATLSFHEMKPMNLWGQQDTTTEYSEIKFPQRTAWP
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. PTM: Phosphorylation of Tyr-432 is required for binding to PTPN6 and PTPN11. Phosphorylation of Tyr-455 is involved in binding to PTPN6. Tyr-432 needs to be phosphorylated prior to Tyr-455. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 51901 Sequence Length: 467 Domain: Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Membrane
Q64JA4
MLPLLLPLLWAGALALEGIFQLEVPESVTVQEGLCVFVPCTFFYPRHTFIKISLACGYWFREGDNPLRDAPVATNDPARQVREETRGRFRLLGNPREKNCSLSIRDARRRDSGSYFFRVEEAMMKYNYKDPPLSVHVTALTHRPDILIPGALKSGRPRNLVCSVPWACEQGTPPIFSWIGTSVSPLSPTTALSSVVTLIPQPQDHGSRLTCQVTLPGAGVTTTRTVRLNVSYPPQNLTLTVFQGDGTASTTLRNESSLQVLEGQSLRLVCAVDSNPPARLSWAQDNLILSPSQPNPGMLELPQMHLRNEGEFTCQARNPLGSQQVSLRLFVQRKSGPMAEVVLVAIGEAAVKILLLFLCLIILRVKSHRRKAAKAATGVEAAKVVKG
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 42525 Sequence Length: 387 Subcellular Location: Membrane
Q08ET2
MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQVKRQGAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNPPASLSWFREGKALNPSQTSMSGTLELPNIGAREGGEFTCRVQHPLGSQHLSFILSVQRSSSSCICVTEKQQGSWPLVLTLIRGALMGAGFLLTYGLTWIYYTRCGGPQQSRAERPG
Function: Putative adhesion molecule. Sialic acid-binding paired receptor which may activate associated receptors. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 43970 Sequence Length: 396 Subcellular Location: Cell membrane
Q6ZMC9
MEKSIWLLACLAWVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTVALLLGALGFKALLLLGVLAARAARRRPEHLDTPDTPPRSQAQESNYENLSQMNPRSPPATMCSP
Function: Binds sialylated glycoproteins. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 35653 Sequence Length: 328 Subcellular Location: Membrane
A6NMB1
MLLLPLLLPVLGAGSLNKDPSYSLQVQRQVPVPEGLCVIVSCNLSYPRDGWDESTAAYGYWFKGRTSPKTGAPVATNNQSREVAMSTRDRFQLTGDPGKGSCSLVIRDAQREDEAWYFFRVERGSRVRHSFLSNAFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFKKCPAPSFSWTGAALSPRRTRPSTSHFSVLSFTPSPQDHDTDLTCHVDFSRKGVSAQRTVRLRVASLELQGNVIYLEVQKGQFLRLLCAADSQPPATLSWVLQDRVLSSSHPWGPRTLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLRNGTSLRVLEGQSLRLVCVTHSSPPARLSWTWGEQTVGPSQPSDPGVLQLPRVQMEHEGEFTCHARHPLGSQRVSLSFSVHCKSGPMTGVVLVAVGEVAMKILLLCLCLILLRVRSCRRKAARAALGMEAADAVTD
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 52992 Sequence Length: 481 Subcellular Location: Membrane
O15389
MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQMKRQGAQVTTERTVQLNVSYAPQTITIFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQSGSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLIVKARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds equally to alpha-2,3-linked and alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 60715 Sequence Length: 551 Domain: Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Membrane
Q920G3
MRWAWLLPLLWAGCLATDGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCSLDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIYAPQKMTIRVSWGDDTGTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWERPTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRSLLQLLGPSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFTVKSSSAGQWANSSLILSMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQAGKSETSRGTVLGAIWGAGLMALLAVCLCLIFFTVKVLRKKSALKVAATKGNHLAKNPASTINSASITSSNIALGYPIQGHLNEPGSQTQKEQPPLATVPDTQKDEPELHYASLSFQGPMPPKPQNTEAMKSVYTEIKIHKC
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 61476 Sequence Length: 569 Domain: Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Membrane
O43699
MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 49913 Sequence Length: 453 Domain: Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Cell membrane
Q9Y286
MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSGVLLGAVGGAGATALVFLSFCVIFIVVRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPRHHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- and alpha-2,6-linked sialic acid. Also binds disialogangliosides (disialogalactosyl globoside, disialyl lactotetraosylceramide and disialyl GalNAc lactotetraoslylceramide). The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Mediates inhibition of natural killer cells cytotoxicity. May play a role in hemopoiesis. Inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro). PTM: Tyrosine phosphorylated. Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 51143 Sequence Length: 467 Domain: Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Membrane
Q9NYZ4
MLLLLLLLPLLWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISWIGASVSSPGPTTARSSVLTLTPKPQDHGTSLTCQVTLPGTGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLRLVCAVNSNPPARLSWTRGSLTLCPSRSSNPGLLELPRVHVRDEGEFTCRAQNAQGSQHISLSLSLQNEGTGTSRPVSQVTLAAVGGAGATALAFLSFCIIFIIVRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNHNPSSKEVRG
Function: Putative adhesion molecule that mediates sialic-acid dependent binding to red blood cells . Preferentially binds to alpha-2,3-linked sialic acid. Also binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface . Recognizes simultaneously epitopes having a terminal N-acetylneuraminic acid (sialic acid) and an underlying 6-O-sulfated galactose. Preferentially binds to Gal-6-sulfated sialyl-Lewis X glycan epitopes . Location Topology: Single-pass type I membrane protein Sequence Mass (Da): 54042 Sequence Length: 499 Domain: Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Subcellular Location: Membrane
P03528
MDPRLREEVVRLIIALTSDNGASLSKGLESRVSALEKTSQIHSDTILRITQGLDDANKRIIALEQSRDDLVASVSDAQLAISRLESSIGALQTVVNGLDSSVTQLGARVGQLETGLAELRVDHDNLVARVDTAERNIGSLTTELSTLTLRVTSIQADFESRISTLERTAVTSAGAPLSIRNNRMTMGLNDGLTLSGNNLAIRLPGNTGLNIQNGGLQFRFNTDQFQIVNNNLTLKTTVFDSINSRIGATEQSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT
Function: Fiber-like molecule that attaches the virion to the host cell membrane by binding to the primary receptor F11R/JAM-A and to sialic acid containing proteins (coreceptor). The interaction of sigma-1 with F11R is required for NF-kB activation and apoptosis. Binding to both sialic acid and F11R is required to induce maximal levels of apoptosis. PTM: Undergoes dramatic conformational rearrangements during viral disassembly in the endocytic pathway. Sequence Mass (Da): 49095 Sequence Length: 455 Subcellular Location: Virion
P04507
MSDLVQLIRREILLLTGNGESANSKHEIEEIKKQIKDISADVNRISNIVDSIQGQLGGLSVRVSAIESGVSENGNRIDRLERDVSGISASVSGIDSRLSELGDRVNVAEQRIGQLDTVTDNLLERASRLETEVSAITNDLGSLNTRVTTELNDVRQTIAAIDTRLTTLETDAVTSVGQGLQKTGNSIKVIVGTGMWFDRNNVLQLFLSNQQKGLGFIDNGMVVKIDTQYFSFDSNGNITLNNNISGLPARTGSLEASRIDVVAPPLVIQSTGSTRLLRLMYEAVDFVVTNNVLTLRNRSVTPTFKFPLELNSADNSVSIHRNYRIRLGQWSGQLEYHTPSLRWNAPVTVNLMRVDDWLILSFTRFSTSGILASGKFVLNFVTGLSPGWATGSTEPSTTTNPLSTTFAAIQFINGSSRVDAFRILGVAEWNAGELEITNHGGTYTAHTNVDWAPMTIMYPCLG
Function: Fiber-like molecule that attaches the virion to the host cell membrane by binding to the primary receptor F11R/JAM-A and to sialic acid containing proteins (coreceptor). The interaction of sigma-1 with F11R is required for NF-kB activation and apoptosis. Binding to both sialic acid and F11R is required to induce maximal levels of apoptosis (By similarity). PTM: Undergoes dramatic conformational rearrangements during viral disassembly in the endocytic pathway. Sequence Mass (Da): 50466 Sequence Length: 462 Subcellular Location: Virion
P04506
MDASLITEIRKIVLQLSVSSNGSQSKEIEEIKKQVQVNVDDIRAANIKLDGLGRQIADISNSISTIESRLGEMDNRLVGISSQVTQLSNSVSQNTQSISSLGDRINAVEPRVDSLDTVTSNLTGRTSTLEADVGSLRTELAALTTRVTTEVTRLDGLINSGQNSIGELSTRLSNVETSMVTTAGRGLQKNGNTLNVIVGNGMWFNSSNQLQLDLSGQSKGVGFVGTGMVVKIDTNYFAYNSNGEITLVSQINELPSRVSTLESAKIDSVLPPLTVREASGVRTLSFGYDTSDFTIINSVLSLRSRLTLPTYRYPLELDTANNRVQVADRFGMRTGTWTGQLQYQHPQLSWRANVTLNLMKVDDWLVLSFSQMTTNSIMADGKFVINFVSGLSSGWQTGDTEPSSTIDPLSTTFAAVQFLNNGQRIDAFRIMGVSEWTDGELEIKNYGGTYTGHTQVYWAPWTIMYPCNVR
Function: Fiber-like molecule that attaches the virion to the host cell membrane by binding to the primary receptor F11R/JAM-A and to sialic acid containing proteins (coreceptor). The interaction of sigma-1 with F11R is required for NF-kB activation and apoptosis. Binding to both sialic acid and F11R is required to induce maximal levels of apoptosis (By similarity). PTM: Undergoes dramatic conformational rearrangements during viral disassembly in the endocytic pathway. Sequence Mass (Da): 51404 Sequence Length: 470 Subcellular Location: Virion
Q8L607
MVMMLKKTVKKGLIGGMSFAKDAGKINWFPGHMAAATRAIRNRLKLSDLVIEVRDARIPLSSANEDLQSQMSAKRRIIALNKKDLANPNVLNKWTRHFESSKQDCIAINAHSRSSVMKLLDLVELKLKEVIAREPTLLVMVVGVPNVGKSALINSIHQIAAARFPVQERLKRATVGPLPGVTQDIAGFKIAHRPSIYVLDSPGVLVPSIPDIETGLKLALSGSVKDSVVGEERIAQYFLAILNIRGTPLHWKYLVEGINEGPHADCIDKPSYNLKDLRHQRTKQPDSSALHYVGDMISEVQRSLYITLSEFDGDTEDENDLECLIEQQFEVLQKALKIPHKASEARLMVSKKFLTLFRTGRLGPFILDDVPETETDHPNSKRVVVL
Function: GTPase that may function in mitochondrial ribosome assembly (Probable). Involved in a variety of growth processes during vegetative development and promotes growth and cell division in the developing integuments . Sequence Mass (Da): 42984 Sequence Length: 386 Domain: In contrast to other GTP-binding proteins, this family is characterized by a circular permutation of the GTPase motifs described by a G4-G1-G3 pattern. Subcellular Location: Mitochondrion
P93748
MAPGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYPPIHQCPNGHTLCSSCKLRVQNTCPTCRYELGNIRCLALEKVAESLEVPCRYQNLGCQDIFPYYSKLKHEQHCRFRSYSCPYAGSECSVTGDIPTLVDHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGMAPVYMAFLRFMGDENEAKKFSYSLEVGAHSRKLTWQGIPRSIRDSHRKVRDSQDGLIIPRNLALYFSGSDKEELKLRVTGRIWKEE
Function: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins . E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates . It probably triggers the ubiquitin-mediated degradation of different substrates . Mediates the proteasomal-dependent degradation of ATG6, a component of the autophagosome complex . Requires TRAF1A/MUSE14 and TRAF1B/MUSE13 to target ATG6 for ubiquitination and subsequent regulation of autophagosome assembly . Modulates directly the ubiquitination and proteasomal-dependent degradation of FREE1, a component of the ESCRT-I complex . Modulates directly the ubiquitination and proteasomal-dependent degradation of ELC/VPS23A, a component of the ESCRT-I complex . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 34557 Sequence Length: 305 Domain: The RING-type zinc finger domain is essential for ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Endosome EC: 2.3.2.27
Q9M2P4
MAPGGSALKEVMESNSTGMDYEVKTAKVEVNNNKPTKPGSAGIGKYGIHSNNGVYELLECPVCTNLMYPPIHQCPNGHTLCSNCKLRVQNTCPTCRYELGNIRCLALEKVAESLEVPCRYQNLGCHDIFPYYSKLKHEQHCRFRPYTCPYAGSECSVTGDIPTLVVHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGMAPVYMAFLRFMGDENEAKKFSYSLEVGAHGRKLTWQGIPRSIRDSHRKVRDSQDGLIIPRNLALYFSGGDRQELKLRVTGRIWKEE
