content
stringlengths 7
1.05M
| fixed_cases
stringlengths 1
1.28M
|
|---|---|
X = int(input())
Y = int(input())
soma = 0
if X > Y:
troca = Y
Y = X
X = troca
sam = X
while sam <= Y:
if sam%13 != 0:
soma = soma + sam
sam += 1
print(soma)
| x = int(input())
y = int(input())
soma = 0
if X > Y:
troca = Y
y = X
x = troca
sam = X
while sam <= Y:
if sam % 13 != 0:
soma = soma + sam
sam += 1
print(soma) |
pMMO_dna_seq = 'ATGAAAACTATTAAAGATAGAATTGCTAAATGGTCTGCTATTGGTTTGTTGTCTGCTGTTGCTGCTACTGCTTTTTATGCTCCATCTGCTTCTGCTCATGGTGAAAAATCTCAAGCTGCTTTTATGAGAATGAGGACTATTCATTGGTATGACTTATCTTGGTCTAAGGAAAAGGTTAAAATAAACGAAACTGTTGAGATTAAAGGTAAATTTCATGTTTTTGAAGGTTGGCCTGAAACTGTTGATGAACCTGATGTTGCTTTTTTGAATGTTGGTATGCCTGGTCCTGTTTTTATTAGAAAAGAATCTTATATTGGTGGTCAATTGGTTCCAAGATCTGTTAGATTGGAAATTGGTAAAACTTATGATTTTAGAGTTGTTTTGAAAGCTAGAAGACCTGGTGATTGGCATGTTCATACTATGATGAATGTTCAAGGTGGTGGTCCAATTATTGGTCCTGGTAAATGGATTACTGTTGAAGGTTCTATGTCTGAATTTAGAAATCCTGTTACTACTTTGACTGGTCAAACTGTTGATTTGGAAAATTATAATGAAGGTAATACTTATTTCTGGCACGCTTTTTGGTTCGCAATAGGCGTTGCCTGGATTGGATATTGGTCGAGGAGACCTATCTTCATACCAAGGTTATTGATGGTTGATGCTGGTAGAGCTGATGAATTGGTTTCTGCTACTGATAGAAAAGTTGCTATGGGTTTTTTGGCTGCTACTATTTTGATTGTTGTTATGGCTATGTCTTCTGCTAATTCTAAATATCCAATTACTATTCCATTGCAAGCTGGTACTATGAGAGGTATGAAACCATTGGAATTGCCTGCTCCAACTGTTTCTGTTAAAGTTGAAGATGCTACTTATAGAGTTCCTGGTAGAGCTATGAGAATGAAATTGACTATTACTAATCATGGTAATTCTCCAATTAGATTGGGTGAATTTTATACTGCTTCTGTTAGATTTTTGGATTCTGATGTTTATAAAGATACTACTGGTTATCCTGAAGATTTGTTGGCTGAAGATGGTTTGTCTGTTTCTGATAATTCTCCATTGGCTCCTGGTGAAACTAGAACTGTTGATGTTACTGCTTCTGATGCTGCTTGGGAAGTTTATAGATTGTCTGATATTATTTATGATCCTGATTCTAGATTTGCTGGTTTGTTGTTTTTTTTTGATGCTACTGGTAATAGACAAGTTGTTCAAATTGATGCTCCATTGATTCCATCTTTTATGTAAATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGCTGATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGGGCTACGGCCTGCAGTGCTTCGCCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCACCGCCGACAAGCAGAAGAACGGCATCAAGGCCAACTTCAAGATCCGCCACAACATCGAGGACGGCGGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCTACCAGTCCAAGCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAATTACTTGTACAGCTCGTCCATGCCGAGAGTGATCCCGGCGGCGGTCACGAACTCCAGCAGGACCATGTGATCGCGCTTCTCGTTGGGGTCTTTGCTCAGCTTGGACTGGTAGCTCAGGTAGTGGTTGTCGGGCAGCAGCACGGGGCCGTCGCCGATGGGGGTGTTCTGCTGGTAGTGGTCGGCGAGCTGCACGCCGCCGTCCTCGATGTTGTGGCGGATCTTGAAGTTGGCCTTGATGCCGTTCTTCTGCTTGTCGGCGGTGATATAGACGTTGTGGCTGTTGTAGTTGTACTCCAGCTTGTGCCCCAGGATGTTGCCGTCCTCCTTGAAGTCGATGCCCTTCAGCTCGATGCGGTTCACCAGGGTGTCGCCCTCGAACTTCACCTCGGCGCGGGTCTTGTAGTTGCCGTCGTCCTTGAAGAAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTTCATGTGGTCGGGGTAGCGGGCGAAGCACTGCAGGCCGTAGCCCAGGGTGGTCACGAGGGTGGGCCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATCAGCTTCAGGGTCAGCTTGCCGTAGGTGGCATCGCCCTCGCCCTCGCCGGACACGCTGAACTTGTGGCCGTTTACGTCGCCGTCCAGCTCGACCAGGATGGGCACCACCCCGGTGAACAGCTCCTCGCCCTTGCTCACCATTTACATAAAAGATGGAATCAATGGAGCATCAATTTGAACAACTTGTCTATTACCAGTAGCATCAAAAAAAAACAACAAACCAGCAAATCTAGAATCAGGATCATAAATAATATCAGACAATCTATAAACTTCCCAAGCAGCATCAGAAGCAGTAACATCAACAGTTCTAGTTTCACCAGGAGCCAATGGAGAATTATCAGAAACAGACAAACCATCTTCAGCCAACAAATCTTCAGGATAACCAGTAGTATCTTTATAAACATCAGAATCCAAAAATCTAACAGAAGCAGTATAAAATTCACCCAATCTAATTGGAGAATTACCATGATTAGTAATAGTCAATTTCATTCTCATAGCTCTACCAGGAACTCTATAAGTAGCATCTTCAACTTTAACAGAAACAGTTGGAGCAGGCAATTCCAATGGTTTCATACCTCTCATAGTACCAGCTTGCAATGGAATAGTAATTGGATATTTAGAATTAGCAGAAGACATAGCCATAACAACAATCAAAATAGTAGCAGCCAAAAAACCCATAGCAACTTTTCTATCAGTAGCAGAAACCAATTCATCAGCTCTACCAGCATCAACCATCAATAACCTTGGTATGAAGATAGGTCTCCTCGACCAATATCCAATCCAGGCAACGCCTATTGCGAACCAAAAAGCGTGCCAGAAATAAGTATTACCTTCATTATAATTTTCCAAATCAACAGTTTGACCAGTCAAAGTAGTAACAGGATTTCTAAATTCAGACATAGAACCTTCAACAGTAATCCATTTACCAGGACCAATAATTGGACCACCACCTTGAACATTCATCATAGTATGAACATGCCAATCACCAGGTCTTCTAGCTTTCAAAACAACTCTAAAATCATAAGTTTTACCAATTTCCAATCTAACAGATCTTGGAACCAATTGACCACCAATATAAGATTCTTTTCTAATAAAAACAGGACCAGGCATACCAACATTCAAAAAAGCAACATCAGGTTCATCAACAGTTTCAGGCCAACCTTCAAAAACATGAAATTTACCTTTAATCTCAACAGTTTCGTTTATTTTAACCTTTTCCTTAGACCAAGATAAGTCATACCAATGAATAGTCCTCATTCTCATAAAAGCAGCTTGAGATTTTTCACCATGAGCAGAAGCAGATGGAGCATAAAAAGCAGTAGCAGCAACAGCAGACAACAAACCAATAGCAGACCATTTAGCAATTCTATCTTTAATAGTTTTCATTCATGAGATTATTGGAAACCACCAGAATCGAATATAAAAGGCGAACACCTTTCCCAATTTTGGTTTCTCCTGACCCAAAGACTTTTCATGAGATTATTGGAAACCACCAGAATCGAATATAAAAGGCGAACACCTTTCCCAATTTTGGTTTCTCCTGACCCAAAGACTTTTCATGAGATTATTGGAAACCACCAGAATCGAATATAAAAGGCGAACACCTTTCCCAATTTTGGTTTCTCCTGACCCAAAGACTTTAAAGTCTTTGGGTCAGGAGAAACCAAAATTGGGAAAGGTGTTCGCCTTTTATATTCGATTCTGGTGGTTTCCAATAATCTCATGAAAAGTCTTTGGGTCAGGAGAAACCAAAATTGGGAAAGGTGTTCGCCTTTTATATTCGATTCTGGTGGTTTCCAATAATCTCATGAAAAGTCTTTGGGTCAGGAGAAACCAAAATTGGGAAAGGTGTTCGCCTTTTATATTCGATTCTGGTGGTTTCCAATAATCTCATGAACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGTCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGTCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGTATGAAACTACTCTTACCATTATTGACACTCGTTGCTGTTGCTAAGGCCATGTCTGCTGCTCAATCTGCTGTTAGATCTCATGCTGAAGCTGTTCAAGTTTCTAGAACTATTGATTGGATGGCTTTGTTTGTTGTTTTTTTTGTTATTGTTGGTTCTTATCATATTCATGCTATGTTGACTATGGGTGATTGGGATTTTTGGTCTGATTGGAAAGATAGAAGATTGTGGGTTACTGTTACTCCAATTGTTTTGGTTACTTTTCCTGCTGCTGTTCAATCTTATTTGTGGGAAAGATATAGATTGCCATGGGGTGCTACTGTTTGTGTTTTGGGTTTGTTGTTGGGTGAATGGATTAATAGATATTTTAATTTTTGGGGTTGGACTTATTTTCCAATTAATTTTGTTTTTCCTGCTTCTTTGGTTCCTGGTGCTATTATTTTGGATACTGTTTTGATGTTGTCTGGTTCTTATTTGTTTACTGCTATTGTTGGTGCTATGGGTTGGGGTTTGATTTTTTATCCTGGTAATTGGCCAATTATTGCTCCATTGCATGTTCCTGTTGAAAATAATGGTATGTTGATGTCTATTGCTGATATTCAAGGTTATAATTATGTTAGAACTGGTACTCCTGAATATATTAGAATGGTTGAAAAAGGTACTTTGAGAACTTTTGGTAAAGATGTTGCGCCCGTTTCAGCTTTTTTTTCTGCGTTCATGTCTATATTGATATATTTTATGTGGCATTTCATTGGTAGATGGTTTTCTAATGAAAGATTTTTGCAATCTACTTAATTAAGTAGATTGCAAAAATCTTTCATTAGAAAACCATCTACCAATGAAATGCCACATAAAATATATCAATATAGACATGAACGCAGAAAAAAAAGCTGAAACGGGCGCAACATCTTTACCAAAAGTTCTCAAAGTACCTTTTTCAACCATTCTAATATATTCAGGAGTACCAGTTCTAACATAATTATAACCTTGAATATCAGCAATAGACATCAACATACCATTATTTTCAACAGGAACATGCAATGGAGCAATAATTGGCCAATTACCAGGATAAAAAATCAAACCCCAACCCATAGCACCAACAATAGCAGTAAACAAATAAGAACCAGACAACATCAAAACAGTATCCAAAATAATAGCACCAGGAACCAAAGAAGCAGGAAAAACAAAATTAATTGGAAAATAAGTCCAACCCCAAAAATTAAAATATCTATTAATCCATTCACCCAACAACAAACCCAAAACACAAACAGTAGCACCCCATGGCAATCTATATCTTTCCCACAAATAAGATTGAACAGCAGCAGGAAAAGTAACCAAAACAATTGGAGTAACAGTAACCCACAATCTTCTATCTTTCCAATCAGACCAAAAATCCCAATCACCCATAGTCAACATAGCATGAATATGATAAGAACCAACAATAACAAAAAAAACAACAAACAAAGCCATCCAATCAATAGTTCTAGAAACTTGAACAGCTTCAGCATGAGATCTAACAGCAGATTGAGCAGCAGACATGGCCTTAGCAACAGCAACGAGTGTCAATAATGGTAAGAGTAGTTTCATATGAAACTACTCTTACCATTATTGACACTCGTTGCTGTTGCTAAGGCCATGGCTGCTACTACTATTGGTGGTGCTGCTGCTGCTGAAGCTCCATTGTTAGATAAGAAATGGTTGACATTTGCTTTGGCTATATACACTGTTTTTTATTTGTGGGTTAGATGGTATGAGGGGGTTTATGGCTGGTCTGCTGGTTTGGATTCTTTCGCTCCGGAGTTTGAAACTTATTGGATGAATTTCTTGTATACGGAGATTGTTTTGGAAATTGTTACTGCTTCTATTTTGTGGGGTTACTTATGGAAAACTAGAGATAGAAATTTGGCTGCTTTGACTCCAAGAGAAGAATTGAGAAGAAATTTTACTCATTTGGTATGGTTGGTTGCTTATGCTTGGGCTATTTACTGGGGTGCTTCTTATTTTACTGAACAAGATGGTACTTGGCACCAAACAATAGTTAGGGACACTGATTTTACACCTTCTCATATTATTGAATTCTATTTGTCTTACCCAATTTATATTATTACTGGGTTTGCTGCTTTTATTTATGCTAAAACTAGATTGCCATTTTTTGCTAAAGGTATTTCTTTGCCATATTTGGTTTTGGTTGTTGGTCCATTTATGATTTTGCCAAATGTTGGTTTGAATGAATGGGGTCATACTTTTTGGTTTATGGAAGAATTGTTTGTTGCTCCATTGCATTATGGTTTTGTTATTTTCGGTTGGTTGGCTTTGGCTGTTATGGGTACTTTGACTCAAACTTTTTATAGATTTGCTCAAGGTGGTTTGGGTCAATCTTTGTGTGAAGCTGTTGATGAAGGTTTGATTGCTAAATAATTATTTAGCAATCAAACCTTCATCAACAGCTTCACACAAAGATTGACCCAAACCACCTTGAGCAAATCTATAAAAAGTTTGAGTCAAAGTACCCATAACAGCCAAAGCCAACCAACCGAAAATAACAAAACCATAATGCAATGGAGCAACAAACAATTCTTCCATAAACCAAAAAGTATGACCCCATTCATTCAAACCAACATTTGGCAAAATCATAAATGGACCAACAACCAAAACCAAATATGGCAAAGAAATACCTTTAGCAAAAAATGGCAATCTAGTTTTAGCATAAATAAAAGCAGCAAACCCAGTAATAATATAAATTGGGTAAGACAAATAGAATTCAATAATATGAGAAGGTGTAAAATCAGTGTCCCTAACTATTGTTTGGTGCCAAGTACCATCTTGTTCAGTAAAATAAGAAGCACCCCAGTAAATAGCCCAAGCATAAGCAACCAACCATACCAAATGAGTAAAATTTCTTCTCAATTCTTCTCTTGGAGTCAAAGCAGCCAAATTTCTATCTCTAGTTTTCCATAAGTAACCCCACAAAATAGAAGCAGTAACAATTTCCAAAACAATCTCCGTATACAAGAAATTCATCCAATAAGTTTCAAACTCCGGAGCGAAAGAATCCAAACCAGCAGACCAGCCATAAACCCCCTCATACCATCTAACCCACAAATAAAAAACAGTGTATATAGCCAAAGCAAATGTCAACCATTTCTTATCTAACAATGGAGCTTCAGCAGCAGCAGCACCACCAATAGTAGTAGCAGCCATGGCCTTAGCAACAGCAACGAGTGTCAATAATGGTAAGAGTAGTTTCAT'
pMMO_rna_seq = 'UUAAGUAGAUUGCAAAAAUCUUUCAUUAGAAAACCAUCUACCAAUGAAAUGCCACAUAAAAUAUAUCAAUAUAGACAUGAACGCAGAAAAAAAAGCUGAAACGGGCGCAACAUCUUUACCAAAAGUUCUCAAAGUACCUUUUUCAACCAUUCUAAUAUAUUCAGGAGUACCAGUUCUAACAUAAUUAUAACCUUGAAUAUCAGCAAUAGACAUCAACAUACCAUUAUUUUCAACAGGAACAUGCAAUGGAGCAAUAAUUGGCCAAUUACCAGGAUAAAAAAUCAAACCCCAACCCAUAGCACCAACAAUAGCAGUAAACAAAUAAGAACCAGACAACAUCAAAACAGUAUCCAAAAUAAUAGCACCAGGAACCAAAGAAGCAGGAAAAACAAAAUUAAUUGGAAAAUAAGUCCAACCCCAAAAAUUAAAAUAUCUAUUAAUCCAUUCACCCAACAACAAACCCAAAACACAAACAGUAGCACCCCAUGGCAAUCUAUAUCUUUCCCACAAAUAAGAUUGAACAGCAGCAGGAAAAGUAACCAAAACAAUUGGAGUAACAGUAACCCACAAUCUUCUAUCUUUCCAAUCAGACCAAAAAUCCCAAUCACCCAUAGUCAACAUAGCAUGAAUAUGAUAAGAACCAACAAUAACAAAAAAAACAACAAACAAAGCCAUCCAAUCAAUAGUUCUAGAAACUUGAACAGCUUCAGCAUGAGAUCUAACAGCAGAUUGAGCAGCAGACAUGGCCUUAGCAACAGCAACGAGUGUCAAUAAUGGUAAGAGUAGUUUCAUUUACUUGUACAGCUCGUCCAUGCCGAGAGUGAUCCCGGCGGCGGUCACGAACUCCAGCAGGACCAUGUGAUCGCGCUUCUCGUUGGGGUCUUUGCUCAGCUUGGACUGGUAGCUCAGGUAGUGGUUGUCGGGCAGCAGCACGGGGCCGUCGCCGAUGGGGGUGUUCUGCUGGUAGUGGUCGGCGAGCUGCACGCCGCCGUCCUCGAUGUUGUGGCGGAUCUUGAAGUUGGCCUUGAUGCCGUUCUUCUGCUUGUCGGCGGUGAUAUAGACGUUGUGGCUGUUGUAGUUGUACUCCAGCUUGUGCCCCAGGAUGUUGCCGUCCUCCUUGAAGUCGAUGCCCUUCAGCUCGAUGCGGUUCACCAGGGUGUCGCCCUCGAACUUCACCUCGGCGCGGGUCUUGUAGUUGCCGUCGUCCUUGAAGAAGAUGGUGCGCUCCUGGACGUAGCCUUCGGGCAUGGCGGACUUGAAGAAGUCGUGCUGCUUCAUGUGGUCGGGGUAGCGGGCGAAGCACUGCAGGCCGUAGCCCAGGGUGGUCACGAGGGUGGGCCAGGGCACGGGCAGCUUGCCGGUGGUGCAGAUCAGCUUCAGGGUCAGCUUGCCGUAGGUGGCAUCGCCCUCGCCCUCGCCGGACACGCUGAACUUGUGGCCGUUUACGUCGCCGUCCAGCUCGACCAGGAUGGGCACCACCCCGGUGAACAGCUCCUCGCCCUUGCUCACCAUUUACAUAAAAGAUGGAAUCAAUGGAGCAUCAAUUUGAACAACUUGUCUAUUACCAGUAGCAUCAAAAAAAAACAACAAACCAGCAAAUCUAGAAUCAGGAUCAUAAAUAAUAUCAGACAAUCUAUAAACUUCCCAAGCAGCAUCAGAAGCAGUAACAUCAACAGUUCUAGUUUCACCAGGAGCCAAUGGAGAAUUAUCAGAAACAGACAAACCAUCUUCAGCCAACAAAUCUUCAGGAUAACCAGUAGUAUCUUUAUAAACAUCAGAAUCCAAAAAUCUAACAGAAGCAGUAUAAAAUUCACCCAAUCUAAUUGGAGAAUUACCAUGAUUAGUAAUAGUCAAUUUCAUUCUCAUAGCUCUACCAGGAACUCUAUAAGUAGCAUCUUCAACUUUAACAGAAACAGUUGGAGCAGGCAAUUCCAAUGGUUUCAUACCUCUCAUAGUACCAGCUUGCAAUGGAAUAGUAAUUGGAUAUUUAGAAUUAGCAGAAGACAUAGCCAUAACAACAAUCAAAAUAGUAGCAGCCAAAAAACCCAUAGCAACUUUUCUAUCAGUAGCAGAAACCAAUUCAUCAGCUCUACCAGCAUCAACCAUCAAUAACCUUGGUAUGAAGAUAGGUCUCCUCGACCAAUAUCCAAUCCAGGCAACGCCUAUUGCGAACCAAAAAGCGUGCCAGAAAUAAGUAUUACCUUCAUUAUAAUUUUCCAAAUCAACAGUUUGACCAGUCAAAGUAGUAACAGGAUUUCUAAAUUCAGACAUAGAACCUUCAACAGUAAUCCAUUUACCAGGACCAAUAAUUGGACCACCACCUUGAACAUUCAUCAUAGUAUGAACAUGCCAAUCACCAGGUCUUCUAGCUUUCAAAACAACUCUAAAAUCAUAAGUUUUACCAAUUUCCAAUCUAACAGAUCUUGGAACCAAUUGACCACCAAUAUAAGAUUCUUUUCUAAUAAAAACAGGACCAGGCAUACCAACAUUCAAAAAAGCAACAUCAGGUUCAUCAACAGUUUCAGGCCAACCUUCAAAAACAUGAAAUUUACCUUUAAUCUCAACAGUUUCGUUUAUUUUAACCUUUUCCUUAGACCAAGAUAAGUCAUACCAAUGAAUAGUCCUCAUUCUCAUAAAAGCAGCUUGAGAUUUUUCACCAUGAGCAGAAGCAGAUGGAGCAUAAAAAGCAGUAGCAGCAACAGCAGACAACAAACCAAUAGCAGACCAUUUAGCAAUUCUAUCUUUAAUAGUUUUCAUUUAUUUAGCAAUCAAACCUUCAUCAACAGCUUCACACAAAGAUUGACCCAAACCACCUUGAGCAAAUCUAUAAAAAGUUUGAGUCAAAGUACCCAUAACAGCCAAAGCCAACCAACCGAAAAUAACAAAACCAUAAUGCAAUGGAGCAACAAACAAUUCUUCCAUAAACCAAAAAGUAUGACCCCAUUCAUUCAAACCAACAUUUGGCAAAAUCAUAAAUGGACCAACAACCAAAACCAAAUAUGGCAAAGAAAUACCUUUAGCAAAAAAUGGCAAUCUAGUUUUAGCAUAAAUAAAAGCAGCAAACCCAGUAAUAAUAUAAAUUGGGUAAGACAAAUAGAAUUCAAUAAUAUGAGAAGGUGUAAAAUCAGUGUCCCUAACUAUUGUUUGGUGCCAAGUACCAUCUUGUUCAGUAAAAUAAGAAGCACCCCAGUAAAUAGCCCAAGCAUAAGCAACCAACCAUACCAAAUGAGUAAAAUUUCUUCUCAAUUCUUCUCUUGGAGUCAAAGCAGCCAAAUUUCUAUCUCUAGUUUUCCAUAAGUAACCCCACAAAAUAGAAGCAGUAACAAUUUCCAAAACAAUCUCCGUAUACAAGAAAUUCAUCCAAUAAGUUUCAAACUCCGGAGCGAAAGAAUCCAAACCAGCAGACCAGCCAUAAACCCCCUCAUACCAUCUAACCCACAAAUAAAAAACAGUGUAUAUAGCCAAAGCAAAUGUCAACCAUUUCUUAUCUAACAAUGGAGCUUCAGCAGCAGCAGCACCACCAAUAGUAGUAGCAGCCAUGGCCUUAGCAACAGCAACGAGUGUCAAUAAUGGUAAGAGUAGUUUCAU'
pMMO_aa_seq = 'MKLLLPLLTLVAVAKAMAATTIGGAAAAEAPLLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAKGISLPYLVLVVGPFMILPNVGLNEWGHTFWFMEELFVAPLHYGFVIFGWLALAVMGTLTQTFYRFAQGGLGQSLCEAVDEGLIAKMKTIKDRIAKWSAIGLLSAVAATAFYAPSASAHGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFMMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKMKLLLPLLTLVAVAKAMSAAQSAVRSHAEAVQVSRTIDWMALFVVFFVIVGSYHIHAMLTMGDWDFWSDWKDRRLWVTVTPIVLVTFPAAVQSYLWERYRLPWGATVCVLGLLLGEWINRYFNFWGWTYFPINFVFPASLVPGAIILDTVLMLSGSYLFTAIVGAMGWGLIFYPGNWPIIAPLHVPVENNGMLMSIADIQGYNYVRTGTPEYIRMVEKGTLRTFGKDVAPVSAFFSAFMSILIYFMWHFIGRWFSNERFLQST'