Function: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins . E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates . It probably triggers the ubiquitin-mediated degradation of different substrates . Mediates the proteasomal-dependent degradation of ATG6, a component of the autophagosome complex . Requires TRAF1A/MUSE14 and TRAF1B/MUSE13 to target ATG6 for ubiquitination and subsequent regulation of autophagosome assembly . Modulates directly the ubiquitination and proteasomal-dependent degradation of FREE1, a component of the ESCRT-I complex . Modulates directly the ubiquitination and proteasomal-dependent degradation of ELC/VPS23A, a component of the ESCRT-I complex . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 34993 Sequence Length: 308 Domain: The RING-type zinc finger domain is essential for ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Endosome EC: 2.3.2.27
Q9STN8
METDSMECVSSTGNEIHQNGNGHQSYQFSSTKTHGGAAAAAVVTNIVGPTATAPATSVYELLECPVCTYSMYPPIHQCHNGHTLCSTCKVRVHNRCPTCRQELGDIRCLALEKVAESLELPCKFYNLGCPEIFPYYSKLKHESLCNFRPYSCPYAGSECGIVGDIPFLVAHLRDDHKVDMHAGSTFNHRYVKSNPREVENATWMLTVFHCFGQYFCLHFEAFQLGMGPVYMAFLRFMGDEEDARSYSYSLEVGGSGRKLTWEGTPRSIRDSHRKVRDSNDGLIIQRNMALFFSGGDRKELKLRVTGKIWKEQHSPDSGLSIPNLSSS
Function: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins . E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates . It probably triggers the ubiquitin-mediated degradation of different substrates . Modulates directly the ubiquitination and proteasomal-dependent degradation of FREE1, a component of the ESCRT-I complex . Modulates directly the ubiquitination and proteasomal-dependent degradation of ELC/VPS23A, a component of the ESCRT-I complex . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 36574 Sequence Length: 327 Domain: The RING-type zinc finger domain is essential for ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Endosome EC: 2.3.2.27
Q8S3N1
METDSIDSVIDDDEIHQKHQFSSTKSQGGATVVISPATSVYELLECPVCTNSMYPPIHQCHNGHTLCSTCKSRVHNRCPTCRQELGDIRCLALEKVAESLELPCKYYNLGCLGIFPYYSKLKHESQCNFRPYSCPYAGSECAAVGDITFLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTVFQCFGQYFCLHFEAFQLGMAPVYMAFLRFMGDEDDARNYTYSLEVGGSGRKQTWEGTPRSVRDSHRKVRDSHDGLIIQRNMALFFSGGDKKELKLRVTGRIWKEQQNPDSGVCITSMCSS
Function: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins . E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates . Mediates the ubiquitination and proteasomal-dependent degradation of NAC021/NAC022, a transcription activator that functions downstream of the auxin signals, thereby acting as a down-regulator of auxin signals . Involved in the formation of lateral roots . Is antagonist to SINAT1, SINAT2, SINAT3 and SINAT4 by suppressing FREE1 ubiquitination and degradation mediated by SINAT1, SINAT2, SINAT3 and SINAT4, and promoting FREE1 accumulation . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 35037 Sequence Length: 309 Domain: The RING-type zinc finger domain is essential for ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Nucleus EC: 2.3.2.27
Q8T3Y0
MSVRNSRPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPSRRKDSVAVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENFSSFTNADFLVLNKHTVELFSEDGNLALNVVIRKVEERTN
Function: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. The adapter phyl is required to direct the degradation of the two isoforms of the transcriptional repressor Tramtrack (Ttk). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates. A phyl-independent mechanism of degradation exists for isoform beta of ttk that involves motifs in the C-terminus of ttk. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 39645 Sequence Length: 351 Domain: The RING-type zinc finger domain is essential for ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. EC: 2.3.2.27
P21461
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV
Function: E3 ubiquitin-protein ligase that is required for specification of R7 photoreceptor cell fate in the eye by mediating the ubiquitination and subsequent proteasomal degradation of Tramtrack (ttk) . E3 Ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates . Acts via the formation of a complex with ebi and phyl that ubiquitinates the transcription repressor ttk, a general inhibitor of photoreceptor differentiation, in a subset of photoreceptor cells in the eye, leading to the differentiation of cells into neurons . Also involved in external sensory organ development . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 33707 Sequence Length: 314 Domain: The RING-type zinc finger domain is essential for ubiquitin ligase activity. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Cytoplasm EC: 2.3.2.27
Q62231
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQSNMGHARSSNYSLPGLTASQPSHGLQAHQHQLQDSLLGPLTSSLVDLGS
Function: Transcription factor that is involved in the regulation of cell proliferation, apoptosis and embryonic development . Plays an important role in the development of several organs, including kidney, muscle and inner ear . Depending on context, functions as transcriptional repressor or activator . Lacks an activation domain, and requires interaction with EYA family members for transcription activation (By similarity). Mediates nuclear translocation of EYA1 and EYA2 (By similarity). Binds the 5'-TCA[AG][AG]TTNC-3' motif present in the MEF3 element in the MYOG promoter and CIDEA enhancer (By similarity). Regulates the expression of numerous genes, including MYC, CCNA1, CCND1 and EZR . Acts as activator of the IGFBP5 promoter, probably coactivated by EYA2 . Repression of precursor cell proliferation in myoblasts is switched to activation through recruitment of EYA3 to the SIX1-DACH1 complex . During myogenesis, seems to act together with EYA2 and DACH2. Regulates the expression of CCNA1 (By similarity). Promotes brown adipocyte differentiation . PTM: Phosphorylated during interphase; becomes hyperphosphorylated during mitosis. Hyperphosphorylation impairs binding to promoter elements (By similarity). Sequence Mass (Da): 32210 Sequence Length: 284 Subcellular Location: Nucleus
Q26292
MKLLLLLIVSASMLIESLVNADGYIKRRDGCKVACLIGNEGCDKECKAYGGSYGYCWTWGLACWCEGLPDDKTWKSETNTCGGKK
Function: Depressant insect beta-toxins cause a transient contraction paralysis followed by a slow flaccid paralysis. They bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on insects. Sequence Mass (Da): 9334 Sequence Length: 85 Domain: Has the structural arrangement of an alpha-helix connected to antiparallel beta-sheets by disulfide bonds (CS-alpha/beta). Subcellular Location: Secreted
Q5NTH4
MEAGVGLALQSRAAGFGGSDRRRSALYGGEGRARIGSLRVAEPAVAKAAVWARGSKPVAPLRAKKSSGGHETLHNSVDEALLLKRKSEEVLFYLNGRCIYLVGMMGSGKSTVGKIMSEVLGYSFFDSDKLVEQAVGMPSVAQIFKVHSEAFFRDNESSVLRDLSSMKRLVVATGGGAVIRPVNWKYMKKGLSVWLDVPLDALARRIAKVGTASRPLLDQPSGDPYTMAFSKLSMLAEQRGDAYANADVRVSLEEIASKQGHDDVSKLTPTDIAIESFHKIENFVIEHTVDNPVGDSQADSRAQRIQTL
Cofactor: Binds 1 Mg(2+) ion per subunit. Function: Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate. Catalytic Activity: ATP + shikimate = 3-phosphoshikimate + ADP + H(+) Sequence Mass (Da): 33310 Sequence Length: 308 Pathway: Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 5/7. Subcellular Location: Plastid EC: 2.7.1.71
O31423
MSYDRVKDFDLPELAVHLQPHGAVMIDRKSMFYFRLSGRGAQLAFLLSKNKNLHKTARIWEIMKKEEMSADQLKEELSAHPFTEAWTEGLLDQPLHVSGSLDSYLPISCTLQLTNACNLSCSFCYASSGKPYPEELSSEQWILVMQKLAAHGVADITLTGGEAKLIKGFKELVVVASSLFTNVNVFSNGLNWRDEEVELLSHLGNVSVQISIDGMDNTHDQLRGRKGGFKESMNTIKKLSEANIPVIVAMTINESNADEVSDVVEQCANAGAFIFRAGKTLSVGRATEGFKALDIDFEEMVQIQLREARHKWGDRLNIIDWEHEESSFTTDFCTPGYLAWYIRADGYVTPCQLEDLPLGHILEDSMADIGSPARLLQLKCEAKNCKCIGKIELSEPDLPFQKEVKAGIQE
Cofactor: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine . The other is coordinated via 3 cysteines and maybe direct contact with the SkfA precursor (Probable). Function: Catalyzes the formation of the thioether bond required for production of the sporulation killing factor (SKF) from SkfA . Forms the cysteine-methionine thioether bond found in SKF; the acceptor amino acid can be hydrophobic, aromatic or a small hydrophilic amino acid but not a larger hydrophilic amino acid, i.e. Met=Ala, Phe, Leu, Tyr>Asn, Ser>>Gln, Glu, Lys . The relative position of Cys and Met in the substrate cannot be inverted, in vitro the thioether bond cannot be made in the absence of the SkfA propeptide, suggesting this is the first reaction in SKF maturation . In vitro, in the absence of a second substrate, cleaves S-adenosyl-L-methionine into Met and 5'-dA . Sequence Mass (Da): 45755 Sequence Length: 410 Subcellular Location: Cytoplasm EC: 1.21.98.-
O31425
MNSLSLVFWSILAVVGLLLFIKFKPPTIASLLLSKDEAKEISIQFIKEFVGIDVENWDFYSVYWYDHDTVNKLHHLGILKKNRKVLYDVGLVESWRVRFVHQNQSFVVGVNANREITFFYADVPKKTLSGKFEQVSPETLKQRLMASPDGLWSRANMTGTGKKEEDFREVSTYWYIAEAGDIRLKVTVELQGGRISYIGTEQEILTDQMSKVIRDEQVESTFGVSGMLGSALAMILAILILVFMDVQTSIIFSLVLGLLIIICQSLTLKEDIQLTIVNAYDARMSVKTVSLLGILSTLLTGLLTGFVVFICSLAGNALAGDFGWKTFEQPIVQIFYGIGAGLISLGVTSLLFNLLEKKQYLRISPELSNRTVFLSGFTFRQGLNMSIQSSIGEEVIYRLLMIPVIWWMSGNILISIIVSSFLWAVMHQVTGYDPRWIRWLHLFIFGCFLGVLFIKFGFICVLVAHFIHNLVLVCMPLWQFKLQKHMHHDQPKHTSL
Function: Required for production of the bacteriocin SkfA. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 56292 Sequence Length: 496 Subcellular Location: Membrane
O31427
MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTTIRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHPGKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGLDIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQAEWRKEVIRLLGEWSDE
Function: Probably part of the ABC transporter SkfEF involved in the export of the bacteriocin SKF. Probably responsible for energy coupling to the transport system. Catalytic Activity: ATP + H2O + sulfate(out) = ADP + H(+) + phosphate + sulfate(in) Location Topology: Peripheral membrane protein Sequence Mass (Da): 26894 Sequence Length: 239 Subcellular Location: Cell membrane EC: 7.3.2.3
O31428
MPFLIMLLFVGAIGFQVSFVSRSTTWDMSIAGWVLTGVFILYTAFGLFSNRLPSQMADIIWLYGTATSFSKVVYSVLFFSVTWKALLWIISAIFGDVLIVLLSGDHINLLGRSIIFVGLFFIAEVWLMSVSCARTVKKMKRVYVLVFLLMLGIYSICLYRFFFLQHSSGIWESIARFISGVGLVFDTLSPLYVVVFIGIITVSFMTIAFTSRQVEMKESLVKEAEFWEEFQERQFGSGQIIQKPKTTWWGLQGLNGIWSFLWLELLLFKKYLFFHSIHTVMLSGVFYVVIFMYPEWFYLLFFLIVSAVMLSSYYSGIVRHSQSGTLHLFPGALWKKIIILELTNTVWLYILYCVSITFMAVGNLVYWYIYGLGIYIWFMTIRLFAFTHTNRNDIKLSLPQYYKSFFMALGLSGICLYVIHLLTADWYTLVVVVCIGSLSWCLFYRFR
Function: Probably part of the ABC transporter SkfEF involved in the export of the bacteriocin SKF. Probably responsible for the translocation of bacteriocin SkfA across the membrane. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51817 Sequence Length: 447 Subcellular Location: Cell membrane
Q753L2
MAVDTTTVAVALAVVLPVSIAVLIALVFWCKTQRRFKREEQDDEKNRGYDDEVVTFREMRASSGTLGPDGTPPTACAEGSGSSEGSESEKDPSPTPAPAGRAARTYMPAYRRRLNRSLSRQQSRADEMTTNSSAASYDTQHAQNAQLSVFEQMVPVLQVDNSSPFANPRDAAFERGSRHSSESLMKSLKNQDFGSYPKRRPSAANTANLAVYNGSVSSFSSRVPSSTTLNCMGDESFYAYEGSVLPRTGRDLPEVKQDVYMLKNNYDVTNNEEITEEDQYENEFTNYSENKREFIDSLRPKAERMSN