hemo_dna_seq = 'ATGGGTGCTTTTACTGAAAAACAAGAGGCTTTGGTTTCTTCTAGCTTTGAAGCTTTTAAAGCTAACATTCCACAATATTCTGTTGTTTTTTATACTTCTATTTTGGAAAAAGCTCCTGCTGCTAAAGATTTGTTTTCTTTTTTGTCTAATGGTGTTGATCCATCTAATCCAAAATTGACTGGTCATGCTGAAAAATTGTTTGGTTTGGTTAGAGATTCTGCTGGTCAATTGAAAGCTAATGGTACTGTTGTTGCTGATGCTGCTTTGGGTTCTATTCATGCTCAAAAAGCTATTACTGATCCACAATTTGTTGTTGTTAAAGAAGCTTTGTTGAAAACTATTAAAGAAGCTGTTGGTGATAAATGGTCTGATGAATTGTCTTCTGCTTGGGAAGTTGCTTATGATGAATTGGCTGCTGCTATTAAAAAAGCTTTTAAAAGCTTTTTTAATAGCAGCAGCCAATTCATCATAAGCAACTTCCCAAGCAGAAGACAATTCATCAGACCATTTATCACCAACAGCTTCTTTAATAGTTTTCAACAAAGCTTCTTTAACAACAACAAATTGTGGATCAGTAATAGCTTTTTGAGCATGAATAGAACCCAAAGCAGCATCAGCAACAACAGTACCATTAGCTTTCAATTGACCAGCAGAATCTCTAACCAAACCAAACAATTTTTCAGCATGACCAGTCAATTTTGGATTAGATGGATCAACACCATTAGACAAAAAAGAAAACAAATCTTTAGCAGCAGGAGCTTTTTCCAAAATAGAAGTATAAAAAACAACAGAATATTGTGGAATGTTAGCTTTAAAAGCTTCAAAGCTAGAAGAAACCAAAGCCTCTTGTTTTTCAGTAAAAGCACCCATATGCTTCCAAGATTCTGGTGGGAATACTGCTGATAGCCTAACGTTCATGATCAAAATTTAACTGTTCTAACCCCTACTTGACAGGCAATATATAAACAGAAGGAAGCTGCCCTGTCTTAAACCTTTTTTTTTATCATCATTATTAGCTTACTTTCATAATTGCGACTGGTTCCAATTGACAAGCTTTTGATTTTAACGACTTTTAACGACAACTTGAGAAGATCAAAAAACAACTAATTATTCGAAACGATGGCTATCCCCGAAGAGTTTGATATCCTAGTTCTAGGTGGTGGATCCAGTGGATCCTGTATTGCCGGAAGATTGGCAAACTTGGACCACTCCTTGAAAGTACTTTCAAGGAGTGGTCCAAGTTTGCCAATCTTCCGGCAATACAGGATCCACTGGATCCACCACCTAGAACTAGGATATCAAACTCTTCGGGGATAGCCATCGTTTCGAATAATTAGTTGTTTTTTGATCTTCTCAAGTTGTCGTTAAAAGTCGTTAAAATCAAAAGCTTGTCAATTGGAACCAGTCGCAATTATGAAAGTAAGCTAATAATGATGATAAAAAAAAAGGTTTAAGACAGGGCAGCTTCCTTCTGTTTATATATTGCCTGTCAAGTAGGGGTTAGAACAGTTAAATTTTGATCATGAACGTTAGGCTATCAGCAGTATTCCCACCAGAATCTTGGAAGCATACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGT'
hemo_rna_seq = 'AAAAGCUUUUUUAAUAGCAGCAGCCAAUUCAUCAUAAGCAACUUCCCAAGCAGAAGACAAUUCAUCAGACCAUUUAUCACCAACAGCUUCUUUAAUAGUUUUCAACAAAGCUUCUUUAACAACAACAAAUUGUGGAUCAGUAAUAGCUUUUUGAGCAUGAAUAGAACCCAAAGCAGCAUCAGCAACAACAGUACCAUUAGCUUUCAAUUGACCAGCAGAAUCUCUAACCAAACCAAACAAUUUUUCAGCAUGACCAGUCAAUUUUGGAUUAGAUGGAUCAACACCAUUAGACAAAAAAGAAAACAAAUCUUUAGCAGCAGGAGCUUUUUCCAAAAUAGAAGUAUAAAAAACAACAGAAUAUUGUGGAAUGUUAGCUUUAAAAGCUUCAAAGCUAGAAGAAACCAAAGCCUCUUGUUUUUCAGUAAAAGCACCCAU'
hemo_aa_seq = 'MGAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF' | p_mmo_dna_seq = 'ATGAAAACTATTAAAGATAGAATTGCTAAATGGTCTGCTATTGGTTTGTTGTCTGCTGTTGCTGCTACTGCTTTTTATGCTCCATCTGCTTCTGCTCATGGTGAAAAATCTCAAGCTGCTTTTATGAGAATGAGGACTATTCATTGGTATGACTTATCTTGGTCTAAGGAAAAGGTTAAAATAAACGAAACTGTTGAGATTAAAGGTAAATTTCATGTTTTTGAAGGTTGGCCTGAAACTGTTGATGAACCTGATGTTGCTTTTTTGAATGTTGGTATGCCTGGTCCTGTTTTTATTAGAAAAGAATCTTATATTGGTGGTCAATTGGTTCCAAGATCTGTTAGATTGGAAATTGGTAAAACTTATGATTTTAGAGTTGTTTTGAAAGCTAGAAGACCTGGTGATTGGCATGTTCATACTATGATGAATGTTCAAGGTGGTGGTCCAATTATTGGTCCTGGTAAATGGATTACTGTTGAAGGTTCTATGTCTGAATTTAGAAATCCTGTTACTACTTTGACTGGTCAAACTGTTGATTTGGAAAATTATAATGAAGGTAATACTTATTTCTGGCACGCTTTTTGGTTCGCAATAGGCGTTGCCTGGATTGGATATTGGTCGAGGAGACCTATCTTCATACCAAGGTTATTGATGGTTGATGCTGGTAGAGCTGATGAATTGGTTTCTGCTACTGATAGAAAAGTTGCTATGGGTTTTTTGGCTGCTACTATTTTGATTGTTGTTATGGCTATGTCTTCTGCTAATTCTAAATATCCAATTACTATTCCATTGCAAGCTGGTACTATGAGAGGTATGAAACCATTGGAATTGCCTGCTCCAACTGTTTCTGTTAAAGTTGAAGATGCTACTTATAGAGTTCCTGGTAGAGCTATGAGAATGAAATTGACTATTACTAATCATGGTAATTCTCCAATTAGATTGGGTGAATTTTATACTGCTTCTGTTAGATTTTTGGATTCTGATGTTTATAAAGATACTACTGGTTATCCTGAAGATTTGTTGGCTGAAGATGGTTTGTCTGTTTCTGATAATTCTCCATTGGCTCCTGGTGAAACTAGAACTGTTGATGTTACTGCTTCTGATGCTGCTTGGGAAGTTTATAGATTGTCTGATATTATTTATGATCCTGATTCTAGATTTGCTGGTTTGTTGTTTTTTTTTGATGCTACTGGTAATAGACAAGTTGTTCAAATTGATGCTCCATTGATTCCATCTTTTATGTAAATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGCTGATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGGGCTACGGCCTGCAGTGCTTCGCCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCACCGCCGACAAGCAGAAGAACGGCATCAAGGCCAACTTCAAGATCCGCCACAACATCGAGGACGGCGGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCTACCAGTCCAAGCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAATTACTTGTACAGCTCGTCCATGCCGAGAGTGATCCCGGCGGCGGTCACGAACTCCAGCAGGACCATGTGATCGCGCTTCTCGTTGGGGTCTTTGCTCAGCTTGGACTGGTAGCTCAGGTAGTGGTTGTCGGGCAGCAGCACGGGGCCGTCGCCGATGGGGGTGTTCTGCTGGTAGTGGTCGGCGAGCTGCACGCCGCCGTCCTCGATGTTGTGGCGGATCTTGAAGTTGGCCTTGATGCCGTTCTTCTGCTTGTCGGCGGTGATATAGACGTTGTGGCTGTTGTAGTTGTACTCCAGCTTGTGCCCCAGGATGTTGCCGTCCTCCTTGAAGTCGATGCCCTTCAGCTCGATGCGGTTCACCAGGGTGTCGCCCTCGAACTTCACCTCGGCGCGGGTCTTGTAGTTGCCGTCGTCCTTGAAGAAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTTCATGTGGTCGGGGTAGCGGGCGAAGCACTGCAGGCCGTAGCCCAGGGTGGTCACGAGGGTGGGCCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATCAGCTTCAGGGTCAGCTTGCCGTAGGTGGCATCGCCCTCGCCCTCGCCGGACACGCTGAACTTGTGGCCGTTTACGTCGCCGTCCAGCTCGACCAGGATGGGCACCACCCCGGTGAACAGCTCCTCGCCCTTGCTCACCATTTACATAAAAGATGGAATCAATGGAGCATCAATTTGAACAACTTGTCTATTACCAGTAGCATCAAAAAAAAACAACAAACCAGCAAATCTAGAATCAGGATCATAAATAATATCAGACAATCTATAAACTTCCCAAGCAGCATCAGAAGCAGTAACATCAACAGTTCTAGTTTCACCAGGAGCCAATGGAGAATTATCAGAAACAGACAAACCATCTTCAGCCAACAAATCTTCAGGATAACCAGTAGTATCTTTATAAACATCAGAATCCAAAAATCTAACAGAAGCAGTATAAAATTCACCCAATCTAATTGGAGAATTACCATGATTAGTAATAGTCAATTTCATTCTCATAGCTCTACCAGGAACTCTATAAGTAGCATCTTCAACTTTAACAGAAACAGTTGGAGCAGGCAATTCCAATGGTTTCATACCTCTCATAGTACCAGCTTGCAATGGAATAGTAATTGGATATTTAGAATTAGCAGAAGACATAGCCATAACAACAATCAAAATAGTAGCAGCCAAAAAACCCATAGCAACTTTTCTATCAGTAGCAGAAACCAATTCATCAGCTCTACCAGCATCAACCATCAATAACCTTGGTATGAAGATAGGTCTCCTCGACCAATATCCAATCCAGGCAACGCCTATTGCGAACCAAAAAGCGTGCCAGAAATAAGTATTACCTTCATTATAATTTTCCAAATCAACAGTTTGACCAGTCAAAGTAGTAACAGGATTTCTAAATTCAGACATAGAACCTTCAACAGTAATCCATTTACCAGGACCAATAATTGGACCACCACCTTGAACATTCATCATAGTATGAACATGCCAATCACCAGGTCTTCTAGCTTTCAAAACAACTCTAAAATCATAAGTTTTACCAATTTCCAATCTAACAGATCTTGGAACCAATTGACCACCAATATAAGATTCTTTTCTAATAAAAACAGGACCAGGCATACCAACATTCAAAAAAGCAACATCAGGTTCATCAACAGTTTCAGGCCAACCTTCAAAAACATGAAATTTACCTTTAATCTCAACAGTTTCGTTTATTTTAACCTTTTCCTTAGACCAAGATAAGTCATACCAATGAATAGTCCTCATTCTCATAAAAGCAGCTTGAGATTTTTCACCATGAGCAGAAGCAGATGGAGCATAAAAAGCAGTAGCAGCAACAGCAGACAACAAACCAATAGCAGACCATTTAGCAATTCTATCTTTAATAGTTTTCATTCATGAGATTATTGGAAACCACCAGAATCGAATATAAAAGGCGAACACCTTTCCCAATTTTGGTTTCTCCTGACCCAAAGACTTTTCATGAGATTATTGGAAACCACCAGAATCGAATATAAAAGGCGAACACCTTTCCCAATTTTGGTTTCTCCTGACCCAAAGACTTTTCATGAGATTATTGGAAACCACCAGAATCGAATATAAAAGGCGAACACCTTTCCCAATTTTGGTTTCTCCTGACCCAAAGACTTTAAAGTCTTTGGGTCAGGAGAAACCAAAATTGGGAAAGGTGTTCGCCTTTTATATTCGATTCTGGTGGTTTCCAATAATCTCATGAAAAGTCTTTGGGTCAGGAGAAACCAAAATTGGGAAAGGTGTTCGCCTTTTATATTCGATTCTGGTGGTTTCCAATAATCTCATGAAAAGTCTTTGGGTCAGGAGAAACCAAAATTGGGAAAGGTGTTCGCCTTTTATATTCGATTCTGGTGGTTTCCAATAATCTCATGAACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGTCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGTCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGTATGAAACTACTCTTACCATTATTGACACTCGTTGCTGTTGCTAAGGCCATGTCTGCTGCTCAATCTGCTGTTAGATCTCATGCTGAAGCTGTTCAAGTTTCTAGAACTATTGATTGGATGGCTTTGTTTGTTGTTTTTTTTGTTATTGTTGGTTCTTATCATATTCATGCTATGTTGACTATGGGTGATTGGGATTTTTGGTCTGATTGGAAAGATAGAAGATTGTGGGTTACTGTTACTCCAATTGTTTTGGTTACTTTTCCTGCTGCTGTTCAATCTTATTTGTGGGAAAGATATAGATTGCCATGGGGTGCTACTGTTTGTGTTTTGGGTTTGTTGTTGGGTGAATGGATTAATAGATATTTTAATTTTTGGGGTTGGACTTATTTTCCAATTAATTTTGTTTTTCCTGCTTCTTTGGTTCCTGGTGCTATTATTTTGGATACTGTTTTGATGTTGTCTGGTTCTTATTTGTTTACTGCTATTGTTGGTGCTATGGGTTGGGGTTTGATTTTTTATCCTGGTAATTGGCCAATTATTGCTCCATTGCATGTTCCTGTTGAAAATAATGGTATGTTGATGTCTATTGCTGATATTCAAGGTTATAATTATGTTAGAACTGGTACTCCTGAATATATTAGAATGGTTGAAAAAGGTACTTTGAGAACTTTTGGTAAAGATGTTGCGCCCGTTTCAGCTTTTTTTTCTGCGTTCATGTCTATATTGATATATTTTATGTGGCATTTCATTGGTAGATGGTTTTCTAATGAAAGATTTTTGCAATCTACTTAATTAAGTAGATTGCAAAAATCTTTCATTAGAAAACCATCTACCAATGAAATGCCACATAAAATATATCAATATAGACATGAACGCAGAAAAAAAAGCTGAAACGGGCGCAACATCTTTACCAAAAGTTCTCAAAGTACCTTTTTCAACCATTCTAATATATTCAGGAGTACCAGTTCTAACATAATTATAACCTTGAATATCAGCAATAGACATCAACATACCATTATTTTCAACAGGAACATGCAATGGAGCAATAATTGGCCAATTACCAGGATAAAAAATCAAACCCCAACCCATAGCACCAACAATAGCAGTAAACAAATAAGAACCAGACAACATCAAAACAGTATCCAAAATAATAGCACCAGGAACCAAAGAAGCAGGAAAAACAAAATTAATTGGAAAATAAGTCCAACCCCAAAAATTAAAATATCTATTAATCCATTCACCCAACAACAAACCCAAAACACAAACAGTAGCACCCCATGGCAATCTATATCTTTCCCACAAATAAGATTGAACAGCAGCAGGAAAAGTAACCAAAACAATTGGAGTAACAGTAACCCACAATCTTCTATCTTTCCAATCAGACCAAAAATCCCAATCACCCATAGTCAACATAGCATGAATATGATAAGAACCAACAATAACAAAAAAAACAACAAACAAAGCCATCCAATCAATAGTTCTAGAAACTTGAACAGCTTCAGCATGAGATCTAACAGCAGATTGAGCAGCAGACATGGCCTTAGCAACAGCAACGAGTGTCAATAATGGTAAGAGTAGTTTCATATGAAACTACTCTTACCATTATTGACACTCGTTGCTGTTGCTAAGGCCATGGCTGCTACTACTATTGGTGGTGCTGCTGCTGCTGAAGCTCCATTGTTAGATAAGAAATGGTTGACATTTGCTTTGGCTATATACACTGTTTTTTATTTGTGGGTTAGATGGTATGAGGGGGTTTATGGCTGGTCTGCTGGTTTGGATTCTTTCGCTCCGGAGTTTGAAACTTATTGGATGAATTTCTTGTATACGGAGATTGTTTTGGAAATTGTTACTGCTTCTATTTTGTGGGGTTACTTATGGAAAACTAGAGATAGAAATTTGGCTGCTTTGACTCCAAGAGAAGAATTGAGAAGAAATTTTACTCATTTGGTATGGTTGGTTGCTTATGCTTGGGCTATTTACTGGGGTGCTTCTTATTTTACTGAACAAGATGGTACTTGGCACCAAACAATAGTTAGGGACACTGATTTTACACCTTCTCATATTATTGAATTCTATTTGTCTTACCCAATTTATATTATTACTGGGTTTGCTGCTTTTATTTATGCTAAAACTAGATTGCCATTTTTTGCTAAAGGTATTTCTTTGCCATATTTGGTTTTGGTTGTTGGTCCATTTATGATTTTGCCAAATGTTGGTTTGAATGAATGGGGTCATACTTTTTGGTTTATGGAAGAATTGTTTGTTGCTCCATTGCATTATGGTTTTGTTATTTTCGGTTGGTTGGCTTTGGCTGTTATGGGTACTTTGACTCAAACTTTTTATAGATTTGCTCAAGGTGGTTTGGGTCAATCTTTGTGTGAAGCTGTTGATGAAGGTTTGATTGCTAAATAATTATTTAGCAATCAAACCTTCATCAACAGCTTCACACAAAGATTGACCCAAACCACCTTGAGCAAATCTATAAAAAGTTTGAGTCAAAGTACCCATAACAGCCAAAGCCAACCAACCGAAAATAACAAAACCATAATGCAATGGAGCAACAAACAATTCTTCCATAAACCAAAAAGTATGACCCCATTCATTCAAACCAACATTTGGCAAAATCATAAATGGACCAACAACCAAAACCAAATATGGCAAAGAAATACCTTTAGCAAAAAATGGCAATCTAGTTTTAGCATAAATAAAAGCAGCAAACCCAGTAATAATATAAATTGGGTAAGACAAATAGAATTCAATAATATGAGAAGGTGTAAAATCAGTGTCCCTAACTATTGTTTGGTGCCAAGTACCATCTTGTTCAGTAAAATAAGAAGCACCCCAGTAAATAGCCCAAGCATAAGCAACCAACCATACCAAATGAGTAAAATTTCTTCTCAATTCTTCTCTTGGAGTCAAAGCAGCCAAATTTCTATCTCTAGTTTTCCATAAGTAACCCCACAAAATAGAAGCAGTAACAATTTCCAAAACAATCTCCGTATACAAGAAATTCATCCAATAAGTTTCAAACTCCGGAGCGAAAGAATCCAAACCAGCAGACCAGCCATAAACCCCCTCATACCATCTAACCCACAAATAAAAAACAGTGTATATAGCCAAAGCAAATGTCAACCATTTCTTATCTAACAATGGAGCTTCAGCAGCAGCAGCACCACCAATAGTAGTAGCAGCCATGGCCTTAGCAACAGCAACGAGTGTCAATAATGGTAAGAGTAGTTTCAT'
p_mmo_rna_seq = 'UUAAGUAGAUUGCAAAAAUCUUUCAUUAGAAAACCAUCUACCAAUGAAAUGCCACAUAAAAUAUAUCAAUAUAGACAUGAACGCAGAAAAAAAAGCUGAAACGGGCGCAACAUCUUUACCAAAAGUUCUCAAAGUACCUUUUUCAACCAUUCUAAUAUAUUCAGGAGUACCAGUUCUAACAUAAUUAUAACCUUGAAUAUCAGCAAUAGACAUCAACAUACCAUUAUUUUCAACAGGAACAUGCAAUGGAGCAAUAAUUGGCCAAUUACCAGGAUAAAAAAUCAAACCCCAACCCAUAGCACCAACAAUAGCAGUAAACAAAUAAGAACCAGACAACAUCAAAACAGUAUCCAAAAUAAUAGCACCAGGAACCAAAGAAGCAGGAAAAACAAAAUUAAUUGGAAAAUAAGUCCAACCCCAAAAAUUAAAAUAUCUAUUAAUCCAUUCACCCAACAACAAACCCAAAACACAAACAGUAGCACCCCAUGGCAAUCUAUAUCUUUCCCACAAAUAAGAUUGAACAGCAGCAGGAAAAGUAACCAAAACAAUUGGAGUAACAGUAACCCACAAUCUUCUAUCUUUCCAAUCAGACCAAAAAUCCCAAUCACCCAUAGUCAACAUAGCAUGAAUAUGAUAAGAACCAACAAUAACAAAAAAAACAACAAACAAAGCCAUCCAAUCAAUAGUUCUAGAAACUUGAACAGCUUCAGCAUGAGAUCUAACAGCAGAUUGAGCAGCAGACAUGGCCUUAGCAACAGCAACGAGUGUCAAUAAUGGUAAGAGUAGUUUCAUUUACUUGUACAGCUCGUCCAUGCCGAGAGUGAUCCCGGCGGCGGUCACGAACUCCAGCAGGACCAUGUGAUCGCGCUUCUCGUUGGGGUCUUUGCUCAGCUUGGACUGGUAGCUCAGGUAGUGGUUGUCGGGCAGCAGCACGGGGCCGUCGCCGAUGGGGGUGUUCUGCUGGUAGUGGUCGGCGAGCUGCACGCCGCCGUCCUCGAUGUUGUGGCGGAUCUUGAAGUUGGCCUUGAUGCCGUUCUUCUGCUUGUCGGCGGUGAUAUAGACGUUGUGGCUGUUGUAGUUGUACUCCAGCUUGUGCCCCAGGAUGUUGCCGUCCUCCUUGAAGUCGAUGCCCUUCAGCUCGAUGCGGUUCACCAGGGUGUCGCCCUCGAACUUCACCUCGGCGCGGGUCUUGUAGUUGCCGUCGUCCUUGAAGAAGAUGGUGCGCUCCUGGACGUAGCCUUCGGGCAUGGCGGACUUGAAGAAGUCGUGCUGCUUCAUGUGGUCGGGGUAGCGGGCGAAGCACUGCAGGCCGUAGCCCAGGGUGGUCACGAGGGUGGGCCAGGGCACGGGCAGCUUGCCGGUGGUGCAGAUCAGCUUCAGGGUCAGCUUGCCGUAGGUGGCAUCGCCCUCGCCCUCGCCGGACACGCUGAACUUGUGGCCGUUUACGUCGCCGUCCAGCUCGACCAGGAUGGGCACCACCCCGGUGAACAGCUCCUCGCCCUUGCUCACCAUUUACAUAAAAGAUGGAAUCAAUGGAGCAUCAAUUUGAACAACUUGUCUAUUACCAGUAGCAUCAAAAAAAAACAACAAACCAGCAAAUCUAGAAUCAGGAUCAUAAAUAAUAUCAGACAAUCUAUAAACUUCCCAAGCAGCAUCAGAAGCAGUAACAUCAACAGUUCUAGUUUCACCAGGAGCCAAUGGAGAAUUAUCAGAAACAGACAAACCAUCUUCAGCCAACAAAUCUUCAGGAUAACCAGUAGUAUCUUUAUAAACAUCAGAAUCCAAAAAUCUAACAGAAGCAGUAUAAAAUUCACCCAAUCUAAUUGGAGAAUUACCAUGAUUAGUAAUAGUCAAUUUCAUUCUCAUAGCUCUACCAGGAACUCUAUAAGUAGCAUCUUCAACUUUAACAGAAACAGUUGGAGCAGGCAAUUCCAAUGGUUUCAUACCUCUCAUAGUACCAGCUUGCAAUGGAAUAGUAAUUGGAUAUUUAGAAUUAGCAGAAGACAUAGCCAUAACAACAAUCAAAAUAGUAGCAGCCAAAAAACCCAUAGCAACUUUUCUAUCAGUAGCAGAAACCAAUUCAUCAGCUCUACCAGCAUCAACCAUCAAUAACCUUGGUAUGAAGAUAGGUCUCCUCGACCAAUAUCCAAUCCAGGCAACGCCUAUUGCGAACCAAAAAGCGUGCCAGAAAUAAGUAUUACCUUCAUUAUAAUUUUCCAAAUCAACAGUUUGACCAGUCAAAGUAGUAACAGGAUUUCUAAAUUCAGACAUAGAACCUUCAACAGUAAUCCAUUUACCAGGACCAAUAAUUGGACCACCACCUUGAACAUUCAUCAUAGUAUGAACAUGCCAAUCACCAGGUCUUCUAGCUUUCAAAACAACUCUAAAAUCAUAAGUUUUACCAAUUUCCAAUCUAACAGAUCUUGGAACCAAUUGACCACCAAUAUAAGAUUCUUUUCUAAUAAAAACAGGACCAGGCAUACCAACAUUCAAAAAAGCAACAUCAGGUUCAUCAACAGUUUCAGGCCAACCUUCAAAAACAUGAAAUUUACCUUUAAUCUCAACAGUUUCGUUUAUUUUAACCUUUUCCUUAGACCAAGAUAAGUCAUACCAAUGAAUAGUCCUCAUUCUCAUAAAAGCAGCUUGAGAUUUUUCACCAUGAGCAGAAGCAGAUGGAGCAUAAAAAGCAGUAGCAGCAACAGCAGACAACAAACCAAUAGCAGACCAUUUAGCAAUUCUAUCUUUAAUAGUUUUCAUUUAUUUAGCAAUCAAACCUUCAUCAACAGCUUCACACAAAGAUUGACCCAAACCACCUUGAGCAAAUCUAUAAAAAGUUUGAGUCAAAGUACCCAUAACAGCCAAAGCCAACCAACCGAAAAUAACAAAACCAUAAUGCAAUGGAGCAACAAACAAUUCUUCCAUAAACCAAAAAGUAUGACCCCAUUCAUUCAAACCAACAUUUGGCAAAAUCAUAAAUGGACCAACAACCAAAACCAAAUAUGGCAAAGAAAUACCUUUAGCAAAAAAUGGCAAUCUAGUUUUAGCAUAAAUAAAAGCAGCAAACCCAGUAAUAAUAUAAAUUGGGUAAGACAAAUAGAAUUCAAUAAUAUGAGAAGGUGUAAAAUCAGUGUCCCUAACUAUUGUUUGGUGCCAAGUACCAUCUUGUUCAGUAAAAUAAGAAGCACCCCAGUAAAUAGCCCAAGCAUAAGCAACCAACCAUACCAAAUGAGUAAAAUUUCUUCUCAAUUCUUCUCUUGGAGUCAAAGCAGCCAAAUUUCUAUCUCUAGUUUUCCAUAAGUAACCCCACAAAAUAGAAGCAGUAACAAUUUCCAAAACAAUCUCCGUAUACAAGAAAUUCAUCCAAUAAGUUUCAAACUCCGGAGCGAAAGAAUCCAAACCAGCAGACCAGCCAUAAACCCCCUCAUACCAUCUAACCCACAAAUAAAAAACAGUGUAUAUAGCCAAAGCAAAUGUCAACCAUUUCUUAUCUAACAAUGGAGCUUCAGCAGCAGCAGCACCACCAAUAGUAGUAGCAGCCAUGGCCUUAGCAACAGCAACGAGUGUCAAUAAUGGUAAGAGUAGUUUCAU'
p_mmo_aa_seq = 'MKLLLPLLTLVAVAKAMAATTIGGAAAAEAPLLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAKGISLPYLVLVVGPFMILPNVGLNEWGHTFWFMEELFVAPLHYGFVIFGWLALAVMGTLTQTFYRFAQGGLGQSLCEAVDEGLIAKMKTIKDRIAKWSAIGLLSAVAATAFYAPSASAHGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFMMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKMKLLLPLLTLVAVAKAMSAAQSAVRSHAEAVQVSRTIDWMALFVVFFVIVGSYHIHAMLTMGDWDFWSDWKDRRLWVTVTPIVLVTFPAAVQSYLWERYRLPWGATVCVLGLLLGEWINRYFNFWGWTYFPINFVFPASLVPGAIILDTVLMLSGSYLFTAIVGAMGWGLIFYPGNWPIIAPLHVPVENNGMLMSIADIQGYNYVRTGTPEYIRMVEKGTLRTFGKDVAPVSAFFSAFMSILIYFMWHFIGRWFSNERFLQST'
hemo_dna_seq = 'ATGGGTGCTTTTACTGAAAAACAAGAGGCTTTGGTTTCTTCTAGCTTTGAAGCTTTTAAAGCTAACATTCCACAATATTCTGTTGTTTTTTATACTTCTATTTTGGAAAAAGCTCCTGCTGCTAAAGATTTGTTTTCTTTTTTGTCTAATGGTGTTGATCCATCTAATCCAAAATTGACTGGTCATGCTGAAAAATTGTTTGGTTTGGTTAGAGATTCTGCTGGTCAATTGAAAGCTAATGGTACTGTTGTTGCTGATGCTGCTTTGGGTTCTATTCATGCTCAAAAAGCTATTACTGATCCACAATTTGTTGTTGTTAAAGAAGCTTTGTTGAAAACTATTAAAGAAGCTGTTGGTGATAAATGGTCTGATGAATTGTCTTCTGCTTGGGAAGTTGCTTATGATGAATTGGCTGCTGCTATTAAAAAAGCTTTTAAAAGCTTTTTTAATAGCAGCAGCCAATTCATCATAAGCAACTTCCCAAGCAGAAGACAATTCATCAGACCATTTATCACCAACAGCTTCTTTAATAGTTTTCAACAAAGCTTCTTTAACAACAACAAATTGTGGATCAGTAATAGCTTTTTGAGCATGAATAGAACCCAAAGCAGCATCAGCAACAACAGTACCATTAGCTTTCAATTGACCAGCAGAATCTCTAACCAAACCAAACAATTTTTCAGCATGACCAGTCAATTTTGGATTAGATGGATCAACACCATTAGACAAAAAAGAAAACAAATCTTTAGCAGCAGGAGCTTTTTCCAAAATAGAAGTATAAAAAACAACAGAATATTGTGGAATGTTAGCTTTAAAAGCTTCAAAGCTAGAAGAAACCAAAGCCTCTTGTTTTTCAGTAAAAGCACCCATATGCTTCCAAGATTCTGGTGGGAATACTGCTGATAGCCTAACGTTCATGATCAAAATTTAACTGTTCTAACCCCTACTTGACAGGCAATATATAAACAGAAGGAAGCTGCCCTGTCTTAAACCTTTTTTTTTATCATCATTATTAGCTTACTTTCATAATTGCGACTGGTTCCAATTGACAAGCTTTTGATTTTAACGACTTTTAACGACAACTTGAGAAGATCAAAAAACAACTAATTATTCGAAACGATGGCTATCCCCGAAGAGTTTGATATCCTAGTTCTAGGTGGTGGATCCAGTGGATCCTGTATTGCCGGAAGATTGGCAAACTTGGACCACTCCTTGAAAGTACTTTCAAGGAGTGGTCCAAGTTTGCCAATCTTCCGGCAATACAGGATCCACTGGATCCACCACCTAGAACTAGGATATCAAACTCTTCGGGGATAGCCATCGTTTCGAATAATTAGTTGTTTTTTGATCTTCTCAAGTTGTCGTTAAAAGTCGTTAAAATCAAAAGCTTGTCAATTGGAACCAGTCGCAATTATGAAAGTAAGCTAATAATGATGATAAAAAAAAAGGTTTAAGACAGGGCAGCTTCCTTCTGTTTATATATTGCCTGTCAAGTAGGGGTTAGAACAGTTAAATTTTGATCATGAACGTTAGGCTATCAGCAGTATTCCCACCAGAATCTTGGAAGCATACTGACAATAAAAAGATTCTTGTTTTCAAGAACTTGTCATTTGTATAGTTTTTTTATATTGTAGTTGTTCTATTTTAATCAAATGTTAGCGTGATTTATATTTTTTTTCGCCTCGACATCATCTGCCCAGATGCGAAGTTAAGTGCGCAGAAAGTAATATCATGCGTCAATCGTATGTGAATGCTGGTCGCTATACTGCAGTATAGCGACCAGCATTCACATACGATTGACGCATGATATTACTTTCTGCGCACTTAACTTCGCATCTGGGCAGATGATGTCGAGGCGAAAAAAAATATAAATCACGCTAACATTTGATTAAAATAGAACAACTACAATATAAAAAAACTATACAAATGACAAGTTCTTGAAAACAAGAATCTTTTTATTGTCAGT'
hemo_rna_seq = 'AAAAGCUUUUUUAAUAGCAGCAGCCAAUUCAUCAUAAGCAACUUCCCAAGCAGAAGACAAUUCAUCAGACCAUUUAUCACCAACAGCUUCUUUAAUAGUUUUCAACAAAGCUUCUUUAACAACAACAAAUUGUGGAUCAGUAAUAGCUUUUUGAGCAUGAAUAGAACCCAAAGCAGCAUCAGCAACAACAGUACCAUUAGCUUUCAAUUGACCAGCAGAAUCUCUAACCAAACCAAACAAUUUUUCAGCAUGACCAGUCAAUUUUGGAUUAGAUGGAUCAACACCAUUAGACAAAAAAGAAAACAAAUCUUUAGCAGCAGGAGCUUUUUCCAAAAUAGAAGUAUAAAAAACAACAGAAUAUUGUGGAAUGUUAGCUUUAAAAGCUUCAAAGCUAGAAGAAACCAAAGCCUCUUGUUUUUCAGUAAAAGCACCCAU'
hemo_aa_seq = 'MGAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF' |
c = int(input('digite o primeiro numero: '))
b = int(input('digite o segundo numero: '))
a = int(input('digite o terceiro numero: '))
cores= {'vermelho': '\033[0;31m',
'azul' : '\033[1;34m',
'zero': '\033[m' }
# qual o maior
maior = a
if b > c and b > a:
maior = b
if c > b and c > a:
maior = c
print('O maior valor foi {}{}{}'.format(cores['azul'],maior,cores['zero']))
# qual o menor
menor = c
if a < b and a < c:
menor = a
if b < a and b < c:
menor = b
print('O menor valor foi {}{}{}'.format(cores['vermelho'],menor,cores['zero']))
| c = int(input('digite o primeiro numero: '))
b = int(input('digite o segundo numero: '))
a = int(input('digite o terceiro numero: '))
cores = {'vermelho': '\x1b[0;31m', 'azul': '\x1b[1;34m', 'zero': '\x1b[m'}
maior = a
if b > c and b > a:
maior = b
if c > b and c > a:
maior = c
print('O maior valor foi {}{}{}'.format(cores['azul'], maior, cores['zero']))
menor = c
if a < b and a < c:
menor = a
if b < a and b < c:
menor = b
print('O menor valor foi {}{}{}'.format(cores['vermelho'], menor, cores['zero'])) |
class ACCOUNTS():
def __init__(self):
self.CodeChef = {
"username": "username",
"password": "password"
}
self.Hackerrank = {
"username": "username",
"password": "password",
"tracks": ["python"]
# Available (add as per your requirements):
# Languages: "java", "python", "c", "cpp", "ruby", "shell", "sql", "fp",
# Domians: "algorithms", "data-structures", "mathematics", "ai", "databases", "regex"
# "tutorials"
}
def getAccounts(self):
return vars(self)
| class Accounts:
def __init__(self):
self.CodeChef = {'username': 'username', 'password': 'password'}
self.Hackerrank = {'username': 'username', 'password': 'password', 'tracks': ['python']}
def get_accounts(self):
return vars(self) |
# Source and destination file names.
test_source = "data/math.txt"
test_destination = "math_output_html.html"