Function: Plays a role in cell wall integrity. Affects the cell wall polymer composition in the growing region of the cell (By similarity). Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 34105 Sequence Length: 307 Subcellular Location: Cell membrane
Q6FLL2
MTGTVSTAVGCAVGIPVGVGVIVACLFWIRMQRRLKEEDIIDQELNRAVYDESGFVSFNNIDTLKAEPNGHPSSEDTNEVMHSSDIDDNGDDDDEDHNARRNNTYAAQDKNNGKYVPAYRRQINKHNSILQQQRKSRNLVNTMGHSIESLSMDDHSQANGKSRQVSVYDQMVPVLDDANRDSSSPFPTNDKDTSDKKSNLFQSHDVSANTSTSFFETRSNDNLIKNLNSHDFGSYYPRRPSTSNLNHSQGSLHTRNSSMLSLGKIENAENVFATPKSENILKHPHPLEHESSSISNETNNVTDNTIDGESASKSSKTYQLKNNYDIQNTSEIAEEDQYENEFTNYSENKRAYIDGLRPKM
Function: Plays a role in cell wall integrity. Affects the cell wall polymer composition in the growing region of the cell (By similarity). Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 40439 Sequence Length: 360 Subcellular Location: Cell membrane
C5DH21
MTDGLGVSVGCAVGIPCGVAVLVAVIFWYYMQRKFKKEIEDDEESMSGDGTISFTNLHSMRVPDNPEKDLPVSHVVGGSTSSDNTTTAQNVATAGQMEAQQSQPSKKPKNTYMPAYRKRLNSSLSTLQHQDEQRSPTDSSSTSLDTKNQNGRAHSTVLDQMIPVLAQDDNAAAASSEFSLTHERTSSNDNLIKNLHNHDFGSYPKRRSSGNLTGMISGNVSSASVHTRTSSVHSGKKNNENVFDTPNSQKFHEAVAPSEEDAESKGMRSYYMLKNNYDVENASQIAEEDQYENEFTNYSESKREFINSLRPKKN
Function: Plays a role in cell wall integrity. Affects the cell wall polymer composition in the growing region of the cell (By similarity). Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 34636 Sequence Length: 314 Subcellular Location: Cell membrane
A7TSZ6
MVASNSVAVGCAVGIPVGVGLIIAGCFWLRLQRRFKREDEQDADLQRAVFDEDAYINFESMPTLRNNNNNDEDNNDDKRIKKIEENGNENTIPINDNKEQRKSKYFVPAYRRKINALSVRYDGQQNIEMQGFGANSSKVSLDSSNAPPKRVISVYDQMVPFVDGDKNSVIQNTELLESNDSVGNDSTRPSSQANLISNLNSNDFGSYYPRKESFSSINIPHLNTSSPSFTTRPSSVNSMIRPNSTDNIFDTPRKSNSDIVSINKDQVNRTGSPVKGTVISENMGYKLKNNYNIENSNEIAEEDQYENEFTNYSQNKKEFIDSLRPK
Function: Plays a role in cell wall integrity. Affects the cell wall polymer composition in the growing region of the cell (By similarity). Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 36744 Sequence Length: 326 Subcellular Location: Cell membrane
B3LRH5
MTASTSVAVGCAVGIPVGVGIIIAVCFWFNLQKRYKREEQDDRELERAIYDESGFVSFDNFGPLRDSKDEAALASSELKNPDHTSGSSEGSAHPEEKDGKSRDQEKPLGKKNSKYYVPAYRRKINLLQVRNNNYGNNARQKSVVDLPSINNSSNVSLSSSQRHITKRQISVYDQMVPVISDEGPKFFADPSSDTNTSNDQNKASMIELKHNTRQSSNENLIRKLQNQDFGSYYPRRASSSFLNGNISNASFHTRNSSITSVNKRDALEDVFATPKSAAQSQLPNTFDKDNEGIDADHSVKDSRSAITDKDKNIYKLQNNYDVGNIGEIAEEDQYENEFTNYSQSKREFIESLRPK
Function: Plays a role in cell wall integrity. Affects the cell wall polymer composition in the growing region of the cell (By similarity). Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 39839 Sequence Length: 355 Subcellular Location: Cell membrane
C5DSG3
MGDVSIAVGCAVGLPVGLSFLLAIVFWIRMQRRYKKEDARDCELENIIRDESGFISFDNLGTWQETQQEKKDVYVNDESVESSGIQGSSSSEQLQQPNETHQNKHQSKHYMPAYRRNLNAYRIRQLPTGINVDNNGSNLSLDSTQNMRKRPNLHQETVYDQMIPVLANTEPKLFSEDNNEQDTAATIQQNQQNNEKVIMKNLRNNDFGSYPRGTQSATSLSRSNSNSNTNTNTNVSRSSLHTRSSSVMSAVKGTTSYDNVFDTPKSATAASLVDVKVSNNNNNNNKQPVYSLKNNYDIKNTSEIQEEDQYENEFTNYSESKRTFIDSLRPKPGI
Function: Plays a role in cell wall integrity. Affects the cell wall polymer composition in the growing region of the cell (By similarity). Location Topology: Single-pass type III membrane protein Sequence Mass (Da): 37761 Sequence Length: 334 Subcellular Location: Cell membrane
P32900
MYHTHMHESLISVTSTVSVSDASYAYARLTRRDDSDSSSSSASSTKNSKSAECTGSKQQCQLPTDSSHSTSVTVGVAVAVPVGVIIIVLAVILCIVYRRSKKEAEEDNDPDFEGDSEFLPTMKDYSPGINHLYSSDSQQDFMEKTLQQPPSDPFVGSMHSSKYNVRSATPPAIGRSWYVDPFQLPQESNDSNSLRDFAMRVQEDGLGGYKVAAESRNASQTSLHPDNFSNCTPIRASSRFQESESFRSHGSPIHNNQLSRGSATEGANKQFTFPNEDNDSSSVSEEAEVLNESNESASNDAFEFELDNSSEKTHERNLRFGKDDDNYELQDIREAEHMNDRSSSKSQDDDYYVSLLSPNEEEDIKRMKSIYQVYLDRAKTMKKEEDKADNANDISQEENRVDNIVQNPLPSIKINNNDNIDNNEVPEAKHLVKEALPLNNTNLAEYGPEMAQSQKQYPVQDTLTVNDTEAAPSNRIASSIYSEAIQPLNYQDQYQQQEQSPVYNGHTQYPGNGYSGNPQQQGYTAQFVQNPQWYGVPTPQQQQHNHPQTLETIGELPTPAYLAQSASSHSLTSFKRPNKQQLLQLQTARLNGTALNPVDHPEMFYSPTNDAYYAPQQQGQYMKFNENGAVPSPYQLRQSVVMTNPSDLTAKPSYKPAGSFRSVSATNSRNNSLTTQNNIYLQQQQQQLYNSRVSGILEETDVVQPPSVGGILPHSGSQDDLRKQLGSSHNYTVN
Function: May be involved in the polarity establishment process. Suppresses the lethality of KEX2-GAS1 double null mutant when overexpressed. PTM: Phosphorylated by CDC28. Location Topology: Single-pass membrane protein Sequence Mass (Da): 81849 Sequence Length: 734 Subcellular Location: Membrane
J9VSG5
MATTNAQIYQQSQMPIPMPTPSLNPNINSAPTPGPNAMSVYEDCQSPLDTSVSGMYPGDRGSRVVSQPAPLLDQSHLRPGNQANLLSHDRTIELYRENAKKTNDPELIFEFSAFMIDAAKAMIPPEQEKDTNPSPALIKQMEKREEIIKEATSLLKRLADRGFPDAQYFLADCYANGIGTARGKQDFDRAFPLFILAAKHGHPDACYRAGTCCEHGWGCRRDSAKAVSFYKKAAVGLHPGAMYRLGTAELNGALGFPRRPKEGVKWLKRSAEHATEEFPHALHELALLHERGIENVVFVDNDYAAELLAQSAELGYAPSAFKLGECYEYGKMGCPVDPALSIHYYNISAQQDHKDACFALTAWYLVGSPGVLPQSDTEAYLWAKKAAELGLAKAQYAVGYFTETGIGIEANPQAALTWYKQAAEGGDKRAAKRLATGSRSSALDRRLEMEALKEEKRLGAANLAQRSGSGSGASGKDGKDGCLIM
Function: Activator of the chitin synthase CHS3 which polymerizes chitin, a structural polymer of the fungal cell wall . Chitin produced by CHS3 is deacetylated to chitosan, which helps to maintain cell wall integrity, anchor melanin, and offers an advantage during infection, as chitosan is less readily detected by host immunosurveillance . Location Topology: Lipid-anchor Sequence Mass (Da): 52855 Sequence Length: 485 Subcellular Location: Cell membrane
P34226
MASSPQVHPYKKHLMQSQHINFDNRGLQFQNSSLKVGQDFSDNKENRENRDNEDFSTADLPKRSANQPLINEHLRAASVPLLSNDIGNSQEEDFVPVPPPQLHLNNSNNTSLSSLGSTPTNSPSPGALRQTNSSTSLTKEQIKKRTRSVDLSHMYLLNGSSDTQLTATNESVADLSHQMISRYLGGKNNTSLVPRLKTIEMYRQNVKKSKDPEVLFQYAQYMLQTALTIESSNALVQDSDKEGNVSQSDLKLQFLKEAQSYLKKLSIKGYSDAQYLLADGYSSGAFGKIENKEAFVLFQAAAKHGHIESAYRASHCLEEGLGTTRDSRKSVNFLKFAASRNHPSAMYKLGLYSFYGRMGLPTDVNTKLNGVKWLSRAAARANELTAAAPYELAKIYHEGFLDVVIPDEKYAMELYIQAASLGHVPSATLLAQIYETGNDTVGQDTSLSVHYYTQAALKGDSVAMLGLCAWYLLGAEPAFEKDENEAFQWALRAANAGLPKAQFTLGYFYEHGKGCDRNMEYAWKWYEKAAGNEDKRAINKLRSRDGGLASIGKKQHKKNKSISTLNLFSTVDSQTSNVGSNSRVSSKSETFFTGNPKRDREPQGLQINMNSNTNRNGIKTGSDTSIRKSSSSAKGMSREVAEQSMAAKQEVSLSNMGSSNMIRKDFPAVKTESKKPTSLKNKKDKQGKKKKDCVIM
Function: Activator of the chitin synthase CHS3 which polymerizes chitin, a structural polymer of the fungal cell wall. PTM: Farnesylation is required for chitin synthase CHS3 activity but is not required for SKT5 membrane association. Location Topology: Lipid-anchor Sequence Mass (Da): 77066 Sequence Length: 696 Subcellular Location: Cell membrane
Q9SU40
MDLFKILLLVFFVNISFCFAADPYSFYNFEVSYITASPLGVPQQVIAINGKFPGPTINVTTNENLVVNVRNKLDEGLLLHWNGIQQRRVSWQDGVLGTNCPIPPKWNWTYEFQVKDQIGSFFYFPSLHFQRASGGFGSFVVNPRAIIPVPFSTPDGDITVTIGDWYIRNHTALRKALDDGKDLGMPDGVLINGKGPYRYNDTLVADGIDFETITVHPGKTYRLRVSNVGISTSLNFRIQGHNLVLAESEGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARVVNETIWRRVTGVGILKYTNSKGKAKGQLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVYVLRNMPPVTISGKRRTTLNGISFKNPSTPIRLADKLKVKDVYKLDFPKRPLTGPAKVATSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARSTIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVLYCGALSKLQKPQKVSSSASKSIGFTSLSMVVMALVMMMMLQH
Function: May be a monocopper oxidase of unknown specificity. Involved in directional growth processes, possibly by participating in cell wall expansion. Location Topology: Lipid-anchor Sequence Mass (Da): 65638 Sequence Length: 587 Subcellular Location: Secreted
Q03656
MGSSINYPGFVTKSAHLADTSTDASISCEEATSSQEAKKNFFQRDYNMMKKAPAPTKSKLSLALQTSKSSSSANGTVQEDTSSKTEDFSTKSIKKKPDSGVESHVSIQSDSGPQSDSDLDSDSSISSCDERNEESLKDYRPGGYHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIGDVEGIVQMVEALDKQKREAKRLQRHVSRSSDITANDSSDEKWAECQTSMPCGSSSNSKSRSIEKDLSKRCFRRPRRHTIITGSQPLPSPISSSNFFEMRAHFCGSSHNSFSSVSGNRNIPSSINNNSINNGIGIKNSNNSFLNSVPHSVTRMFINEDSNDNNNNDNSKNKNNNNNNSNNNNNEDIMNTPLHEEQLADSLSTFDISNISQSSDTNGPYISNTMDSNSNVSTDINSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADIWSTACLIFELITGDFLFEPDEGHSYTKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSRGLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWLKDTLGMEEIRVPDRELYGSGSDIPGWFEEVRDHKRH
Function: Constitutively active kinase, specifically and sequentially phosphorylates serine/arginine (SR)-type shuttling mRNA binding proteins in their RS dipeptide repeats. Catalytic Activity: ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein] Sequence Mass (Da): 83238 Sequence Length: 742 EC: 2.7.11.1
Q9VIH7
MPYHRGGDASSQADKLSGIVEESDLYEGFAPHVETSEIKTLDFYNLPKQTGKEPALRSYTEIQQLLQQGKKRDVKNILRENSWPINSPIRAQLWPMLCGQHQTKQQMLDGFYWEMVHQVFGTTELSEKPIMLPAFVDATHCLPYHLTSTGRAVADRIVNVLGYDCPDITYSPVLYPITSILLHFMSEEEAYICLAGLVGSKEKVFINQTKLQHEVTWKTVMQIAKKHTKSATSYFQRICPGLKLERIFMDWCWWILAGLPFQHLVRIMDCYFHEGIKVLYRVALVILNLFHKECQSNNEWSPDNIKNDIGNALIKFCKKIPVSPAKLLHAAFSIRGLSTQYISRIFIKTEMLLKSRSVLTSGSKQLIKSRSSDNLPTSQSQVNIQMMSHTLTIREHFGLPGTKNFIKTWTDRQFLFTLWSWLPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQHEPTLLMIKTCNNEVFGAYCSSRWFERNVKDDKGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGHSSELFMAADSKMITIGGGEGQAIWMDENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVYGFVGI
Function: GTPase-activating protein (GAP) for Rab35 which regulates synaptic vesicle (SV) protein recycling and turnover at the neuromuscular junction boutons and possibly ventral nerve cord via endosomal trafficking . Inhibits Rab35-mediated endosomal sorting which traffics old or dysfunctional SV proteins through a degradative endolysosomal route that involves the ESCRT pathway and the HOPS complex members dor, vps39 and rab7 . This function is essential for preventing excessive degradation and turnover of vesicles from the readily releasable pool which leads to increased neurotransmission and eventually neurodegeneration . Preferentially binds phosphoinositides phosphorylated at the D5 position of the inositol ring, such as phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3) . Binding to phosphoinositides and thus membrane-association, is required for its function in regulating the turnover of synaptic-vesicle proteins . It is therefore likely that it is recruited to vesicle membranes with high phosphoinositide content and thereby selectively prevents endolysosomal degradation of these vesicles . Location Topology: Peripheral membrane protein Sequence Mass (Da): 67328 Sequence Length: 587 Domain: The Rab-GAP TBC domain is essential for phosphoinositide binding. Subcellular Location: Cytoplasmic vesicle
Q00497
MEARVSQSLQLSSWINSDKVVRKPSGLLRFSEKWNEKPRHRVVVSCHLQPRKAAHSDRRVQLKVSCSPQNVQASVLESGCFSASIDEIETLKNKAEEVEEYLDGRCVYLVGMMGCGKTTVGRILAETLGYSFFDCDRLIEQAVGGITVAEIFELRGESFFRDNETEVLHKLSLMHRLVVSTGGGAVVRPINWRHMHKGISVWLDVPLEALAKRITTEGTKSRPLLHEESGDVYDTTLKRLTTLMETRGENYANASARVSLENIALKREKDVCHITPAEITLEVLIQIENFLKTQKSVVVL
Cofactor: Binds 1 Mg(2+) ion per subunit. Function: Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate. Catalytic Activity: ATP + shikimate = 3-phosphoshikimate + ADP + H(+) Sequence Mass (Da): 33720 Sequence Length: 300 Pathway: Metabolic intermediate biosynthesis; chorismate biosynthesis; chorismate from D-erythrose 4-phosphate and phosphoenolpyruvate: step 5/7. Subcellular Location: Plastid EC: 2.7.1.71
A2ZLU6
MAGDRAEEEEGEAPPPEARAAAAVERVAAAVEAVAAGAGAGAGEYRNAYRRQLLALSRRIRLLGPFVEELRERRRGEGEGEEEERALAPLADALEAALALLRLGREGSRISLVLERDSVMKKFQGVILQLEQALCDIPYNELDISDEVREQVELVHAQLKRAKERIDMPDDEFYNDLLSVYDKNYDPSAELAILGRLSEKLHLMTITDLTQESLALHEMVASGGGQDPGEHIERMSMLLKKIKDFVQTQNPDMGPPMASRVLDSNGDSRPITIPDEFRCPISLELMKDPVIVSTGQTYERACIEKWIASGHHTCPTTQQKMSTSALTPNYVLRSLISQWCETNGMEPPKRSTQPNKPTPACSSSERANIDALLSKLCSPDTEEQRSAAAELRLLAKRNANNRICIAEAGAIPLLLSLLSSSDLRTQEHAVTALLNLSIHEDNKASIISSGAVPSIVHVLKNGSMEARENAAATLFSLSVIDEYKVTIGGMGAIPALVVLLGEGSQRGKKDAAAALFNLCIYQGNKGRAIRAGLVPLIMGLVTNPTGALMDEAMAILSILSSHPEGKAAIGAAEPVPVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQECGIMVPLRELALNGTDRGKRKAVQLLERMSRFLVQQQEEQESQSQASAQVPPQATPEQVPENDIPEQLDSPASQYPMVV
Function: Defense related protein that negatively regulates programmed cell death. In vitro, possesses E3 ubiquitin ligase activity. Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 75300 Sequence Length: 694 Pathway: Protein modification; protein ubiquitination. EC: 2.3.2.27
P35829
MKKNLRIVSAAAAALLAVAPVAASAVSTVSAATTINASSSAINTNTNAKYDVDVTPSVSAVAANTANNTPAIAGNLTGTISASYNGKTYTANLKADTENATITAAGSTTAVKPAELAAGVAYTVTVNDVSFNFGSENAGKTVTLGSANSNVKFTGTNSDNQTETNVSTLKVKLDQNGVASLTNVSIANVYAINTTDNSNVNFYDVTSGATVTNGAVSVNADNQGQVNVANVVAAINSKYFAAQYADKKLNTRTANTEDAIKAALKDQKIDVNSVGYFKAPHTFTVNVKATSNTNGKSATLPVVVTVPNVAEPTVASVSKRIMHNAYYYDKDAKRVGTDSVKRYNSVSVLPNTTTINGKTYYQVVENGKAVDKYINAANIDGTKRTLKHNAYVYASSKKRANKVVLKKGEVVTTYGASYTFKNGQKYYKIGDNTDKTYVKVANFR
Function: The S-layer is a paracrystalline mono-layered assembly of proteins which coat the surface of bacteria. PTM: Glycosylated. Sequence Mass (Da): 46570 Sequence Length: 444 Subcellular Location: Secreted
P38059
MKKNLRIVSAAAAALLAVAPIAATAMPVNAATTINADSAINANTNAKYDVDVTPSISAIAAVAKSDTMPAIPGSLTGSISASYNGKSYTANLPKDSGNATITDSNNNTVKPAELEADKAYTVTVPDVSFNFGSENAGKEITIGSANPNVTFTEKTGDQPASTVKVTLDQDGVAKLSSVQIKNVYAIDTTYNSNVNFYDVTTGATVTTGAVSIDADNQGQLNITSVVAAINSKYFAAQYDKKQLTNVTFDTETAVKDALKAQKIEVSSVGYFKAPHTFTVNVKATSNKNGKSATLPVTVTVPNVADPVVPSQSKTIMHNAYFYDKDAKRVGTDKVTRYNTVTVAMNTTKLANGISYYEVIENGKATGKYINADNIDGTKRTLKHNAYVYKTSKKRANKVVLKKGTEVTTYGGSYKFKNGQRYYKIGANTEKTYVKVANFE
Function: The S-layer is a paracrystalline mono-layered assembly of proteins which coat the surface of bacteria. PTM: Glycosylated. Sequence Mass (Da): 46688 Sequence Length: 439 Subcellular Location: Secreted
Q05044
MQSSLKKSLYLGLAALSFAGVAAVSTTASAKSYATAGAYSTLKTDAATRNVEATGTNALYTKPGTVKGAKVVASKATMAKLASSKKSADYFRAYGVKTTNRGSVYYRVVTMDGKYRGYVYGGKSDTAFAGGIKSAETTTKADMPARTTGFYLTDTSKNTLWTAPKYTQYKASKVSLYGVAKDTKFTVDQAATKTREGSLYYHVTATNGSGISGWIYAGKGFSTTATGTQVLGGLSTDKSVTATNDNSVKIVYRTTDGTQVGSNTWVTSTDGTKAGSKVSDKAADQTALEAYINANKPSGYTVTNPNAADATYGNTVYATVSQAATSKVALKVSGTPVTTALTTADANDKVAANDTTANGSSVAGSTVYAAGTKLAQLTTDLTGEKGQVVTLTAIDTDLEDATFTGTTTYYSDLGKAYHYTYTYNKDSAASSNASTQFGSNVTGTLTATLVMGKSTATANGTTWFN
Function: S-layer protein. The S-layer is a paracrystalline mono-layered assembly of proteins which coats the surface of bacteria. PTM: Glycosylated. Sequence Mass (Da): 48159 Sequence Length: 465 Subcellular Location: Secreted
P22258
MKNLKKLIAVVSTFALVFSAMAVGFAATTPFTDVKDDAPYASAVARLYALNITNGVGDPKFGVDQPVTRAQMITFVNRMLGYEDLAEMAKSEKSAFKDVPQNHWAVGQINLAYKLGLAQGVGNGKFDPNSELRYAQALAFVLRALGFKDLDWPYGYLAKAQDLGLVHGLNLAYNGVIKRGDLALILDRALEVPMVKYVDGKEVLGEPLISKVATKAEYTVIATNAQDRSVEEGKVAVLDKDGKLTTINAGLVDFSEYLGKKVIVYSERFGDPVYVAEGDNDVVSFTEGQDSVGTTVYKNDDNKTAIKVDDNAYVLYNGYLTKVSKVTVKEGAEVTIINNNYLIVNGSYDNSTIVYNDVQSGDKYLNRDSNYELKGTVTVTGAVSKVTDIKANDYIYYGKQYDVNGNVVGTVIYVVRNQVTGTVTEKSVSGSTYKASIDNVSYTVADNNVWNQLEPGKKVTVILNKDNVIVGISSTTTTTAVNYAIFKEKSDPFTAWFAKVKLILPDAAEKVFDAVYSDVYDKVNLAEGTIVTYTVDANGKLNDIQRANDQPFSSASYKADAKVLTEGSTTYYITDNTVLLNNTSDGYKALKLTDLKDATNLNVKIVADNYNVAKVVVFNNASFVSTTTSTVYAYVTGTADVYVNGSTFTRLTVLENGQTKTYDANAQLATNYTHKAVVLTLTNAKIANIALPTVASGVKLTNIDQANLRITDTTNKGYLLDPNFIVVDTNGNLKGLSDITKDTGVNLYTNDVGKVFVIEIVQ
Function: The S-layer is a paracrystalline mono-layered assembly of proteins which coat the surface of bacteria. PTM: Glycosylated; contains 8% carbohydrates, which correspond to about 40 to 50 sugar molecules per monomer. O-linked glycans consist of Glc, GalNAc and GlcNAc. Sequence Mass (Da): 82785 Sequence Length: 762 Subcellular Location: Secreted
O14216
MHDESRTKQISSIKALLKKWEHEYVHTNNCKPSKEDVKKQPEIALLYKQYYELKRESSITPKKAKTKVDFKFQTPTKQRAETEANESPKAPRNDYLQVTPKTVDKSLLGPTPQLSRRVLNLLEDMSPIADSHVDQISDIKHNTSEISSTMIPTTPSKNPEPVAQHTPTVLETPSSYRLQVYTSPNLLRVNAPCRKSLSEMLRELKDIEDDYGSNEEKILQEFESFSSSSSESLVDRDISQPMKKKIKRQNRLVKLPPSMNLSKSHLEGLPEIDEDAENGIDDNEDTTASKDSSPFLDLQSERQNKKIMRNGLVIGKQVSQNYSSYKLKKRKFRRHRS
Function: Has a role in the initiation of DNA replication. Required at S-phase checkpoint. PTM: Phosphorylated by cdc2 at the onset of S-phase. Sequence Mass (Da): 38685 Sequence Length: 337 Subcellular Location: Cytoplasm
P34252
MYSFELDKLKIELKTWEHDFIDKNKREPTRDDIKSLRTVRQMYKQYSTLKKKQSLQRQKVDTQESVELPAHKKDHDEVVEIGPTPQVYGKAISIFDMNLSPIKPIYMTFTNNIDVNNDNSKTISNESSPRKTILLKSSPADRTLVAEPISSVKRQLNFQMLNASSTRTPTSSPCKNRNGKLVEIKKCSPTINPPLESGKPSGYYGPNSPLKLDEENIHLNISLNSSTKRRLQIAYPSLQKTPSKDQADISTSFSPSPLIRRPLTKSLIELAREHTEIVKEFGVLQEEDIEEEEEGEEGENGYDEKNHEDDFGLEDELIRPKVVKDIFQEDDDNDDSQAREDTFIRKRPKRRKVIRRLRDNDPETETAGFERDVHKELVKLKRRKVAEFLGSTSQISDTEFEHDPEASSGVVSSEQKPTAKRKGRKKYNLVSNNFRRLKLPKKNRFSNGRWGRR
Function: Has a role in the initiation of DNA replication. Required at S-phase checkpoint. Also required for the proper activation of RAD53 in response to DNA damage and replication blocks. PTM: Phosphorylated by CDC28 at the onset of S-phase. This phosphorylation, specifically phosphorylation of Thr-84 promotes interaction with DPB11 leading to DNA replication. Dephosphorylated by CDC14. Sequence Mass (Da): 52272 Sequence Length: 453 Subcellular Location: Nucleus
Q09761
MNNDHASKKSFCIKAPSNWEKSYLEVWPLVTVPRQCICLRWCISKEYHEFTCSSLQFIVIRPAGTSVLLGRVKSSKANQLVGIEHVEGSRYALIFLSEKLDFKSLKVIANHQLTKSSKSLSNVSNKPLGDQLFRSNSLMSPSLLKKELHRIQSDASQANERESQAPHSFVTHDLISSSKDGNSLTHEFANDSVTEMVQDYTPSCSRDVKSLLDHLYNSYFYQLLMTKTPVVFYVKQMVGKTRQLAVEVHNHVEEKALVDELLKFLDNLKSVDDRKSRLLQCFESHLNYKAWHLEFENEAHQYEIKGYRLWLQNILNRENCQITKLDFEREFSQLKLKEYEIRVLLYFEILYLFLKWDPEYARRRANDNSLLDSRDSGKRKSRKKNAKTLNPFETAQLKLEFTFDGLCIRRTIEQNATERSEDLLLKFCKETIVPYYSSKFPRITRNLLEKCNGLDLLPERSHKHRHSAPPRSKLISSKSEAGRALPGNTSGASISNTSSPHSEASISKDYEILKRRRSNSGVHSLTRSDSSFNGFERDTRRRSSDIARIKNREINLPSSSLSKQRNSMHDISTNFPRRNLSFTEKLTMASLQGQSEESVQPKTTSSLSRSKTLSILEGSVSKRSEPSMDSILVQATPRKSSSVITELPDTPIKMNSLDKASACTVENHIVTESPAHKSNKAQLFVCVPTTPVKKKSASP
Function: Required for loading and maintenance of stable association of cdc45 with chromatin during initiation and elongation of DNA replication. Also involved in temporal regulation of origin firing. Plays a role in meiosis. PTM: Phosphorylated. Sequence Mass (Da): 79815 Sequence Length: 699 Subcellular Location: Nucleus
A6XIG6
MSEQAVEVSPKCLGPQHHINPLRFVMPPGSWDTHFHVFGPTTKYPYSETRKYTPPDSPFEEYVKLMLALGIERGVCVHPNIHGPDNSVTLDAVERSEGRFLAIVKIAPDVTLPQLKEMKKKGACGVRFAFNPEHGSGELDTALFDRVVQWCGELDWCVNLHFASNAIHSLAERLSQLTIPTLIDHFGRVHPTKGVDQPDFKTLVDLMRLPHMWVKLTGADRISRNSPSYQDVVPLARTLVDVAPDRVIWGTDWPHSGYFDVKRMPNDGDLTNLLLDFAPSEEQRRRILVDNPSRLFGQVAKGA
Function: Involved in the degradation of 4-sulfocatechol which is a central intermediate in the degradation of substituted sulfonated benzenes. Catalyzes the hydrolytical desulfonation of 4-sulfomuconolactone to yield maleylacetate. Catalytic Activity: 4-sulfomuconolactone + H2O = 2 H(+) + maleylacetate + sulfite Sequence Mass (Da): 34092 Sequence Length: 303 EC: 3.1.1.92
Q8IYM2
MNISVDLETNYAELVLDVGRVTLGENSRKKMKDCKLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFSNILLFVPEYLDFMQNGNYFLIFVKSWSLNTSGLRITTLSSNLYKRDITSAKVMNATAALEFLKDMKKTRGRLYLRPELLAKRPCVDIQEENNMKALAGVFFDRTELDRKEKLTFTESTHVEIKNFSTEKLLQRIKEILPQYVSAFANTDGGYLFIGLNEDKEIIGFKAEMSDLDDLEREIEKSIRKMPVHHFCMEKKKINYSCKFLGVYDKGSLCGYVCALRVERFCCAVFAKEPDSWHVKDNRVMQLTRKEWIQFMVEAEPKFSSSYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQHEGLKQLICEEMDSVRKGSLIFSRSWSVDLGLQENHKVLCDALLISQDSPPVLYTFHMVQDEEFKGYSTQTALTLKQKLAKIGGYTKKVCVMTKIFYLSPEGMTSCQYDLRSQVIYPESYYFTRRKYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRLT
Function: Ribonuclease which is part of an E2/17beta-estradiol-induced pro-apoptotic signaling pathway. E2 stabilizes the PDE3A/SLFN12 complex in the cytosol, promoting the dephosphorylation of SLFN12 and activating its pro-apoptotic ribosomal RNA/rRNA ribonuclease activity. This apoptotic pathway might be relevant in tissues with high concentration of E2 and be for instance involved in placenta remodeling . May play a role in cell differentiation . PTM: Phosphorylation at Ser-368 and Ser-573 negatively regulates the ribonuclease activity . Dephosphorylation is induced by the interaction with PDE3A and stimulates the rRNA ribonuclease activity . Sequence Mass (Da): 66972 Sequence Length: 578 Subcellular Location: Nucleus EC: 3.1.-.-
Q5U311
MEIHPSLVVEPSYPDLIIHAGEVTLGEKDRNKMDSKKKRLEKARITEAACALLNSGGGVIVMQMSNKSEHPVEMGLDLETSLRELIPSSDLQAFIETKQQGDLFYIFVKSWSCSPKDGSTKPRICSLSSSLYCRSLTSKLPLDSKETFEFLERKKTCVKGSLTDGKGPPAKIPRLMYQNDLESNPAFEIFQSERLEYGQRLPFSESASIEFKQFSTRRAHEYIKSVIPEYISAFANTQGGYLLFGVDDESKRVLGCPKDNVDRDSLKAVVNEAISKLPVFHFCSSKEKVSYKTRVIDVFKEGNLYGYLCVIKVERFCCAVFSEAPISWMADKENGVYSLNTEKWVRMMVDIGPEAASSKQSSLDDLSKDFECQLSLSNSPPHCRPVYSKKGLEHKGDLQKRLFQVSADCFKYTPESLWRELCSQHERLENLISQQMCSFSCGLLILSRSWAVDLNLEGKQGVICDALLIAENSPPTLYTILEEQDELGQDYCTRTAFTLKQKLVNTGGYTGRVCVMTKVLCLSSQNNIETNGNSVSLIDYPRSYNLANIQEMEDLLQALVIVLLNFSSFLSDQLGCEILNLLTVQQYEILSKSLHKTRKLFVHGMPGSGKTIIAMKIMEKIKNTFHCERDSILYICENQLLRDFIRAKNVCRAVTRKTFMTPNFEVEKIQHIIVDEAQNFRTENGDWYMKAKRITQRMKTCPQIFWIFLDYFQTSHQKESGLPDFLHQYPKEELTKVVRNADKIAEFLQKISEKIRSNPPPIIPRESLNMVCEFNWSQGVSGTCKLLTSLGLEQMARYVAERCYFFLKNGYSAQDIAVLFSTEDEKDNNEDMFLREIRNRTSQIDDAYHLYMFDSIRRFSGLERSIVFGIDPRTAEKSIFHNLMLCLASRARKHLYILSKVPNPFNF
Cofactor: Can also use Mn(2+). Function: Endoribonuclease that cleaves tRNAs and rRNAs . Cleaves tRNAs 11 nucleotides from the 3'-terminus at the acceptor stem . Does not act on tRNA(Sec) . Sequence Mass (Da): 103655 Sequence Length: 907 Domain: Shows a pseudo-dimeric U-pillow-shaped architecture of the SLFN13 N'-domain that may clamp base-paired RNAs. Subcellular Location: Cytoplasm EC: 3.1.-.-
P0C7P3
MESLKTDTEMPYPEVIVDVGRVIFGEENRKKMTNSCLKRSENSRIIRAICALLNSGGGVIKAEIDDKTYSYQCHGLGQDLETSFQKLLPSGSQKYLDYMQQGHNLLIFVKSWSPDVFSLPLRICSLRSNLYRRDVTSAINLSASSALELLREKGFRAQRGRPRVKKLHPQQVLNRCIQEEEDMRILASEFFKKDKLMYKEKLNFTESTHVEFKRFTTKKVIPRIKEMLPHYVSAFANTQGGYVLIGVDDKSKEVVGCKWEKVNPDLLKKEIENCIEKLPTFHFCCEKPKVNFTTKILNVYQKDVLDGYVCVIQVEPFCCVVFAEAPDSWIMKDNSVTRLTAEQWVVMMLDTQSAPPSLVTDYNSCLISSASSARKSPGYPIKVHKFKEALQRHLFPVTQEEVQFKPESLCKKLFSDHKELEGLMKTLIHPCSQGIVIFSRSWAGDVGFRKEQNVLCDALLIAVNSPVVLYTILIDPNWPGGLEYARNTAHQLKQKLQTVGGYTGKVCIIPRLIHLSSTQSRPGEIPLRYPRSYRLADEEEMEDLLQALVVVSLSSRSLLSDQMGCEFFNLLIMEQSQLLSESLQKTRELFIYCFPGVRKTALAIKIMEKIKDLFHCKPKEILYVCESDSLKDFVTQQTTCQAVTRKTFMQGEFLKIKHIVMDETENFCSKYGNWYMKAKNITHPKAKGTGSENLHHGILWLFLDPFQIHHADVNGLPPPSAQFPRKTITSGIHCALEIAKVMKEEMKRIKENPPSNMSPDTLALFSETAYEEATCAQALPGVCETKTNLTTEQIANYVARKCHSLFQCGYLPKDIAILCRRGEDRGRYRLALLKAMELIETHRPSEVVFSPATGVWGSHIVLDSIQQFSGLERTVVFGLSPECDQSEEFHKLCFASRAIKHLYLLYEKRAAY
Cofactor: C-terminally truncated SLFN14 endoribonuclease requires manganese and magnesium for its endoribonuclease activity. Function: Shows no ribosome-associated and endoribonuclease activities. Sequence Mass (Da): 103907 Sequence Length: 912 Subcellular Location: Nucleus
Q8W127
MKREYQDGGGSGGGGDEMGSSRDKMMVSSSEAGEGEEVDELLAALGYKVRASDMADVAQKLEQLEMAMGMGGPAPDDGFATHLATDTVHYNPTDLSSWVESMLSELNAPPPPLPPAPPQLNASTSSTVTGGGGYFDLPPSVDSSSSTYALRPIISPPVAPADLSADSVRDPKRMRTGGSSTSSSSSSSSSLGGGAARSSVVEAAPPVAAAAAAPALPVVVVDTQEAGIRLVHALLACAEAVQQENLSAAEALVKQIPLLAASQGGAMRKVAAYFGEALARRVFRFRPQPDSSLLDAAFADLLHAHFYESCPYLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGLVAATLADLEPFMLQPEGEEDPNEEPEVIAVNSVFEMHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGGSSGGPSEVSSGGAAPAAAAGTDQVMSEVYLGRQICNVVACEGTERTERHETLGQWRNRLGNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAAP
Function: Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. Acts as a negative regulator of GAMYB gene expression. PTM: Phosphorylated. Sequence Mass (Da): 65206 Sequence Length: 618 Domain: The DELLA motif is required for its GA-induced degradation. Subcellular Location: Nucleus
Q0V640
MPASPLPALSPPASPRRNTSGASALGSRKADIPPDAIRGFATVGSLVRSEHFAQHFDDDIAGKDQEQSRKKSPEDVGNIAATKKKPGKRAATTSTADGEAKPKPKPRARKPKAADEEAVIIDPELRLPAAKVSPFFAAEGAPAAIEPSDEPVVDVPKLTKAGKPRKPRAKKENVGGEEAVPKPKRTRVTKPKAAKAKAGGKSQEEACVESAHFRKSEDTGDETVAGVLATRKSATTENVGSGEASIWDVPQSPKPKKKRAPKKPPPDPVINNLELDEAVSRRRDWTPPRDTAIPSPFTDSVGKENKQIEPDADNGGFTHMISNFAYAQALPAQVASTVADSATGTMAATKRRRIELLDVPGNQTTSRNSSPEKGKAPKKKPRTITDIATEQYQHRAAQLDQSDVASDFFQSHTAVTKVPLNDASLPNGDAPTKKPPRKRSTSKPASEKEKVGSKARSKKASTKAAAKPKHIAEKLLSPGSALMRMNKQDILFGTSSQLALEEPPTLVRQLQHALKESEVEADLSSNGMIAPPPRWPKLDKVVGKRSLWDASSRDVEGGMLEHMEDVYIPEFDRTQDFPLLMDGTNDQPDGAPPSFADIDDFEPAPPVIISSDGPTPPPTTSRTSQRKANDEPDHVMEGPVFEDIDDFDFQPPPSNQNVEFQDSFADDDEILHTSVQSSTHPPPRLRPPATSDPMNGSSKKPRGCPAKSQSAIATSGSPAVAKEPKRTKGKEVKSAPAPPTTPAKGSGRFIDIDEILDSDDEALQALSPTPPRIHNFENSQPLPLYSVSPTRAKKPKADSSVDSKIVPVHIIPTAHLEWLNLKNSIFPSITSHIRSLPSTRDPSKPSWHEKILMYDPIVLEDFTAYLNAKTSLRTWRRATKIQSKAWNKAQKSIGAQEIGVVEGGGNVLAVEKELEAWQVQSWCESMSVCCIWGEGRGKGGVRKGFY
Function: Regulatory subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 102257 Sequence Length: 946 Subcellular Location: Nucleus
A5DIU9
MSNDVYFESIHMQSNYEEFETQAQERENISKISTSLSKFRKMSPKSTRSFKVKSAPLTNRKARNRIKSINAHVSAQYKVSNGQQNDDILDFFLKRKHNISSILEGVEDLENRNIVSNDTPQPSDNTGNYSSQLFTQEEWFQILRRIKLRFPKLSARTRKSLKYVTTKLEHLKNINSDDDSPQLWTQAASLPEEGLVNEDMKWLYELDDEQMDIGSSFCNVDEDSDQKLFVLTLSQAMGEREKSEPDVEIISDSSPEPTQLLNDGIIEEEHEVDEEEEDNENEEKSEKQLASSPTQISSDDTQEQLTNRAEISSYEASSLFPNTLETQKQPVKSTIQKQASVVVPDYPKISNVKDEEIILSSSPTRDNEIFQTPRKYSVESVRSSPSSRSGRLGRLMVSPLKLLSPDRLDASQSVYSTARSSPTKQKRVRGREVNEKIVRKRFKTSRVEVAGNFHLKASDDLKIVSTVDKVNGSEVEDSEDDDHSVSIIEITHEVNDEELKAVDEEVTGEAEDGPSIIQVPSSPGNENLQEDLTSMQTSIASVTQEVPSNYTATQMRQALRSLDFPPERSKEGMASSLTRAASIAGTSVSSLLTPDAPYEEVKNQIYSAISESVKKDQLWHERVLSYEPIVLEEFKQWLGELDKDLKFDVTFLQQYCDHMGITTTIGTTTGTTAGTNTTTTD
Function: Regulatory subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 76784 Sequence Length: 681 Subcellular Location: Nucleus
A3GGG8
MVDSESQNDFANDGDNDSYFVSTQFESKQEEIMEKELQKLQTGQTVSQLLRFRSGISGLTSVTPKPVKVSRPGLRKTGSRKSKKNQSMSAMVKERFKTDKYAYFSGDQRKIDEFLRRLEGSEDIENMAMSTSGKDGSCLFTRDEWICIVQSIKLRFPELSTTKKKSLSAITRQINKQEKENEDENSIWSQARSLPSLELTDEDLKWLYDLDDEQMANRTITSSMTEVDGNDDHSPFVMTLSQTTPSQLSHIKESDSLYSQETNVQTTEPADHQSGHMQRCHSQTAEGKTQSKILEIEIVSDSEEEIESLIRNTEPDSSEDVYGANEVSSHQVPAVDALASFQSFPFAADMIPRNNVRDKEHESLHISSSIRSSPAQSLTQSQVPSSIDSIIEPPCESPRKMSPIRDTQPEPVITSPFKTPTKKSKELLSKYSSPVKNSIHNNMGSPVAMMVPRSSESAKHVEEIIVSSDEESVYSTAKSVFPSAQIVISEVEDEDEEFYEIVSSIPEKHKPTAAAKKRKLLQTSRYEVVSNFNINDYDDDQRGFKLRKLETKPIIIDSDNEIADSEEDEKNLSIIEITREVEAEESEHDTEYLINLGKQVEGNSKMNTSVLQVPSSPSSITFGRTDILKELEAFSNSDLDTDRTINSNTSKNSNAIKSGTNQTIDFTLLSTKELQERFKKWELKPVQGRQRMVSVLSEVSKLFTNSFNDPVPETRQGFEGTVYGSLNRLVGSNQYWHEKIISFEPLRVSELRDWICTKGYELEEDFLMRYCDDNGYCCTRQP
Function: Regulatory subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 88506 Sequence Length: 782 Subcellular Location: Nucleus
Q9P6M0
MSAEEYIEVSSSPDIFTDDDDMITIEPELNKNPKDCNSKRKRSVTECCEIRLITSKCDFESTQQLVHHNCTGHKVHEHNLNAVDEEDFDTENLPLLFSSFSDNESDILEPDLNTRVAEDNDVLLSRYSKIKNSASCRNTFEHSAYHSNREEISSSGFYYHRKPQLFEKSLEKLGNKSIEANRSPLIKELCESANSTENVCFSVSTVDEIQQRHPSAGHSIDSTCQSNSFLEGDSATHKKKKTDNIKEFTSCEFNDRSRTLLNYAGYMDTNKNADNEAKSLKEKLENFPVEKLRAIAESYGFKSSDSKATLIKIVESCLDAIDSRSQSKKLGKETPHDYLITSTKTVLEFDDIVTQTHRAISQVVKQAKDNSVWIKILTYSAIDVEEFQLWLKRKNLNVSLDLIKSWCDKYGVLMKGSWH
Function: Regulatory subunit of the slx1-slx4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. Has a preference for stem-loop (SL) and splayed arm Y structures. Introduces a single-strand cut in duplex DNA on the 3' side of a double-strand/single-strand junction with respect to the single-strand moving 3' to 5' away from the junction. Plays a critical role in maintaining the integrity of the ribosomal DNA (rDNA) loci, where it has a role in re-starting stalled replication forks. The complex initiates homologous recombination (HR) events, used to maintain rDNA copy number, in the rDNA repeats that are processed by a mechanism that requires rad22, but not rhp51. Has Holliday junction resolvase activity in vitro. Slx4 is required for efficient processing of DNA substrates. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 47765 Sequence Length: 419 Subcellular Location: Nucleus
A7F2D1
MATTDVFIISSSPPRRLVSHIASSPPLPSLDKMVNGKKASNLRQGSSVAPIPTGATIFASASTLLRESSSGSLQGFDNARSFVTSAVQDENDLKKSAKPKAPRKTAPKKEDGTVEKVAKASRKTVKKKDKDVSGDFVDELVGEAAEIIAEKKPRKPRAKKGDNAEGKSGSVAEATVEKKPRKSRAKKAVDATGEDLKEKVPRKSRAKKTDVEAGIETVPKEKAVRKPRAKNSDLDSNLQSKMVKGRVTKSAVNASNTHKVETSKADTGNKHFAPNPIVEDIVADEGFGLVEAIRRRTNWTPPKSTKVPIDLEDSPEAQESDTSKGFAELLGSFGYSSYQADSIEKRISSGVSNGAAATRKRKLIEMVTTNIPREPGSKTTKEKAVKKKARTLTDLATSAYATAEDDDNLLDAPTPLLQYFPHAAPEGSTNNGFKIPPKPRSKSPMKRVQKSKTGSAEEPILLSPESAMKQVSNQDFVFGTSSQLAREDSPSLLRDLHDAMQASNELDDYDDPFVSPPTKIAERGKAVVAAKRNLWSIAARDNHGDLMDVETIDLAHTPVAKPDRIMLSQKPSSLVTPGKDDWFDIDEIEDNRPPSTQVPLRETGPIERSINFQLLDSPTQPKNTSKDSSKVFPQKKGTKSLVDKSTTPKKVDASKMPDYESFTTPQLTREIQKYKFKQIKSRKRMIDLLIQCYESQNRPALGVLQGNIPIITQNSLEKSKDVADSSTQVKPTIPSPRRGRAKKVTTSTASLPKSKAKSKMTDTVAFLEMDSDTPLSKIRTPQKSRKGKQPLEDIFDSDHPITPSPPRRSDSQIRKISKALELSPDNNQDDEAQQAQLFTHIYTAITKAPPSQDPFNPSWHEKILLYDPIILEDLASWLNTGALSKVGWDEEVAPLEVKKWCESKSICCLWKENQGGGARSRY
Function: Regulatory subunit of the slx1-slx4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 101156 Sequence Length: 922 Subcellular Location: Nucleus
B8MED8
MTSRLDHTIVIPSSPEQNWARSVSPCTPTRLFGLPPMSISPPSLPSPSRLFEEIGLGQQKNPPSPKSPFSSAAGKTATSKAITENPSRNESSSKRGRPGSSEAKTAGSRKNSKSQETRNKILTGRVAKPTTVSKAKATAASKSKDTSVVKAKAGTKKSKPASQNKKDKLAEEAEAEAKEVADAEGLNLEEALKRRSDWTPPKALSLVSIDEDTPSQGSGTKLSFGDVLRDYHYNRENSSCEPAQPSKEGNPTKRRRLELVEFEVLQERKPIQQKQIKDAVKTRKTKSKPKKQLNTITARVTARYEQIGELEDLFVYNEESSCETSECLKKPTKPKKETAGKQKEPEYIILSPDAATKSLNDQNFLFGTCSQLERDDSPTFFEETQTAIQLSECLTFKKTASTITTASSAMSIATRFTGKKSHWSEAARDFNGAVVQPEIIDMTDSPTVSVALSRLSEVKHDAPKMASLVSSQSVSATNSLVPKDVVTASKPAADVQLASSGPEPNKTELAAGPFRKTASRLPEMPNFNGYTDSELKNQVLSYGFSLRAVRGRKKMIELLDKCWQSKHGNTATAAIVETSSSAAINETVSVSAARHSDTQVSDKLPTRKKKTTPSRLEPKTTSRAGKKKVSEKPLAGKADKPVEKAASPIPASTYNMVDEIEDSEEEIIPSPTRIQIQRQSSSRQTTPAISCLPLGTKSKRSLKSTKSSTYDEATLLELQSSITKAIHLQTRPRRSLGGSSYSPQLTWHEKILLYEPIILEDFAAWLNTEGFALACEDREVGVALVRTWCESRGICCTFRP
Function: Regulatory subunit of the slx1-slx4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 87385 Sequence Length: 800 Subcellular Location: Nucleus
C4JJE8
MSFLNSSRRRTRSPSPGQIFAPSATPIVIDSSPSVPSASSILDSLLGEFSEARDPYTVEAGPTGRSSDHLFSSPGVLTQSPGRENVPPRPSERTKDAHGKDRFLVSTERNGRSPFRGNPYRSAEIHSPKGRLKAPTKEGGTRKTKKFSSSNRTLTGRSTKFLAKTASKPTQSSKVPSEIPAAKLDSLQWEDGELRLELATTRRGSWTPIKDTSIDIVDPTRNLSPSNVSAAGSQKFSSMLSDYGFTKGSTLTMENELRREVPTTKRRLELLQGTANDIFSEGDFSRPPEKSVVNPNGTHSRRSRKTTSTTITSLSTAQYGHQDSRQMSNLADFFPSGEAVERPSGAIKKLKTSKSGTKKKGVKKAKEAPLFKVASIEDALKSLEDQVCLFGTSSQLERVSSDEEPQMANFNLNAQFPRKNSRPQKTRSPCSNPKTSKSLWYASSRGYDDIEFVDMIDSSNPKTLESVEASTFVTPIDSSPMHSQVASQMVFENPCDVSHVLTKIPQTGPKDPIENPVCPEIQIRHSGNVKTQSTSGQSIPSFRGLTTAQLAQKVASFGFKPLRSREKMISLLEKCWESQQQTHIPAMLPASHTALPDSVTRAEQMSKRDTIKSRDIRASKSRSNSNHIPGLVSSTSQNTGYAAKSPDCIRGSSKSNDIGTTQGSPLLTTQSVIVIPDSDDSDNDNNPTGGAYSYPSLASNTPSSSTRTMASESLLSVRTRYEANVGEEQGSNDINQQITKAIRAQPRLVAINGVKRPTWLEKILMYDPIVLDDLTVWLNTEGLDQIGEDSEVSGTTVREWCESKGICCTWKKKRHVAP
Function: Regulatory subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 89414 Sequence Length: 818 Subcellular Location: Nucleus
A7TEM0
MDFRQAQRNLELIEEVAKNSQDSDEPIIDEDDLKEGKVEEEGEGTQIPSMPFSDDDDSDNNSKDTFKETPLELVDKEEAIEDKAPNDDEPVVSVEEKIATQEPEPEEQIFMNTQIQGQLDDIEQEDNLRSKLSNFKYASEESSSVQVIKRSNERKLKSKKITKPKLTKTSKRTKTNSNPSTQQTLDEIKISRSENILKLLSGKHGKVKDMINHQRNVEKKVKLVKNKNSNIITYDTYNSEEWLRIMKLILEKFPSANDMEVKQVYHYIYGEEQEQEYDNLWEASQIPLASMREEAYNEDNQIDRKIPNIPNSTQTRVEVMSLSQVMDDVSIIEESKKTTIDSEREMHIYEVPDSTDDEDSRIIRVISGSDEVASIVAESEFSTETESTSTQFFTADGNMVDGVIDLTQGSFKAVTKLFSPLKVDTLLSINKNKEKVQVAVTRTSTRFSNLGSGPVGLEETPRLAPDEAATPPTVISRSPQSTRTPQATRLPNPNITVMYEVNKCELQSSNSYQSRSSEDIRIVNQYDIDVRDSQDEYDSATEKCLIEFAVTNSATPSVQPEDVMNVISSQSVQKLRQDLKTIGLKPVRTKAKMIEALMAASQVLDTDNVDQEQTREALYDQLTSMIKQIPELVSKISRFEPITMEELVLQLIEVNPFADHIDESTIKEWADIQGITLRNN
Function: Regulatory subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 77170 Sequence Length: 680 Subcellular Location: Nucleus
B3LT96
MELQRAQRNLKFLQNEDYVNVTDQTNLNGESQNAYSLGMETQVPEMQFSLSSDDDSIGTQVKSVTAQKSPMTQETTKNDTERNKDVDKSCNPVSTSHPDLGGSNIEENIFINTQIQSRLDDAEEETNLKLKLEKFKYSFKSSNADDTHSNANVTAKRRPAIRKANSKLKTKPKTKRDPKIIKNITDFNINNYERSRTASLLKQLSGKHKKVLDIIKTQNEGNSDKPPRARNNKGEKATFDTYSEQEWKDIMKLLLQKFPQSEETDLNEVQKFLYGSEKSSNSLDNQESSQQRLWTASQLPPELPDEAIQPEQEERIRDTQSAVNFLSLSQVMDDKSEIMKDEESIIISRGDSTSSQEYGNGLEPQQPVGNVVGEDIELAVGTRINAFSLTDYKACKPMSVEVSRRCENSTDNDYDNISIVSDTTDETSTLFPLDQYRYVFIENDERPPLATDTIGSTQFFTPNTSPLDGIIDLTQESFKAVRSLISPLKVENNKTGVTSQASNQVQVPATRTPTIIPQKNLTTTLKTEEEKNNIGSSIRVKLLQESVVKLNPKLVKHNFYRVEANDSEEEETEFDDQFCIADIQLVDSSKISTKDSTQNPTTSNDIIDTSAASSIASPEKFCEIMMSQSMKELRQSLKTVGLKPMRTKVEIIQSLQTASQILSTANPDNKGEHGGVANFSKIEIFDHLTELIEAFPDFLERIYTFEPIPLNELIEKLFSAEPFVSQIDEMTIREWADVQGICLRNDKK
Function: Regulatory subunit that interacts with and increases the activity of different structure-specific endonucleases. Has several distinct roles in protecting genome stability by resolving diverse forms of deleterious DNA structures. Component of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. Has a preference for simple Y, 5'-flap and replication fork-like structures. It cleaves the strand bearing the 5'-non-homologous arm at the branch site junction and generates ligatable, nicked products from the 5'-flap or replication fork substrates. Plays a critical role in maintaining the integrity of the ribosomal DNA (rDNA) loci, where it has a role in re-starting stalled replication forks. Has Holliday junction resolvase activity in vitro. Interacts with the structure-specific RAD1-RAD10 endonuclease and promotes RAD1-RAD10-dependent 3'-non-homologous tail removal (NHTR) during repair of double-strand breaks by single-strand annealing. SLX4 also promotes recovery from DNA-alkylation-induced replisome stalling during DNA replication by facilitating the error-free mode of lesion bypass. This does not require SLX1 or RAD1-RAD10, but probably RTT107. PTM: Phosphorylated by ATR (MEC1) and ATM (TEL1) upon DNA damage. This appears to be required for the function with the RAD1-RAD10 endonuclease. Sequence Mass (Da): 84362 Sequence Length: 748 Subcellular Location: Nucleus