# Keyword parameters passed to publish_file.
reader_name = "standalone"
parser_name = "rst"
writer_name = "html"
# Extra setting
settings_overrides['math_output'] = 'HTML'
settings_overrides['stylesheet_path'] = (
'../docutils/writers/html4css1/html4css1.css, '
'../docutils/writers/html4css1/math.css ')
| test_source = 'data/math.txt'
test_destination = 'math_output_html.html'
reader_name = 'standalone'
parser_name = 'rst'
writer_name = 'html'
settings_overrides['math_output'] = 'HTML'
settings_overrides['stylesheet_path'] = '../docutils/writers/html4css1/html4css1.css, ../docutils/writers/html4css1/math.css ' |
def test_valid(cldf_dataset, cldf_logger):
assert cldf_dataset.validate(log=cldf_logger)
def test_parameters(cldf_dataset):
assert len(list(cldf_dataset["ParameterTable"])) == 100
def test_languages(cldf_dataset):
assert len(list(cldf_dataset["LanguageTable"])) > 4000
| def test_valid(cldf_dataset, cldf_logger):
assert cldf_dataset.validate(log=cldf_logger)
def test_parameters(cldf_dataset):
assert len(list(cldf_dataset['ParameterTable'])) == 100
def test_languages(cldf_dataset):
assert len(list(cldf_dataset['LanguageTable'])) > 4000 |
description = 'setup for the status monitor'
group = 'special'
_expcolumn = Column(
Block('Experiment', [
BlockRow(
# Field(name='Proposal', key='exp/proposal', width=7),
# Field(name='Title', key='exp/title', width=20,
# istext=True, maxlen=20),
Field(name='Current status', key='exp/action', width=40,
istext=True, maxlen=40),
Field(name='Data file', key='exp/lastpoint'),
),
],
),
)
_sampletable = Column(
Block('Sample table', [
BlockRow(
Field(dev='omgs'),
),
BlockRow(
Field(dev='tths'),
),
],
),
)
_instrument = Column(
Block('Instrument', [
BlockRow(
Field(dev='wav'),
),
BlockRow(
Field(dev='slits'),
),
BlockRow(
Field(dev='mon'),
Field(name='Resosteps', key='adet/resosteps'),
Field(name='Step', key='adet/value[0]'),
),
],
),
)
_frm = Column(
Block('FRM II', [
BlockRow(
Field(dev='ReactorPower'),
),
],
),
Block('SPODI', [
BlockRow(
Field(name='O2', dev='o2_nguide'),
Field(name='O2 part', dev='o2part_nguide'),
),
BlockRow(
Field(name='p1 N-Guide', dev='p1_nguide'),
Field(name='p2 N-Guide', dev='p2_nguide'),
Field(name='p3 N-Guide', dev='p3_nguide'),
),
],
),
)
# generic CCR-stuff
ccrs = []
ccrsupps = []
ccrplots = []
_ccrnrs = [6,] + list(range(10, 22 + 1))
for i in _ccrnrs:
ccrs.append(
Block('CCR%d-Pulse tube' % i, [
BlockRow(
Field(dev='t_ccr%d_c' % i, name='Coldhead'),
Field(dev='t_ccr%d_d' % i, name='Regulation'),
Field(dev='t_ccr%d_b' % i, name='Sample'),
),
BlockRow(
Field(key='t_ccr%d/setpoint' % i, name='Setpoint'),
Field(key='t_ccr%d/p' % i, name='P', width=7),
Field(key='t_ccr%d/i' % i, name='I', width=7),
Field(key='t_ccr%d/d' % i, name='D', width=6),
),
],
setups='ccr%d and not cci3he0*' % i,
),
)
ccrsupps.append(
Block('CCR%d' % i, [
BlockRow(
Field(dev='T_ccr%d_A' % i, name='A'),
Field(dev='T_ccr%d_B' % i, name='B'),
Field(dev='T_ccr%d_C' % i, name='C'),
Field(dev='T_ccr%d_D' % i, name='D'),
),
BlockRow(
Field(key='t_ccr%d/setpoint' % i, name='SetP.', width=6),
Field(key='t_ccr%d/p' % i, name='P', width=4),
Field(key='t_ccr%d/i' % i, name='I', width=4),
Field(key='t_ccr%d/d' % i, name='D', width=3),
),
BlockRow(
Field(dev='ccr%d_p1' % i, name='P1'),
Field(dev='ccr%d_p2' % i, name='P2'),
),
],
setups='ccr%d' % i,
),
)
_cryo = Column(*ccrs)
_cryosup = Column(*ccrsupps)
_htf = Column(
Block('HTF', [
BlockRow(
Field(dev='T'),
Field(name='Power', key='T/heaterpower'),
),
],
setups='htf*',
),
)
_magnet = Column(
Block('Magnet', [
BlockRow(
Field(dev='B'),
),
],
setups='ccm*',
),
)
_sc = Column(
Block('Sample Changer', [
BlockRow(
Field(dev='sams'),
),
],
setups='samplechanger',
),
)
_e = Column(
Block('E field', [
BlockRow(
Field(dev='E'),
),
],
setups='efield',
),
)
_tension = Column(
Block('Tension rack', [
BlockRow(
Field(dev='teload'),
Field(dev='tepos'),
Field(dev='teext'),
Field(dev='topos'),
Field(dev='tomom'),
),
],
setups='tensile',
),
)
_nps =[1,2,3,10,11,12]
_npblocks = []
for i in _nps:
_npblocks.append(
Block('Newport', [
BlockRow(
Field(dev='sth_rsc%02d' % i),
),
],
setups='rsc%02d' % i,
),
)
_rsc = Column(*_npblocks)
devices = dict(
Monitor = device('nicos.services.monitor.html.Monitor',
title = 'SPODI status monitor',
loglevel = 'info',
interval = 10,
filename = '/spodicontrol/webroot/index.html',
cache = 'spodictrl.spodi.frm2',
font = 'Luxi Sans',
valuefont = 'Consolas',
prefix = 'nicos/',
padding = 0,
fontsize = 24,
layout = [
Row(_expcolumn),
Row(_frm, _instrument, _sampletable),
Row(_htf,),
Row(_cryosup),
Row(_tension),
Row(_magnet, _e,),
Row(_sc, _rsc),
],
noexpired = True,
),
)
| description = 'setup for the status monitor'
group = 'special'
_expcolumn = column(block('Experiment', [block_row(field(name='Current status', key='exp/action', width=40, istext=True, maxlen=40), field(name='Data file', key='exp/lastpoint'))]))
_sampletable = column(block('Sample table', [block_row(field(dev='omgs')), block_row(field(dev='tths'))]))
_instrument = column(block('Instrument', [block_row(field(dev='wav')), block_row(field(dev='slits')), block_row(field(dev='mon'), field(name='Resosteps', key='adet/resosteps'), field(name='Step', key='adet/value[0]'))]))
_frm = column(block('FRM II', [block_row(field(dev='ReactorPower'))]), block('SPODI', [block_row(field(name='O2', dev='o2_nguide'), field(name='O2 part', dev='o2part_nguide')), block_row(field(name='p1 N-Guide', dev='p1_nguide'), field(name='p2 N-Guide', dev='p2_nguide'), field(name='p3 N-Guide', dev='p3_nguide'))]))
ccrs = []
ccrsupps = []
ccrplots = []
_ccrnrs = [6] + list(range(10, 22 + 1))
for i in _ccrnrs:
ccrs.append(block('CCR%d-Pulse tube' % i, [block_row(field(dev='t_ccr%d_c' % i, name='Coldhead'), field(dev='t_ccr%d_d' % i, name='Regulation'), field(dev='t_ccr%d_b' % i, name='Sample')), block_row(field(key='t_ccr%d/setpoint' % i, name='Setpoint'), field(key='t_ccr%d/p' % i, name='P', width=7), field(key='t_ccr%d/i' % i, name='I', width=7), field(key='t_ccr%d/d' % i, name='D', width=6))], setups='ccr%d and not cci3he0*' % i))
ccrsupps.append(block('CCR%d' % i, [block_row(field(dev='T_ccr%d_A' % i, name='A'), field(dev='T_ccr%d_B' % i, name='B'), field(dev='T_ccr%d_C' % i, name='C'), field(dev='T_ccr%d_D' % i, name='D')), block_row(field(key='t_ccr%d/setpoint' % i, name='SetP.', width=6), field(key='t_ccr%d/p' % i, name='P', width=4), field(key='t_ccr%d/i' % i, name='I', width=4), field(key='t_ccr%d/d' % i, name='D', width=3)), block_row(field(dev='ccr%d_p1' % i, name='P1'), field(dev='ccr%d_p2' % i, name='P2'))], setups='ccr%d' % i))
_cryo = column(*ccrs)
_cryosup = column(*ccrsupps)
_htf = column(block('HTF', [block_row(field(dev='T'), field(name='Power', key='T/heaterpower'))], setups='htf*'))
_magnet = column(block('Magnet', [block_row(field(dev='B'))], setups='ccm*'))
_sc = column(block('Sample Changer', [block_row(field(dev='sams'))], setups='samplechanger'))
_e = column(block('E field', [block_row(field(dev='E'))], setups='efield'))
_tension = column(block('Tension rack', [block_row(field(dev='teload'), field(dev='tepos'), field(dev='teext'), field(dev='topos'), field(dev='tomom'))], setups='tensile'))
_nps = [1, 2, 3, 10, 11, 12]
_npblocks = []
for i in _nps:
_npblocks.append(block('Newport', [block_row(field(dev='sth_rsc%02d' % i))], setups='rsc%02d' % i))
_rsc = column(*_npblocks)
devices = dict(Monitor=device('nicos.services.monitor.html.Monitor', title='SPODI status monitor', loglevel='info', interval=10, filename='/spodicontrol/webroot/index.html', cache='spodictrl.spodi.frm2', font='Luxi Sans', valuefont='Consolas', prefix='nicos/', padding=0, fontsize=24, layout=[row(_expcolumn), row(_frm, _instrument, _sampletable), row(_htf), row(_cryosup), row(_tension), row(_magnet, _e), row(_sc, _rsc)], noexpired=True)) |
def shellSort(alist):
gap = len(alist) // 2
while gap > 0:
for i in range(gap, len(alist)):
val = alist[i]
j = i
while j >= gap and alist[j - gap] > val:
alist[j] = alist[j - gap]
j -= gap
alist[j] = val
gap //= 2
| def shell_sort(alist):
gap = len(alist) // 2
while gap > 0:
for i in range(gap, len(alist)):
val = alist[i]
j = i
while j >= gap and alist[j - gap] > val:
alist[j] = alist[j - gap]
j -= gap
alist[j] = val
gap //= 2 |
#!/usr/bin/env python3
def foo():
a = 10
# infer that b is an int
b = a
assert b == 10
print(b)
if __name__ == "__main__":
foo()
| def foo():
a = 10
b = a
assert b == 10
print(b)
if __name__ == '__main__':
foo() |
x="There are %d types of people."%10
binary="binary"
do_not="don't"
y="Those who know %s and those who %s."%(binary,do_not)
print(x)
print(y)
print("I said: '%s'."%y)
hilarious=False
joke_evaluation="Isn't that joke so funny?! %r"
print (joke_evaluation % hilarious)
w="This is the left side of ..."
e="a string with a right side"
print (w+e)
| x = 'There are %d types of people.' % 10
binary = 'binary'
do_not = "don't"
y = 'Those who know %s and those who %s.' % (binary, do_not)
print(x)
print(y)
print("I said: '%s'." % y)
hilarious = False
joke_evaluation = "Isn't that joke so funny?! %r"
print(joke_evaluation % hilarious)
w = 'This is the left side of ...'
e = 'a string with a right side'
print(w + e) |
# -*- coding: utf-8 -*-
# -----------------------------------------------------------------------------
# Copyright (c) Spyder Project Contributors
#
# Licensed under the terms of the MIT License
# (see LICENSE.txt for details)
# -----------------------------------------------------------------------------
ANSI_COLORS = {
'emacs': {
'black': '#000000',
'red': '#800000',
'green': '#005100',
'yellow': '#abab67',
'blue': '#151d51',
'magenta': '#510051',
'cyan': '#105151',
'white': '#ffffff',
'brightBlack': '#555555',
'brightRed': '#c80000',
'brightGreen': '#00aa00',
'brightYellow': '#cbcb7b',
'brightBlue': '#3c51e8',
'brightMagenta': '#900090',
'brightCyan': '#20a7a7',
'brightWhite': '#ffffff'
},
'idle': {
'black': '#ffffff',
'red': '#8a0000',
'green': '#008a00',
'yellow': '#8a4000',
'blue': '#00008a',
'magenta': '#5a005a',
'cyan': '#105151',
'white': '#ffffff',
'brightBlack': '#555555',
'brightRed': '#dd0000',
'brightGreen': '#00aa00',
'brightYellow': '#ff7700',
'brightBlue': '#0000ff',
'brightMagenta': '#900090',
'brightCyan': '#20a7a7',
'brightWhite': '#ffffff'
},
'monokai': {
'black': '#48483e',
'red': '#dc2566',
'green': '#8fc029',
'yellow': '#d4c96e',
'blue': '#55bcce',