C5DY61
MDFHRANRNLQLVESGVSDGRNPESFSLDETQVPVSSGFSSDSDKDQQEQIFINTQVQGRLDEAEEADKVRANLGQFRYDSQDSAISPKHKSAIQRPSARTTKRSSSSQRRKAPTKAQSLLKQLSGKHAKVQDMIKYQQKLDSLAGSQQRAKSKGKTTKTKKQQEKRYDTYNANEWQHIYNLLLEKFPHTRPSEVEDVYQYLYGDESEDQPLWNESQRPIEPESQDLGFLPPPPADKQRVSVLSLSQVMDDKHSREPDEDIIVPDSTDEEYIVIPIPSSPQPLRPPLATKPPLLTKPPLKKVESDAGTPKTAHSPSDGVIDLTNGSFKVVKSLISPLKEETAQVQVPATRMPTLGTTPNLAPTKEQPLRYRLHRSQLESFSAVEGLIVCSPGPSQDDVPVPDTESEDSAAEDHCMVELQPSILASRTPSPSVQSDWNSQSAQQLRQSMKSLGLKTSRSKRQMLHSLQQASQVLEIDTGGQENQRQEIHDYLTSLVQSSPVLLEKVYTFQPIASKELLTKLTEANPFVDVIDEYTIREWADYQGICLTTS
Function: Regulatory subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA (By similarity). PTM: Phosphorylated in response to DNA damage. Sequence Mass (Da): 61482 Sequence Length: 549 Subcellular Location: Nucleus
P32828
MHSDTNGRTKSNNSPSDNNPNETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQEPGSETLETPRTIQVDNTNGYLNDNGNNNESDDGLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHNLPEAIQRARRESRMRMSRRIAERQRRVQQQRVSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALERQERTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARAASLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAKKKSKMPKKKLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF
Function: Component of the SUMO-targeted ubiquitin ligase (STUbL) complex SLX5/SLX8 that mediates ubiquitination and subsequent desumoylation of sumoylated proteins and proteins containing SUMO-like domains for their degradation . The STUbL complex SLX5/SLX8 stimulates ubiquitin conjugating enzymes, including UBC1, UBC4, UBC5 and UBC13-MMS2, and mediates the proteolytic down-regulation of sumoylated proteins . The STUbL complex SLX5/SLX8 is involved in ubiquitin-mediated degradation of histone variant CSE4, preventing mislocalization to euchromatin . The complex plays an essential role in maintenance of chromosome stability and links SUMO-dependent ubiquitination to a centromere-specific function during mitosis . The complex is involved in proteolysis of spindle positioning protein KAR9 and ensures correct spindle function by regulating levels of microtubule-associated proteins . During replication, the complex helps prevent DNA lesions via recombination and has a role in localizing the DNA damage protein DCD2 . The complex especially ubiquitinates the nuclease YEN1 and prevents persistent accumulation of a fraction of YEN1 associated with sites of activity in late G2/M and helps maintain the balance between pro- and anti-crossover pathways during homologous recombination . It is also involved in ubiquitin-mediated degradation of DNA repair proteins RAD52 and RAD57 . Along with SIR2, promotes silencing of genes at telomeric or ribosomal DNA (rDNA) loci . Finally, the complex is recruited to distinct genomic hotspots of non-H2B protein ubiquitination (ub-hotspots) by the sumoylated transcription factor-like protein EUC1 where it ubiquitinates EUC1 and presumably other targets . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 71071 Sequence Length: 619 Domain: The region between Ser-201 and Leu-335 is required recruitment of SLX5 to ub-hotspots via interacion with EUC1. Pathway: Protein modification; protein ubiquitination. Subcellular Location: Nucleus EC: 2.3.2.27
P87176
MPPAHKRDTNVRNLSAPYNIPSQSARVAAGNAAINRRRSSPVENSPGNGFPVSEDATDYPSGTTSENESLPLNRAPRSLREVASELAQEETLPVETSDLNIDVESEVFDLEDINFQNDADDINQRFTYNNHPASVENSLTNVNSIHAQPTTISDMIDLTDETSYDPRKQKFEQGKNPSTTNAEIEKEEPSKKQVVPSSQRLADYKCVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPVCRRKVHPNKVICLEMMLGSQKKKS
Function: Mediates ubiquitination and subsequent desumoylation/degradation of sumoylated proteins and proteins containing SUMO-like domains. Acts as a critical suppressor of gross chromosomal rearrangements (GCRs) during normal cell cycle progression. Involved in stabilizing, restarting or resolving transiently stalled replication forks. Prevents accumulation of DNA damage during cell cycle progression (By similarity). Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 29656 Sequence Length: 269 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Nucleus EC: 2.3.2.27
P40072
MARRPDNQNPEGENLRIKRVRLESVRQNDEEEENEVSRTQNIVTDNRHDSPEAVVEIIGERALENTSEEDGDDDLSLFRALEEDPGSDHNTSNNDSGNHDRETMHTEEPEASSGNNITLTNNVEELHTMDVLSQTANTPSASPMLDAAPPTTKPGTNSKEQTVDLTADAIDLDAEEQQVLQISDDDFQEETKEAPKEYGAAKDYRCPICFEPPETALMTLCGHVFCCPCLFQMVNSSRTCRQFGHCALCRSKVYLKDVRLIILRKKQVKKKVKS
Function: Component of the SUMO-targeted ubiquitin ligase (STUbL) complex SLX5/SLX8 that mediates ubiquitination and subsequent desumoylation of sumoylated proteins and proteins containing SUMO-like domains for their degradation . The STUbL complex SLX5/SLX8 stimulates ubiquitin conjugating enzymes, including UBC1, UBC4, UBC5 and UBC13-MMS2, and mediates the proteolytic down-regulation of sumoylated proteins . The STUbL complex SLX5/SLX8 is involved in ubiquitin-mediated degradation of histone variant CSE4, preventing mislocalization to euchromatin . The complex plays an essential role in maintenance of chromosome stability and links SUMO-dependent ubiquitination to a centromere-specific function during mitosis . The complex is involved in proteolysis of spindle positioning protein KAR9 and ensures correct spindle function by regulating levels of microtubule-associated proteins . During replication, the complex helps to prevent DNA lesions via recombination and has a role in localizing the DNA damage protein DCD2 . The complex especially ubiquitinates the nuclease YEN1 and prevents persistent accumulation of a fraction of YEN1 associated with sites of activity in late G2/M and helps maintain the balance between pro- and anti-crossover pathways during homologous recombination . It is also involved in ubiquitin-mediated degradation of DNA repair proteins RAD52 and RAD57 . Finally, the complex is recruited to distinct genomic hotspots of non-H2B protein ubiquitination (ub-hotspots) by the sumoylated transcription factor-like protein EUC1 where it ubiquitinates EUC1 and presumably other targets . Catalytic Activity: S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. Sequence Mass (Da): 30764 Sequence Length: 274 Pathway: Protein modification; protein ubiquitination. Subcellular Location: Nucleus EC: 2.3.2.27
Q9UHJ3
MNGEQQLDADAGSGMEEVELSWEDYLEETGSTAVPYGSFKHVDTRLQNGFAPGMKLEVAVRTDPETYWVATVITTCEQLLLLRYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKVFDEKYFLVEMDDLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPGYPSQDFDWADYLKQCGAEAAPQRCFPPLISEHEFKENMKLEAVNPILPEEVCVATITAVRGSYLWLQLEGSKKPIPECIVSVESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVHEGLRNQELNSTESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKGKSYRATVEIVKTADRVTEFCRQTCIKLECCPNLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGSGGEDEDDPDEGDDDSLSEGSTSEQQDELQEESEMSEKKSCSSSPTQSEISTSLPPDRQRRKRELRTFSFSDDENKPPSPKEIRIEVAERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN
Function: Histone-binding protein, which is part of various corepressor complexes. Mediates the recruitment of corepressor complexes to target genes, followed by chromatin compaction and repression of transcription. Plays a role during myogenesis: required for the maintenance of undifferentiated states of myogenic progenitor cells via interaction with MYOD1. Interaction with MYOD1 leads to the recruitment of associated corepressors and silencing of MYOD1 target genes. Part of the SLC complex in germ cells, where it may play a role during spermatogenesis. Sequence Mass (Da): 98141 Sequence Length: 866 Domain: The MBT repeats mediate binding to histones tails; however, in contrast to other MBT repeats, does not bind specific histone lysine modifications. The MBT repeats lack the conserved Asp and aromatic cage at conserved positions . Subcellular Location: Nucleus
Q9MA17
MEIGSSSTVAGGGQLSVPPGFRFHPTEEELLYYYLKKKVSYEPIDLDVIREVDLNKLEPWELKEKCRIGSGPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKSIHLNSSKKIGLRKTLVFYTGRAPHGQKTEWIMHEYRLDDSENEIQEDGWVVCRVFKKKNHFRGFHQEQEQDHHHHHQYISTNNDHDHHHHIDSNSNNHSPLILHPLDHHHHHHHIGRQIHMPLHEFANTLSHGSMHLPQLFSPDSAAAAAAAAASAQPFVSPINTTDIECSQNLLRLTSNNNYGGDWSFLDKLLTTGNMNQQQQQQVQNHQAKCFGDLSNNDNNDQADHLGNNNGGSSSSPVNQRFPFHYLGNDANLLKFPK
Function: Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. Sequence Mass (Da): 42382 Sequence Length: 371 Domain: The NAC domain includes a DNA-binding domain and a dimerization domain. Subcellular Location: Nucleus
C0NUU1
MTPLLRTICAILCILIAVPLTFACPTKAGVSKQANKRPTYAIAHMVLDRKGLKDAIKNGANSVEIDIAAYKEGWWADHDIRGRSWGDSLEDMFKAVAKESKNIAFVWLDLKTPDMCSGATCNKDVLDPSKCKPKDKCSMNSLQELAQKILNPAGVRILYGFFGAGATDSAGFNYIQGNLKAGEAVCLSGEVENVLNVYKKKGRGVKPQQRVMDYGYTQLETGFGNCKEKGYNTCAGLRNGAKARDKGDVKRVFGWTSRVGDGERVGQLLDKAHVDGIIYGFAITRYYDHEDSRAAARDITQRVQKSDDRYMATGADKPW
Cofactor: Binds 1 Mg(2+) ion per subunit. Function: Catalyzes the hydrolysis of sphingomyelin. Sphingomyelinases D are produced by some spider in their venoms, but also by arthropods such as ticks, or pathogenic bacteria and fungi. They might play a role in pathogenicity through different mechanisms, such as membrane destabilization and host cell penetration, but also pulmonary inflammation and cutaneous lesions. Catalytic Activity: a sphingomyelin + H2O = an N-acylsphing-4-enine 1-phosphate + choline + H(+) Sequence Mass (Da): 35095 Sequence Length: 319 Domain: The SMD-tail motif is highly conserved and may be responsible for structural stabilization. Subcellular Location: Secreted EC: 3.1.4.41
D4AZV8
MVSLLRLCSFLLAAGSILVQGSPIIAPSIPPCEPPSNFTGPSNFTSRPGNGASPFWLIAHRVLTKDGVKAALGHGANALEMDITGWWSGWFGDHDGLLTSAGDTVSDLFDEIASRRTQGDPVSFVWLDLKNPDFNKNGVNIVSLMILCREKLEKVGVRVLYGFYSSQTNGPSFKFVKQVMNENEAIGIDGKFETVEKDFEEKGIPLQKRVFSSGLFNPDFNFGNCEVHSSGVCAQLREGKESHEFSKVFGWTVSSYTRKDHVYKMMEVGVDGLIYGFVASHYYDHADIRHTLSTIRGWLEEHKDTHRLATVDDNPWSSMSKKGSSKSSWVKGEVPSIAH
Cofactor: Binds 1 Mg(2+) ion per subunit. Function: Catalyzes the hydrolysis of sphingomyelin. Sphingomyelinases D are produced by some spider in their venoms, but also by arthropods such as ticks, or pathogenic bacteria and fungi. They might play a role in pathogenicity through different mechanisms, such as membrane destabilization and host cell penetration, but also pulmonary inflammation and cutaneous lesions. Catalytic Activity: a sphingomyelin + H2O = an N-acylsphing-4-enine 1-phosphate + choline + H(+) Sequence Mass (Da): 37485 Sequence Length: 339 Domain: The SMD-tail motif is highly conserved and may be responsible for structural stabilization. Subcellular Location: Secreted EC: 3.1.4.41