'magenta': '#9358fe',
'cyan': '#56b7a5',
'white': '#f8f8f2',
'brightBlack': '#76715e',
'brightRed': '#fa2772',
'brightGreen': '#a7e22e',
'brightYellow': '#e7db75',
'brightBlue': '#66d9ee',
'brightMagenta': '#ae82ff',
'brightCyan': '#66efd5',
'brightWhite': '#f9f8f5'
},
'pydev': {
'black': '#ffffff',
'red': '#800000',
'green': '#00aa00',
'yellow': '#ffff99',
'blue': '#0000ff',
'magenta': '#900090',
'cyan': '#007f7f',
'white': '#efefef',
'brightBlack': '#c0c0c0',
'brightRed': '#c10000',
'brightGreen': '#00cc00',
'brightYellow': '#fff569',
'brightBlue': '#015aff',
'brightMagenta': '#bf00bf',
'brightCyan': '#00a5a5',
'brightWhite': '#ffffff'
},
'scintilla': {
'black': '#ffffff',
'red': '#800000',
'green': '#007f00',
'yellow': '#ffff99',
'blue': '#00007f',
'magenta': '#7f007f',
'cyan': '#007f7f',
'white': '#efefef',
'brightBlack': '#adadad',
'brightRed': '#c10000',
'brightGreen': '#00ab00',
'brightYellow': '#fff569',
'brightBlue': '#0000ff',
'brightMagenta': '#be00be',
'brightCyan': '#00a5a5',
'brightWhite': '#ffffff'
},
'spyder': {
'black': '#ffffff',
'red': '#800000',
'green': '#00aa00',
'yellow': '#ffff99',
'blue': '#0000ff',
'magenta': '#900090',
'cyan': '#27b5ac',
'white': '#efefef',
'brightBlack': '#adadad',
'brightRed': '#c10000',
'brightGreen': '#00c800',
'brightYellow': '#fff569',
'brightBlue': '#0a37ff',
'brightMagenta': '#d500d5',
'brightCyan': '#2dd0c5',
'brightWhite': '#ffffff'
},
'spyder/dark': {
'black': '#19232D',
'red': '#c80000',
'green': '#11a642',
'yellow': '#c5bb29',
'blue': '#558eff',
'magenta': '#aa00aa',
'cyan': '#20b3a7',
'white': '#ffffff',
'brightBlack': '#4b4b4b',
'brightRed': '#ef0000',
'brightGreen': '#13c24b',
'brightYellow': '#e6e13f',
'brightBlue': '#4395ff',
'brightMagenta': '#da00da',
'brightCyan': '#23cbbd',
'brightWhite': '#ffffff'
},
'zenburn': {
'black': '#3F3F3F',
'red': '#705050',
'green': '#60B48A',
'yellow': '#DFAF8F',
'blue': '#506070',
'magenta': '#DC8CC3',
'cyan': '#8CD0D3',
'white': '#DCDCCC',
'brightBlack': '#709080',
'brightRed': '#DCA3A3',
'brightGreen': '#C3BF9F',
'brightYellow': '#F0DFAF',
'brightBlue': '#94BFF3',
'brightMagenta': '#EC93D3',
'brightCyan': '#93E0E3',
'brightWhite': '#DCDCCC'
},
'solarized/light': {
'black': '#fdf6e3',
'red': '#dc322f',
'green': '#859900',
'yellow': '#b58900',
'blue': '#268bd2',
'magenta': '#6c71c4',
'cyan': '#2aa198',
'white': '#93a1a1',
'brightBlack': '#657b83',
'brightRed': '#dc322f',
'brightGreen': '#859900',
'brightYellow': '#b58900',
'brightBlue': '#268bd2',
'brightMagenta': '#6c71c4',
'brightCyan': '#2aa198',
'brightWhite': '#fdf6e3'
},
'solarized/dark': {
'black': '#002b36',
'red': '#dc322f',
'green': '#859900',
'yellow': '#b58900',
'blue': '#268bd2',
'magenta': '#6c71c4',
'cyan': '#2aa198',
'white': '#93a1a1',
'brightBlack': '#657b83',
'brightRed': '#dc322f',
'brightGreen': '#859900',
'brightYellow': '#b58900',
'brightBlue': '#268bd2',
'brightMagenta': '#6c71c4',
'brightCyan': '#2aa198',
'brightWhite': '#fdf6e3'
},
'inkpot': {
'black': '#1f1f27',
'red': '#CD5200',
'green': '#9DCD00',
'yellow': '#cd8b00',
'blue': '#87cefa',
'magenta': '#8b8bff',
'cyan': '#87FAE5',
'white': '#93a1a1',
'brightBlack': '#313131',
'brightRed': '#CD2300',
'brightGreen': '#C0CD00',
'brightYellow': '#ffcd8b',
'brightBlue': '#B9E1FA',
'brightMagenta': '#A3A3FF',
'brightCyan': '#B8FAEE',
'brightWhite': '#cfbfad'
},
'minimal': {
'black': '#ffffff',
'red': '#D22D72',
'green': '#568C3B',
'yellow': '#8A8A0F',
'blue': '#257FAD',
'magenta': '#5D5DB1',
'cyan': '#2D8F6F',
'white': '#7EA2B4',
'brightBlack': '#5A7B8C',
'brightRed': '#D22D72',
'brightGreen': '#568C3B',
'brightYellow': '#8A8A0F',
'brightBlue': '#257FAD',
'brightMagenta': '#5D5DB1',
'brightCyan': '#2D8F6F',
'brightWhite': '#EBF8FF'
},
'nightlion': {
'black': '#4c4c4c',
'red': '#bb0000',
'green': '#5fde8f',
'yellow': '#f3f167',
'blue': '#276bd8',
'magenta': '#bb00bb',
'cyan': '#00dadf',
'white': '#bbbbbb',
'brightBlack': '#555555',
'brightRed': '#ff5555',
'brightGreen': '#55ff55',
'brightYellow': '#ffff55',
'brightBlue': '#5555ff',
'brightMagenta': '#ff55ff',
'brightCyan': '#55ffff',
'brightWhite': '#ffffff'
},
'notepad++': {
'black': '#ffffff',
'red': '#CC342B',
'green': '#198844',
'yellow': '#FBA922',
'blue': '#3971ED',
'magenta': '#A36AC7',
'cyan': '#3971ED',
'white': '#C5C8C6',
'brightBlack': '#969896',
'brightRed': '#CC342B',
'brightGreen': '#198844',
'brightYellow': '#FBA922',
'brightBlue': '#3971ED',
'brightMagenta': '#A36AC7',
'brightCyan': '#3971ED',
'brightWhite': '#FFFFFF'
},
'oblivion': {
'black': '#1D1F21',
'red': '#CC6666',
'green': '#B5BD68',
'yellow': '#F0C674',
'blue': '#81A2BE',
'magenta': '#B294BB',
'cyan': '#8ABEB7',
'white': '#C5C8C6',
'brightBlack': '#969896',
'brightRed': '#CC6666',
'brightGreen': '#B5BD68',
'brightYellow': '#F0C674',
'brightBlue': '#81A2BE',
'brightMagenta': '#B294BB',
'brightCyan': '#8ABEB7',
'brightWhite': '#FFFFFF'
},
'obsidian': {
'black': '#232C31',
'red': '#2A5491',
'green': '#237986',
'yellow': '#A03B1E',
'blue': '#484D79',
'magenta': '#C59820',
'cyan': '#B02F30',
'white': '#9EA7A6',
'brightBlack': '#3F4944',
'brightRed': '#2A5491',
'brightGreen': '#237986',
'brightYellow': '#A03B1E',
'brightBlue': '#484D79',
'brightMagenta': '#C59820',
'brightCyan': '#B02F30',
'brightWhite': '#B5D8F6'
},
'pastel': {
'black': '#000000',
'red': '#c37372',
'green': '#72c373',
'yellow': '#c2c372',
'blue': '#7372c3',
'magenta': '#c372c2',
'cyan': '#72c2c3',
'white': '#d9d9d9',
'brightBlack': '#323232',
'brightRed': '#dbaaaa',
'brightGreen': '#aadbaa',
'brightYellow': '#dadbaa',
'brightBlue': '#aaaadb',
'brightMagenta': '#dbaada',
'brightCyan': '#aadadb',
'brightWhite': '#ffffff'
},
'retta': {
'black': '#000000',
'red': '#A54242',
'green': '#8C9440',
'yellow': '#de935f',
'blue': '#5F819D',
'magenta': '#85678F',
'cyan': '#5E8D87',
'white': '#969896',
'brightBlack': '#373b41',
'brightRed': '#cc6666',
'brightGreen': '#b5bd68',
'brightYellow': '#f0c674',
'brightBlue': '#81a2be',
'brightMagenta': '#b294bb',
'brightCyan': '#8abeb7',
'brightWhite': '#c5c8c6'
},
'roboticket': {
'black': '#f5f5f5',
'red': '#E64569',
'green': '#89D287',
'yellow': '#DAB752',
'blue': '#439ECF',
'magenta': '#D961DC',
'cyan': '#64AAAF',
'white': '#B3B3B3',
'brightBlack': '#535353',
'brightRed': '#E4859A',
'brightGreen': '#A2CCA1',
'brightYellow': '#E1E387',
'brightBlue': '#6FBBE2',
'brightMagenta': '#E586E7',
'brightCyan': '#96DCDA',
'brightWhite': '#DEDEDE'
},
'sublime-monokai/extended': {
'black': '#222222',
'red': '#dc2566',
'green': '#8fc029',
'yellow': '#d4c96e',
'blue': '#55bcce',
'magenta': '#9358fe',
'cyan': '#56b7a5',
'white': '#f8f8f2',
'brightBlack': '#76715e',
'brightRed': '#fa2772',
'brightGreen': '#a7e22e',
'brightYellow': '#e7db75',
'brightBlue': '#66d9ee',
'brightMagenta': '#ae82ff',
'brightCyan': '#66efd5',
'brightWhite': '#f9f8f5'
},
'vibrant-ink': {
'black': '#191919',
'red': '#d00e18',
'green': '#138034',
'yellow': '#ffcb3e',
'blue': '#006bb3',
'magenta': '#6b2775',
'cyan': '#384564',
'white': '#ededed',
'brightBlack': '#5d504a',
'brightRed': '#f07e18',
'brightGreen': '#b1d130',
'brightYellow': '#fff120',
'brightBlue': '#4fc2fd',
'brightMagenta': '#de0071',
'brightCyan': '#5d504a',
'brightWhite': '#ffffff'
}
}
| ansi_colors = {'emacs': {'black': '#000000', 'red': '#800000', 'green': '#005100', 'yellow': '#abab67', 'blue': '#151d51', 'magenta': '#510051', 'cyan': '#105151', 'white': '#ffffff', 'brightBlack': '#555555', 'brightRed': '#c80000', 'brightGreen': '#00aa00', 'brightYellow': '#cbcb7b', 'brightBlue': '#3c51e8', 'brightMagenta': '#900090', 'brightCyan': '#20a7a7', 'brightWhite': '#ffffff'}, 'idle': {'black': '#ffffff', 'red': '#8a0000', 'green': '#008a00', 'yellow': '#8a4000', 'blue': '#00008a', 'magenta': '#5a005a', 'cyan': '#105151', 'white': '#ffffff', 'brightBlack': '#555555', 'brightRed': '#dd0000', 'brightGreen': '#00aa00', 'brightYellow': '#ff7700', 'brightBlue': '#0000ff', 'brightMagenta': '#900090', 'brightCyan': '#20a7a7', 'brightWhite': '#ffffff'}, 'monokai': {'black': '#48483e', 'red': '#dc2566', 'green': '#8fc029', 'yellow': '#d4c96e', 'blue': '#55bcce', 'magenta': '#9358fe', 'cyan': '#56b7a5', 'white': '#f8f8f2', 'brightBlack': '#76715e', 'brightRed': '#fa2772', 'brightGreen': '#a7e22e', 'brightYellow': '#e7db75', 'brightBlue': '#66d9ee', 'brightMagenta': '#ae82ff', 'brightCyan': '#66efd5', 'brightWhite': '#f9f8f5'}, 'pydev': {'black': '#ffffff', 'red': '#800000', 'green': '#00aa00', 'yellow': '#ffff99', 'blue': '#0000ff', 'magenta': '#900090', 'cyan': '#007f7f', 'white': '#efefef', 'brightBlack': '#c0c0c0', 'brightRed': '#c10000', 'brightGreen': '#00cc00', 'brightYellow': '#fff569', 'brightBlue': '#015aff', 'brightMagenta': '#bf00bf', 'brightCyan': '#00a5a5', 'brightWhite': '#ffffff'}, 'scintilla': {'black': '#ffffff', 'red': '#800000', 'green': '#007f00', 'yellow': '#ffff99', 'blue': '#00007f', 'magenta': '#7f007f', 'cyan': '#007f7f', 'white': '#efefef', 'brightBlack': '#adadad', 'brightRed': '#c10000', 'brightGreen': '#00ab00', 'brightYellow': '#fff569', 'brightBlue': '#0000ff', 'brightMagenta': '#be00be', 'brightCyan': '#00a5a5', 'brightWhite': '#ffffff'}, 'spyder': {'black': '#ffffff', 'red': '#800000', 'green': '#00aa00', 'yellow': '#ffff99', 'blue': '#0000ff', 'magenta': '#900090', 'cyan': '#27b5ac', 'white': '#efefef', 'brightBlack': '#adadad', 'brightRed': '#c10000', 'brightGreen': '#00c800', 'brightYellow': '#fff569', 'brightBlue': '#0a37ff', 'brightMagenta': '#d500d5', 'brightCyan': '#2dd0c5', 'brightWhite': '#ffffff'}, 'spyder/dark': {'black': '#19232D', 'red': '#c80000', 'green': '#11a642', 'yellow': '#c5bb29', 'blue': '#558eff', 'magenta': '#aa00aa', 'cyan': '#20b3a7', 'white': '#ffffff', 'brightBlack': '#4b4b4b', 'brightRed': '#ef0000', 'brightGreen': '#13c24b', 'brightYellow': '#e6e13f', 'brightBlue': '#4395ff', 'brightMagenta': '#da00da', 'brightCyan': '#23cbbd', 'brightWhite': '#ffffff'}, 'zenburn': {'black': '#3F3F3F', 'red': '#705050', 'green': '#60B48A', 'yellow': '#DFAF8F', 'blue': '#506070', 'magenta': '#DC8CC3', 'cyan': '#8CD0D3', 'white': '#DCDCCC', 'brightBlack': '#709080', 'brightRed': '#DCA3A3', 'brightGreen': '#C3BF9F', 'brightYellow': '#F0DFAF', 'brightBlue': '#94BFF3', 'brightMagenta': '#EC93D3', 'brightCyan': '#93E0E3', 'brightWhite': '#DCDCCC'}, 'solarized/light': {'black': '#fdf6e3', 'red': '#dc322f', 'green': '#859900', 'yellow': '#b58900', 'blue': '#268bd2', 