B8NQ51
MQSISVLICVLLALSILNFTVASLTQRPIYAIAHRVLRNEAVTAALSHGANALEVDLTAWYFGWWADHDGKLFSAGSTARDLFKFIAQKQWTKDYNISFVWLDIKNPDFCRKGRPCSIEALRDLAREILEPAGIRVLYGFFETAESRGFKVIRDGLNSNEAVVLSGETSTILHLYNISGAGIPVKQMVMDFGDSWLRKGVDIYPELRYGSWKRDHGKLGKVFSWTSAQGDTEMVRYLLREAGIDGLIYGYQTDEYNDKSGPKSALKDIVDFVEAHSDTHRMATEDDAPW
Cofactor: Binds 1 Mg(2+) ion per subunit. Function: Catalyzes the hydrolysis of sphingomyelin. Sphingomyelinases D are produced by some spider in their venoms, but also by arthropods such as ticks, or pathogenic bacteria and fungi. They might play a role in pathogenicity through different mechanisms, such as membrane destabilization and host cell penetration, but also pulmonary inflammation and cutaneous lesions. Catalytic Activity: a sphingomyelin + H2O = an N-acylsphing-4-enine 1-phosphate + choline + H(+) Sequence Mass (Da): 32525 Sequence Length: 289 Domain: The SMD-tail motif is highly conserved and may be responsible for structural stabilization. Subcellular Location: Secreted EC: 3.1.4.41
J3K844
MVSLSLLLCSALAGLLHVASCIDVPDQAPLTVDECKCKPTSPKPVYAIAHRVLTEEGIQAAIAHGANAIEIDMTAWKSGWWADHDGLPTSGNVTAKAMFREVARLREDGAHLSFVWLDIKNPDWAISGRSSVAYLRKLAREYLEPAGVRVLYGFSNPRNSWGFKEIRNFLNANESVSVWMDSGDAKKIYAGVGRSIPVAQRVVDNGLFSLFWKPYIFDDLRRSSEARDCCTVGKAFGWTILAGQDRYVDKLLGYSGVDGLIYGTMASAYEDSEDTRAAAALISNWIKNHPDTHRVPTQDDKPW
Cofactor: Binds 1 Mg(2+) ion per subunit. Function: Catalyzes the hydrolysis of sphingomyelin. Sphingomyelinases D are produced by some spider in their venoms, but also by arthropods such as ticks, or pathogenic bacteria and fungi. They might play a role in pathogenicity through different mechanisms, such as membrane destabilization and host cell penetration, but also pulmonary inflammation and cutaneous lesions. Catalytic Activity: a sphingomyelin + H2O = an N-acylsphing-4-enine 1-phosphate + choline + H(+) Sequence Mass (Da): 33481 Sequence Length: 303 Domain: The SMD-tail motif is highly conserved and may be responsible for structural stabilization. Subcellular Location: Secreted EC: 3.1.4.41
C4JUE5
MLLSSLISLALLSSQVVADPAWAPPDKGLKPEVARLLPPFLRYRRPIYAIAHRVVTVGGIKDAISHGANAFEVDMCADSIGEGWWANHDCTNGRKAGDSARKIFETFAAERKRGKTVTFVWLDFKNPDACVKNQGCSIEAIQQLCRDILEKQGIRVLYGFYKAEDSRAFKTIRNNLNDREAISLNGATTKVLKLFEGTAPKVSKHQRVMDYGDTYLDKGFGDCTEKDWYTCTELRQGADLRRKGKLGKVFAWTSTVNQGRLVDQLLGKAHVDGIIYGFKLTDYYDHADSRAAANDIISWVKRRRALYYMATNDNNPWIDIHKLFLYLLSWFSCILLLMMNEWTCPQDGA
Cofactor: Binds 1 Mg(2+) ion per subunit. Function: Catalyzes the hydrolysis of sphingomyelin. Sphingomyelinases D are produced by some spider in their venoms, but also by arthropods such as ticks, or pathogenic bacteria and fungi. They might play a role in pathogenicity through different mechanisms, such as membrane destabilization and host cell penetration, but also pulmonary inflammation and cutaneous lesions. Catalytic Activity: a sphingomyelin + H2O = an N-acylsphing-4-enine 1-phosphate + choline + H(+) Sequence Mass (Da): 39447 Sequence Length: 349 Domain: The SMD-tail motif is highly conserved and may be responsible for structural stabilization. Subcellular Location: Secreted EC: 3.1.4.41
P38925
MVNVGPSHAAVAVDASEARKRNISEEVFELRDKKDSTVVIEGEAPVRTFTSSSSNHEREDTYVSKRQVMRDIFAKYLKFIGPGLMVSVAYIDPGNYSTAVDAGASNQFSLLCIILLSNFIAIFLQCLCIKLGSVTGLDLSRACREYLPRWLNWTLYFFAECAVIATDIAEVIGTAIALNILIKVPLPAGVAITVVDVFLIMFTYKPGASSIRFIRIFECFVAVLVVGVCICFAIELAYIPKSTSVKQVFRGFVPSAQMFDHNGIYTAISILGATVMPHSLFLGSALVQPRLLDYDVKHGNYTVSEEQDKVKKSKSTEEIMEEKYFNYRPTNAAIKYCMKYSMVELSITLFTLALFVNCAILVVAGSTLYNSPEADGADLFTIHELLSRNLAPAAGTIFMLALLLSGQSAGVVCTMSGQIVSEGHINWKLQPWQRRLATRCISIIPCLVISICIGREALSKALNASQVVLSIVLPFLVAPLIFFTCKKSIMKTEITVDHTEEDSHNHQNNNDRSAGSVIEQDGSSGMEIENGKDVKIVYMANNWIITVIAIIVWLFLSLLNVYAIVQLGMSHGDIS
Function: High-affinity manganese transporter involved in manganese uptake from the extracellular environment. Contributes also to cellular accumulation of other divalent metal ions such as cadmium, cobalt, copper, iron and nickel. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 63264 Sequence Length: 575 Subcellular Location: Cell membrane
P38778
MTSQEYEPIQWSDESQTNNDSVNDAYADVNTTHESRRRTTLQPNSTSQSMIGTLRKYARFIGPGLMVSVSYMDPGNYSTAVAAGSAHRYKLLFSVLVSNFMAAFWQYLCARLGAVTGLDLAQNCKKHLPFGLNITLYILAEMAIIATDLAEVVGTAISLNILFHIPLALGVILTVVDVLIVLLAYKPNGSMKGIRIFEAFVSLLVVLTVVCFTVELFYAKLGPAKEIFSGFLPSKAVFEGDGLYLSLAILGATVMPHSLYLGSGVVQPRLREYDIKNGHYLPDANDMDNNHDNYRPSYEAISETLHFTITELLISLFTVALFVNCAILIVSGATLYGSTQNAEEADLFSIYNLLCSTLSKGAGTVFVLALLFSGQSAGIVCTLSGQMVSEGFLNWTVSPALRRSATRAVAITPCLILVLVAGRSGLSGALNASQVVLSLLLPFVSAPLLYFTSSKKIMRVQLNRTKELSRTTDKKPVADRTEDDETIELEEMGIGSSSQERSLVSPAPEYKDMSNGMIVTVLAIIVWLIISGLNFYMLLGFTTGKEVHL
Function: High-affinity manganese transporter involved in mobilizing manganese from vesicular stores iin conditions of low manganese ion concentrations. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 59768 Sequence Length: 549 Subcellular Location: Vacuole membrane
Q12078
MRSYMQILQKFAKFIGPGILVSVAYMDPGNYATSVSGGAQYKYTLLFSIFISNIFAVLLQCLCVKLGTITGYDLAENCRHNLPKKLNYTLYLFAEVAIIATDLAEVVGTAIALQILFKIPLTWGVLLTVLDVLVILMFYTPNGQSLKKVRVFEFGVGILVIGTCICFVLELFKVSIPDKAELFKGFLPSNIIFKEQQALYISLGILGATVMPHSLYLGSSIVKPRLHDYDLKKYGKVNARPSLSAIKYTLNYAYAELIISLFLIATFVNSAILIVAGATLSGQPEAEDADLLSIYKLLVHYISPAAGLIFALAMLCSGQSAGIICTLAGQIVSEGFLQWSLPPWATRLCTRLIAIVPCLFVTLTMGEKGISDILNFSQVVLSLILPIVSAPLIYFTANRKLMVVHDENGVVRAPADVNAIADETTPLNSKHSKIVDFTNSRLLTYTSVFVWALIGSLNCYLVISYLLGADIHF
Function: Has a role in controlling the cellular iron ion levels. Mobilizes vacuolar stores of iron in conditions of low iron levels. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 51775 Sequence Length: 473 Subcellular Location: Vacuole membrane
B0R061
MSFFNLDRFRFQRDNAVGIHRKSPDGSNSDKENKQAHQRKADGQFPSGKTSRQVLEDVSSDDEVVRMGKDSASDLQQHINKDMEDKIIKLLEIFPQKSKKDLLEVIENTSTLDGAVAHCLMIYGDEDSGGRKDKGGRSDDDDQPKKKRKIQRSDSSESEDEDSEDEESEEPSREKQEALLKKLKRKLPDIEKEVLRDILKEHDWDYENALGSLLVFSSTDTSSPENQKSKQKSKSSHSKEKTDKITQRPSGSSSLSRWLTAASSHVPEVSSMSALKTQKSALSKSTSKNSSFKRKRGDEMPLNDVSASEDEDEIDSDVDSMSDDQDSEDEDSISGTLQDKIIQFLQDASLDELALISGCSIKKAQKIISLRPFNTWKDVKEQFFKDNGLSIDLVHGCKVVLKERQVVLDLMGRCEKIAQKMTKDVTQVIEAGMGSIKQPKVLNSNLKLQAYQLIGLKWLILLHQHKLSGILADEMGLGKTIQAIAFLAHLYEKGIKGPHLITVPSSTLDNWVRELGLWCPSLKVLIYYGSVEDRKYLRQDILTGLIDFNIIVSTYNLTIGNDHDRSLFRKLKLKYAVFDEGHMLKNMNSLRYRHLMTINAEHRLLLTGTPLQNNLLELMSLLNFIMPSMFSSSTSQISKMFSTRSSEEESSFHKDRIAQARLIMKPFILRRVKSEVLKELPPKMEKIEMCPMSDAQHKLYDILFKRLKKTPNGDKRELCNVMMQLRKMANHPLLHRQYYTSDKLAAMSKAMLKEPTHYDADPALIQEDMEVMSDFELHNLCREYSSISGFQLEKALILDSGKFALLTKTLAKLKEKGDRVVLFSQFTMMLDIVEILLKHLDHQYVRLDGSTPMAERIGLIDKYNTNPEIFVFLLSTRAGGQGINLASANTVILHDIDCNPFNDKQAEDRCHRMGQTRTVQVIKLISKDSIEDCMLRVGQEKLKLEQDMTTDEGEDGAITEQMAELLKVSLGL
Function: DNA helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity and is both required for DNA repair and heterochromatin organization. Promotes DNA end resection of double-strand breaks (DSBs) following DNA damage: probably acts by weakening histone DNA interactions in nucleosomes flanking DSBs. Required for the restoration of heterochromatin organization after replication (By similarity). Catalytic Activity: ATP + H2O = ADP + H(+) + phosphate Sequence Mass (Da): 110346 Sequence Length: 972 Subcellular Location: Nucleus EC: 3.6.4.12
Q9U3D4
MSVTVEVADEETHDVPLVEQVRTTPDQNVDVKVQENNVVTTKIGPKLETIPAAKMQDDNGDEEKAENSEGAAAEKVEKQHDDDGVVVHEETDGVASSRSSHHDKQKPGETKKSGDGKMDDDDIITTARSSSRRICGSAASSSDSETADDAPLLPDEGPSHAVRLEMPGDKPASPHDRFPKTPLKTLVAFLMLVVAAAGNTITLSWIHERYPLTPPLPDIVFELIPKIPWGLRLCENLMIGSFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTPVPKADEDFECSPRFGENATFSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHWLSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFWFPLLRWFEGDIRRPVPRRFDCPISYSQVCNAFRRVRPRGRNGAARPAFE
Function: Sphingomyelin synthases (SM synthase or SMS) synthesize the sphingolipid sphingomyelin (SM) through transfer of the phosphatidyl head group of 1,2-diacyl-sn-glycero-3-phosphocholine (phosphatidylcholine, PC) on to the primary hydroxyl of ceramide (N-acylsphingoid base), yielding 1,2-diacyl-sn-glycerol (diacylglycerol, DAG) as a side product. Functions as a bidirectional lipid cholinephosphotransferases capable of converting PC and ceramide to SM and DAG and vice versa depending on the respective levels of ceramide and DAG as phosphocholine acceptors, respectively. Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine + an N-acylsphing-4-enine = a 1,2-diacyl-sn-glycerol + a sphingomyelin Location Topology: Multi-pass membrane protein Sequence Mass (Da): 52642 Sequence Length: 469 Pathway: Lipid metabolism; sphingolipid metabolism. Subcellular Location: Golgi apparatus membrane EC: 2.7.8.27
Q7T3T4
MSGRMKEVVSWSPEEVTNWLMENAVPEYCEPLKSFTGQDLINLTEEDFKKTPLSRVSSDSGQQLLHMIETLKMAHHIEAHKNGHVNGHIHVSVNNTAHENGFSSKTKLNGVPNGYKKEMIKIPMPEPERLQYPMEWGKTFLAFIYALFCFIFTTVTISVVHERVPPKEVQPPLPDAFFDRFDRVQWAFSICEINGMILVGLWLVQWLLLKYKSIISRRFFCIVCTLYLYRCITMYVTTLPVPGMHFKCSPKLFGDWESHLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVILTLTYLFIKEYSPRRLWWYHWLCWTLSMVGMFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQVLKEASQTNLLARVWWYKPFQYFEKNVQGIVPRSYHWPFPWPVLHRGRQVKYSRLVNDT
Function: Sphingomyelin synthases synthesize the sphingolipid, sphingomyelin, through transfer of the phosphatidyl head group, phosphatidylcholine, on to the primary hydroxyl of ceramide. The reaction is bidirectional depending on the respective levels of the sphingolipid and ceramide. Golgi apparatus SMS1 directly and specifically recognizes the choline head group on the substrate, requiring two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. Major form in macrophages. Required for cell growth in certain cell types. Suppresses BAX-mediated apoptosis and also prevents cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. May protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide (By similarity). Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine + an N-acylsphing-4-enine = a 1,2-diacyl-sn-glycerol + a sphingomyelin Location Topology: Multi-pass membrane protein Sequence Mass (Da): 49014 Sequence Length: 417 Subcellular Location: Golgi apparatus membrane EC: 2.7.8.27
Q86VZ5
MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPMPELERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGLWLIQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGMHFNCSPKLFGDWEAQLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYLFIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQVLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT
Function: Major sphingomyelin synthase at the Golgi apparatus . Catalyzes the reversible transfer of phosphocholine moiety in sphingomyelin biosynthesis: in the forward reaction transfers phosphocholine head group of phosphatidylcholine (PC) on to ceramide (CER) to form ceramide phosphocholine (sphingomyelin, SM) and diacylglycerol (DAG) as by-product, and in the reverse reaction transfers phosphocholine from SM to DAG to form PC and CER. The direction of the reaction depends on the levels of CER and DAG in Golgi membranes . Does not use free phosphorylcholine or CDP-choline as donor . Regulates receptor-mediated signal transduction via mitogenic DAG and proapoptotic CER, as well as via SM, a structural component of membrane rafts that serve as platforms for signal transduction and protein sorting . Plays a role in secretory transport via regulation of DAG pool at the Golgi apparatus and its downstream effects on PRKD1 . Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine + an N-acylsphing-4-enine = a 1,2-diacyl-sn-glycerol + a sphingomyelin Location Topology: Multi-pass membrane protein Sequence Mass (Da): 48617 Sequence Length: 413 Pathway: Sphingolipid metabolism. Subcellular Location: Golgi apparatus membrane EC: 2.7.8.27
Q20735
MTNSSEFTDVLQSRDPCVSNGIVINIDPIDPEPTPIRKEFTCEDTFHHEHHGNSEGFKTLTAFLCLMLSAFLNFFLLTVIHDVVPRQPLPDLTFMIIPQQRWAWSVGDVLSTVSSVVAFTIIFLHHQRWIVLRRTFLLGAIMYGLRAVILGVTFLPPSFHNRDEICQPQVNRTAMYGMEIATRFLTYVITLGLTSGQDKILCGDLMFSGHTVVLTIMYFVQLQYTPRGLVILRYIAAPITFLGIAALVVSGGHYTMDVLIAYWLTSHVFWSYHQIFEMRKDDRPQAPLSRLWWFWLCYWFESDVADGKLVNKWNWPLEGPQRMHTIMNRINYKLQ
Function: Sphingomyelin synthases (SM synthase or SMS) synthesize the sphingolipid sphingomyelin (SM) through transfer of the phosphatidyl head group of 1,2-diacyl-sn-glycero-3-phosphocholine (phosphatidylcholine, PC) on to the primary hydroxyl of ceramide (N-acylsphingoid base), yielding 1,2-diacyl-sn-glycerol (diacylglycerol, DAG) as a side product. Functions as a bidirectional lipid cholinephosphotransferases capable of converting PC and ceramide to SM and DAG and vice versa depending on the respective levels of ceramide and DAG as phosphocholine acceptors, respectively. Catalytic Activity: a 1,2-diacyl-sn-glycero-3-phosphocholine + an N-acylsphing-4-enine = a 1,2-diacyl-sn-glycerol + a sphingomyelin Location Topology: Multi-pass membrane protein Sequence Mass (Da): 38737 Sequence Length: 335 Pathway: Lipid metabolism; sphingolipid metabolism. Subcellular Location: Membrane EC: 2.7.8.27
Q7ZXV5
MGQPEGLERFDSPGKGRGLKATRSFALGELLFTCPAYTYVLTDTERGNHCDFCFARKEGLSKCGKCKQAFYCNVDCQKGDWPMHKLECSAMCSYGQNWCPSETVRLTARILAKQKTQTERTPSETFLSVKEFESHLSKLDNEKKELIESDIAALHRFYSKNLHYTDNAALVFLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNIIVTFKGTVAEIRAVQEIHAGDEVFTSYIDLLYPTEDRNDRLMDSYFFTCDCRECSTKQKDPAKLEIRKLSDPPSHQTVKDMIKYARNIVEEFRRAKHYKTPSELLEMCELSLDKMGSVFVDSNVYMLHMMYQAMGVCLYLQEWDGALKYGEKIIKPYSKHYPAYSLNVASMWLKLGRLYMGLEKTTIGTKALKKALAIMQIAHGPDHHYIAEIKKELEL
Function: Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'. Catalytic Activity: L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 49119 Sequence Length: 430 Subcellular Location: Cytoplasm EC: 2.1.1.-
Q5RGL7
MMKAEGIPGIEQFASPGKGRGLRVSRAYGVGELLFSCPAYSYVLSVGERGLICEQCFTRKKGLAKCGKCKKAFYCNANCQKKNWPMHKLECQAMCAFGENWRPSETVRLVARIIARLKAQKERSPSEILLLLGEMEAHLEDMDNEKREMTEAHIAGLHQFYSKHLDFPDHQALLTLFSQVHCNGFTVEDEELSNLGLAIFPDIALLNHSCSPNVIVTYRGINAEVRAVKDISPGQEIYTSYIDLLYPTADRLERLRDMYYFSCDCKECTTKSMDVVKMSVRKRSDEIGEKEIKDMVRYARNSMENFRRAKQDKSPTELLEMCELSIDKMSTVFDDSNVYILHMMYQAMGICLFTEDYEGAVRYGEKVIKPFTVLYPAYSMNVASMFLKLGRLYIALDRKLAGIDAFQKALTIMEVVHGKDHTYVTELKQEMRDF
Function: Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'. Catalytic Activity: L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 49630 Sequence Length: 434 Subcellular Location: Cytoplasm EC: 2.1.1.-
Q8NB12
MTIGRMENVEVFTAEGKGRGLKATKEFWAADIIFAERAYSAVVFDSLVNFVCHTCFKRQEKLHRCGQCKFAHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQKKLKDDLFLGVKDNPKPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNIYMLRMLSIVSEVLSYLQAFEEASFYARRMVDGYMKLYHPNNAQLGMAVMRAGLTNWHAGNIEVGHGMICKAYAILLVTHGPSHPITKDLEAMRVQTEMELRMFRQNEFMYYKMREAALNNQPMQVMAEPSNEPSPALFHKKQ
Function: Methylates histone H3 at 'Lys-4' (H3K4me), seems able to perform both mono-, di-, and trimethylation. Acts as a transcriptional repressor. Essential for cardiomyocyte differentiation and cardiac morphogenesis. Catalytic Activity: L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 56617 Sequence Length: 490 Domain: The SET domain is split between the S-sequence (residues 1-49) and the core SET domain (residues 181-258), however the two segments still come together to form a conserved SET domain fold. Subcellular Location: Cytoplasm EC: 2.1.1.354
E1C5V0
MRSEAVPQPGGLERFASPGKGRGLRALRRYAVGELLFSCPAYTAVLTVSERGSHCDGCFARKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECAAMCAFGQNWNPSETVRLTARILAKQKIHPERTQSEKLLAVKEFESHLDKLDNEKRELIQNDIAALHHFYSKHMEYPDNAALVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVKEIEPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCDCRECTMKEKDKEKLKIRKLNDPPSAEAVRDMIKYARNVIEEFRRAKHYKPPSELLEICELSLDKMGAVFEDSNVYMLHMMYQAMGVCLYVQDWEGALRYGQKIIRPYSKHYPSYSLNVASMWLKLGRLYMALENRPAGDKALKKAIAIMEVAHGKDHPYISEIKKELEDH
Function: Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'. Catalytic Activity: L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 49947 Sequence Length: 436 Subcellular Location: Cytoplasm EC: 2.1.1.-
Q9NRG4
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Function: Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'. Catalytic Activity: L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 49688 Sequence Length: 433 Subcellular Location: Cytoplasm EC: 2.1.1.-
Q9H7B4
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS
Function: Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but not monomethylation . Also methylates 'Lys-5' of histone H4 . Plays an important role in transcriptional activation as a member of an RNA polymerase complex . Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences . Catalytic Activity: L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine Sequence Mass (Da): 49097 Sequence Length: 428 Subcellular Location: Cytoplasm EC: 2.1.1.354
Q5F3V0
MALPVEEWRRSAARCWAALEPALRERLAAAPLGEALRMGCGLFGPEEAALQRLCRRARTGKEPAAARFYREEGNRQFGRCCYRDAVRLYSQAAAHEPPRSPEVALCFANRSAALFHLGHFEVCLEDIARAESHGYPDRLLPKVLLRKAECLLRLGRLQDATDTLTAVENKMAVDGIMTSPIHRMLLKKLSQLKTEIHEGSCPEPAREADGDVQRESEIWEENGSISGASSSLSLNFSTERGRHLVASQDILPGQNLLKEKAFVSVLCPGEGDSLLLQDSSETVWDTRVTNADLYCHHCLKQLLASIPCCGCSYAKYCSQNCADVAWEQYHRTECPLGALLLTLGVFFHVALRTVLLAGFSEVSRLVEWSRDDSNKDLCNAEAGGEHPSEALDTRAGRKVIPGCNDNGQYQSSYQAVFNLLPHVEKHSPEHKFLCMLSIVAICKKLQETGLEAAVLNGESSTTGSEQKTCGKTSDELSPELMIMAEAMLRHVLQLQCNAQAITVMQELESGDGAVVNKKPVRLATAFFPVLSLLNHSCSPNISVSFSGTAATVRASQPIPSGQEIFHCYGEEMLCCSSEACAFSVSRERLSQRLLDLQQQMEKALELLRDSKADEAIKMLLKCQIDARNFLSPEHLLMGELEDHLAQVYATLGKWQEAARHLGRSIQLVEMHHGPSSVEMGHELFKLAQILFNGFAVSEALSTIQRAEEILSVHCGPQSTQIQELQEMKTCLLELPRSILQRT
Function: Plays a critical role in cardiac development. Acts as a key epigenetic regulator of gene expression during cardiac development via its dual activities as a methyltransferase and negative regulator of HDAC1. Sequence Mass (Da): 82027 Sequence Length: 742 Subcellular Location: Nucleus EC: 2.1.1.-
Q08C84
MDLPCQDWVCHVEQKWAELRSEETERFSLLTDIDAIFNYGLSLICPEDLNILSRISEKFSVKKSPETASEFRQQGNLSFKVKDYPAAVLHYSKGVCHADKNTDELSLCYANRSAALFYQGLYQACLEDIRRSLEAGYPSHLQDKLQTRQTACQNQLRKAEKPNIPHTDHQLSPCQKTVNSTGHLSDGVSVYFSSDKGRHMLVMENKPAGEVVLEDEAYCSVLIPANIFNTGTNKAVETFGTEDRHCHHCLSQSLSFVPCPKCSYARYCGESCQKDAWDQWHQWECPVGADLLAIGVLGHLALRVVLKAGQTEVQMGIKNTKDHVTTYKNDSPVQLSLGGDCGKSLDHTDCFHGSSYMGIYSLLPHVAQHSPASRFLMAITMAVIYGKLQGGPPPNKWMSFKDEGVKASWQPEMSMLGATALRHMMQLRCNAQAITAVRVKEESGMAVQSSSEIRIATAIFPVLSLLNHSCSPNTSISFTTGFQPDPHNQLGCSEGHFDHPKGSRSGVTVTVRASKDLTAGQEILHCYGPHRSRMEVKERQRLLLEQYFFQCVCQACQRDLSEGSPNAKEHTAPGMKCVKCGKPLQSHTDGYTCSWSSCGHQISSADVQNRLQGFQLLLDEAVHLMEQDRLNEALHILQSAFSQANSILTETHPFQGELADALARLYASTGEWSLAASHLKRSLVAIQAQFGEDSIELGRQLFKLAQLHFNGRDGVASLSVIPRARRLLSLHCSPRCEELQELSEMEHCLQGLL
Function: Plays a critical role in cardiac development . Acts as a key epigenetic regulator of gene expression during cardiac development via its dual activities as a methyltransferase and negative regulator of HDAC1 . Sequence Mass (Da): 83677 Sequence Length: 753 Subcellular Location: Nucleus EC: 2.1.1.-
Q8IYR2
MDLPVDEWKSYLLQKWASLPTSVQVTISTAETLRDIFLHSSSLLQPEDELFLKRLSKGYLVGKDSDAPLFYREEGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDMSLCHANRSAALFHLGQYETCLKDINRAQTHGYPERLQPKIMLRKAECLVALGRLQEASQTISDLERNFTATPALADVLPQTLQRNLHRLKMKMQEKDSLTESFPAALAKTLEDAALREENEQLSNASSSIGLCVDPLKGRCLVATKDILPGELLVQEDAFVSVLNPGELPPPHHGLDSKWDTRVTNGDLYCHRCLKHTLATVPCDGCSYAKYCSQECLQQAWELYHRTECPLGGLLLTLGVFCHIALRLTLLVGFEDVRKIITKLCDKISNKDICLPESNNQVKTLNYGLGESEKNGNIVETPIPGCDINGKYENNYNAVFNLLPHTENHSPEHKFLCALCVSALCRQLEAASLQAIPTERIVNSSQLKAAVTPELCPDVTIWGVAMLRHMLQLQCNAQAMTTIQHTGPKGSIVTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTVATIRASQRIRKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCACPACQTEAHRMAAGPRWEAFCCNSCGAPMQGDDVLRCGSRSCAESAVSRDHLVSRLQDLQQQVRVAQKLLRDGELERAVQRLSGCQRDAESFLWAEHAVVGEIADGLARACAALGDWQKSATHLQRSLYVVEVRHGPSSVEMGHELFKLAQIFFNGFAVPEALSTIQKAEEVLSLHCGPWDDEIQELQKMKSCLLDLPPTPVGPAL
Function: Plays a critical role in cardiac development . Acts as a key epigenetic regulator of gene expression during cardiac development via its dual activities as a methyltransferase and negative regulator of HDAC1 (By similarity). Sequence Mass (Da): 89225 Sequence Length: 804 Subcellular Location: Nucleus EC: 2.1.1.-
Q12483
MKQFGLAAFDELKDGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQL
Function: Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Location Topology: Peripheral membrane protein Sequence Mass (Da): 26954 Sequence Length: 233 Subcellular Location: Cytoplasm
O43759
MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQGYQSQGY
Function: May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity (By similarity). Location Topology: Multi-pass membrane protein Sequence Mass (Da): 25456 Sequence Length: 233 Subcellular Location: Cytoplasmic vesicle
P46950
MTKSVGDEESQYIEDPSFAAAAAFTGGRDGVSYSNQRFAEGSGHSSDLAKSLEDYRPPDEKPSSLSSVGEGGANEEEKGGNDGGPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQSISAIIPSLLASVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANSEFNSSIFFESVFESGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGKKMQKNAMQAAEAAVAAATQRASRPAEANTDKNNNPPGN
Function: May function as a N-methyl-N'nitro-N-nitrosoguanidine (MNNG) export permease. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 61293 Sequence Length: 547 Subcellular Location: Membrane
O43760
MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
Function: May play a role in regulated exocytosis. In neuronal cells, modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in the formation and/or the maturation of this vesicles. May also play a role in GLUT4 storage and transport to the plasma membrane. PTM: May be tyrosine phosphorylated by Src. Location Topology: Multi-pass membrane protein Sequence Mass (Da): 24810 Sequence Length: 224 Subcellular Location: Cytoplasmic vesicle membrane