'magenta': '#6c71c4', 'cyan': '#2aa198', 'white': '#93a1a1', 'brightBlack': '#657b83', 'brightRed': '#dc322f', 'brightGreen': '#859900', 'brightYellow': '#b58900', 'brightBlue': '#268bd2', 'brightMagenta': '#6c71c4', 'brightCyan': '#2aa198', 'brightWhite': '#fdf6e3'}, 'solarized/dark': {'black': '#002b36', 'red': '#dc322f', 'green': '#859900', 'yellow': '#b58900', 'blue': '#268bd2', 'magenta': '#6c71c4', 'cyan': '#2aa198', 'white': '#93a1a1', 'brightBlack': '#657b83', 'brightRed': '#dc322f', 'brightGreen': '#859900', 'brightYellow': '#b58900', 'brightBlue': '#268bd2', 'brightMagenta': '#6c71c4', 'brightCyan': '#2aa198', 'brightWhite': '#fdf6e3'}, 'inkpot': {'black': '#1f1f27', 'red': '#CD5200', 'green': '#9DCD00', 'yellow': '#cd8b00', 'blue': '#87cefa', 'magenta': '#8b8bff', 'cyan': '#87FAE5', 'white': '#93a1a1', 'brightBlack': '#313131', 'brightRed': '#CD2300', 'brightGreen': '#C0CD00', 'brightYellow': '#ffcd8b', 'brightBlue': '#B9E1FA', 'brightMagenta': '#A3A3FF', 'brightCyan': '#B8FAEE', 'brightWhite': '#cfbfad'}, 'minimal': {'black': '#ffffff', 'red': '#D22D72', 'green': '#568C3B', 'yellow': '#8A8A0F', 'blue': '#257FAD', 'magenta': '#5D5DB1', 'cyan': '#2D8F6F', 'white': '#7EA2B4', 'brightBlack': '#5A7B8C', 'brightRed': '#D22D72', 'brightGreen': '#568C3B', 'brightYellow': '#8A8A0F', 'brightBlue': '#257FAD', 'brightMagenta': '#5D5DB1', 'brightCyan': '#2D8F6F', 'brightWhite': '#EBF8FF'}, 'nightlion': {'black': '#4c4c4c', 'red': '#bb0000', 'green': '#5fde8f', 'yellow': '#f3f167', 'blue': '#276bd8', 'magenta': '#bb00bb', 'cyan': '#00dadf', 'white': '#bbbbbb', 'brightBlack': '#555555', 'brightRed': '#ff5555', 'brightGreen': '#55ff55', 'brightYellow': '#ffff55', 'brightBlue': '#5555ff', 'brightMagenta': '#ff55ff', 'brightCyan': '#55ffff', 'brightWhite': '#ffffff'}, 'notepad++': {'black': '#ffffff', 'red': '#CC342B', 'green': '#198844', 'yellow': '#FBA922', 'blue': '#3971ED', 'magenta': '#A36AC7', 'cyan': '#3971ED', 'white': '#C5C8C6', 'brightBlack': '#969896', 'brightRed': '#CC342B', 'brightGreen': '#198844', 'brightYellow': '#FBA922', 'brightBlue': '#3971ED', 'brightMagenta': '#A36AC7', 'brightCyan': '#3971ED', 'brightWhite': '#FFFFFF'}, 'oblivion': {'black': '#1D1F21', 'red': '#CC6666', 'green': '#B5BD68', 'yellow': '#F0C674', 'blue': '#81A2BE', 'magenta': '#B294BB', 'cyan': '#8ABEB7', 'white': '#C5C8C6', 'brightBlack': '#969896', 'brightRed': '#CC6666', 'brightGreen': '#B5BD68', 'brightYellow': '#F0C674', 'brightBlue': '#81A2BE', 'brightMagenta': '#B294BB', 'brightCyan': '#8ABEB7', 'brightWhite': '#FFFFFF'}, 'obsidian': {'black': '#232C31', 'red': '#2A5491', 'green': '#237986', 'yellow': '#A03B1E', 'blue': '#484D79', 'magenta': '#C59820', 'cyan': '#B02F30', 'white': '#9EA7A6', 'brightBlack': '#3F4944', 'brightRed': '#2A5491', 'brightGreen': '#237986', 'brightYellow': '#A03B1E', 'brightBlue': '#484D79', 'brightMagenta': '#C59820', 'brightCyan': '#B02F30', 'brightWhite': '#B5D8F6'}, 'pastel': {'black': '#000000', 'red': '#c37372', 'green': '#72c373', 'yellow': '#c2c372', 'blue': '#7372c3', 'magenta': '#c372c2', 'cyan': '#72c2c3', 'white': '#d9d9d9', 'brightBlack': '#323232', 'brightRed': '#dbaaaa', 'brightGreen': '#aadbaa', 'brightYellow': '#dadbaa', 'brightBlue': '#aaaadb', 'brightMagenta': '#dbaada', 'brightCyan': '#aadadb', 'brightWhite': '#ffffff'}, 'retta': {'black': '#000000', 'red': '#A54242', 'green': '#8C9440', 'yellow': '#de935f', 'blue': '#5F819D', 'magenta': '#85678F', 'cyan': '#5E8D87', 'white': '#969896', 'brightBlack': '#373b41', 'brightRed': '#cc6666', 'brightGreen': '#b5bd68', 'brightYellow': '#f0c674', 'brightBlue': '#81a2be', 'brightMagenta': '#b294bb', 'brightCyan': '#8abeb7', 'brightWhite': '#c5c8c6'}, 'roboticket': {'black': '#f5f5f5', 'red': '#E64569', 'green': '#89D287', 'yellow': '#DAB752', 'blue': '#439ECF', 'magenta': '#D961DC', 'cyan': '#64AAAF', 'white': '#B3B3B3', 'brightBlack': '#535353', 'brightRed': '#E4859A', 'brightGreen': '#A2CCA1', 'brightYellow': '#E1E387', 'brightBlue': '#6FBBE2', 'brightMagenta': '#E586E7', 'brightCyan': '#96DCDA', 'brightWhite': '#DEDEDE'}, 'sublime-monokai/extended': {'black': '#222222', 'red': '#dc2566', 'green': '#8fc029', 'yellow': '#d4c96e', 'blue': '#55bcce', 'magenta': '#9358fe', 'cyan': '#56b7a5', 'white': '#f8f8f2', 'brightBlack': '#76715e', 'brightRed': '#fa2772', 'brightGreen': '#a7e22e', 'brightYellow': '#e7db75', 'brightBlue': '#66d9ee', 'brightMagenta': '#ae82ff', 'brightCyan': '#66efd5', 'brightWhite': '#f9f8f5'}, 'vibrant-ink': {'black': '#191919', 'red': '#d00e18', 'green': '#138034', 'yellow': '#ffcb3e', 'blue': '#006bb3', 'magenta': '#6b2775', 'cyan': '#384564', 'white': '#ededed', 'brightBlack': '#5d504a', 'brightRed': '#f07e18', 'brightGreen': '#b1d130', 'brightYellow': '#fff120', 'brightBlue': '#4fc2fd', 'brightMagenta': '#de0071', 'brightCyan': '#5d504a', 'brightWhite': '#ffffff'}} |
def printVal(state, name):
val = state[name]
print("%s:" % state.fuzzy_names[name], val)
def print_all(state):
printVal(state, "var_default")
printVal(state, "var_default_override")
printVal(state, "var_default_override_twice")
printVal(state, "var_default_override_twice_and_cli")
def register(mf):
mf.register_defaults({
"var_default": 1,
"var_default_override": 2,
"var_default_override_twice": 3,
"var_default_override_twice_and_cli": 4
})
mf.register_event('print_all', print_all, unique=False)
| def print_val(state, name):
val = state[name]
print('%s:' % state.fuzzy_names[name], val)
def print_all(state):
print_val(state, 'var_default')
print_val(state, 'var_default_override')
print_val(state, 'var_default_override_twice')
print_val(state, 'var_default_override_twice_and_cli')
def register(mf):
mf.register_defaults({'var_default': 1, 'var_default_override': 2, 'var_default_override_twice': 3, 'var_default_override_twice_and_cli': 4})
mf.register_event('print_all', print_all, unique=False) |
class Node():
def __init__(self,data):
self.data=data
self.ref=None
class LinkedList():
def __init__(self):
self.head=None
def Print_ll(self):
n=self.head
if n is None:
print("LinkedList is empty")
else:
while n is not None:
print(n.data)
n=n.ref
ll=LinkedList()
ll.Print_ll()
| class Node:
def __init__(self, data):
self.data = data
self.ref = None
class Linkedlist:
def __init__(self):
self.head = None
def print_ll(self):
n = self.head
if n is None:
print('LinkedList is empty')
else:
while n is not None:
print(n.data)
n = n.ref
ll = linked_list()
ll.Print_ll() |
#!/usr/bin/env python3
#encoding=utf-8
#------------------------------------------------
# Usage: python3 3-desc-state-inst.py
# Description: descriptor for attribute intercept
#------------------------------------------------
class InstState: # Using instance state, (object) in 2.X
def __get__(self, instance, owner):
print('InstState get') # Assume set by client class
return instance._X * 10
def __set__(self, instance, value):
print('InstState set')
instance._X = value
# Client class
class CalcAttrs:
X = InstState() # Descriptor class attr
Y = 3 # Class attr
def __init__(self):
self._X = 2 # Instance attr
self.Z = 4 # Instance attr
if __name__ == '__main__':
obj = CalcAttrs()
print(obj.X, obj.Y, obj.Z) # X is computed, others are not
obj.X = 5 # X assignment is intercepted
CalcAttrs.Y = 6 # Y reassigned in class
obj.Z = 7 # Z assigned in instance
print(obj.X, obj.Y, obj.Z)
obj2 = CalcAttrs() # But X differs now, like Z!
print(obj2.X, obj2.Y, obj2.Z)
| class Inststate:
def __get__(self, instance, owner):
print('InstState get')
return instance._X * 10
def __set__(self, instance, value):
print('InstState set')
instance._X = value
class Calcattrs:
x = inst_state()
y = 3
def __init__(self):
self._X = 2
self.Z = 4
if __name__ == '__main__':
obj = calc_attrs()
print(obj.X, obj.Y, obj.Z)
obj.X = 5
CalcAttrs.Y = 6
obj.Z = 7
print(obj.X, obj.Y, obj.Z)
obj2 = calc_attrs()
print(obj2.X, obj2.Y, obj2.Z) |
bind = "0.0.0.0:5000"
backlog = 2048
workers = 1
worker_class = "sync"
threads = 16
spew = False
reload = True
loglevel = "debug"
| bind = '0.0.0.0:5000'
backlog = 2048
workers = 1
worker_class = 'sync'
threads = 16
spew = False
reload = True
loglevel = 'debug' |
for t in range(int(input())):
n=int(input())
if n%2==0:
print(int(n/2-1))
else:
print(int(n//2)) | for t in range(int(input())):
n = int(input())
if n % 2 == 0:
print(int(n / 2 - 1))
else:
print(int(n // 2)) |
value1 = int(input()); value2 = value1//100
if value1 % 2==0 and value2 % 2==0:
print("Even")
elif value1 % 2==0 and value2 % 2==1:
print("Even Odd")
elif value1 % 2==1 and value2 % 2==1:
print("Odd")
elif value1 % 2==1 and value2 % 2==0:
print("Odd Even")
| value1 = int(input())
value2 = value1 // 100
if value1 % 2 == 0 and value2 % 2 == 0:
print('Even')
elif value1 % 2 == 0 and value2 % 2 == 1:
print('Even Odd')
elif value1 % 2 == 1 and value2 % 2 == 1:
print('Odd')
elif value1 % 2 == 1 and value2 % 2 == 0:
print('Odd Even') |
class Solution:
def lemonadeChange(self, bills: List[int]) -> bool:
money = [0, 0, 0]
for x in bills:
if x == 5:
money[0] += 1
if x == 10:
if money[0] >= 1:
money[1] += 1
money[0] -= 1
else:
return False
if x == 20:
if money[1] >= 1 and money[0] >= 1:
money[2] += 1
money[1] -= 1
money[0] -= 1
elif money[0] >= 3:
money[2] += 1
money[0] -= 3
else:
return False
return True | class Solution:
def lemonade_change(self, bills: List[int]) -> bool:
money = [0, 0, 0]
for x in bills:
if x == 5:
money[0] += 1
if x == 10:
if money[0] >= 1:
money[1] += 1
money[0] -= 1
else:
return False
if x == 20:
if money[1] >= 1 and money[0] >= 1:
money[2] += 1
money[1] -= 1
money[0] -= 1
elif money[0] >= 3:
money[2] += 1
money[0] -= 3
else:
return False
return True |
config = {}
with open("config.txt", "r") as f:
lines = f.readlines()
for line in lines:
key, value = line.split("=")
value = value.replace("\n", "")
config[key] = value
print(f"Added key {key} with value {value}")
user_key = input("Which key would you like to see? ")
if user_key not in config:
print(f"I don't know the key {user_key}")
else:
val = config[user_key]
print(f"Current value for {user_key}:{val}")
next_step = input("Would you like to change?[y/n]")
if next_step == "y":
new_val = input("What is the new value? ")
config[user_key] = new_val
with open("config.txt", "w") as f:
for key, value in config.items():
l = f"{key}={value}\n"
f.write(l) | config = {}
with open('config.txt', 'r') as f:
lines = f.readlines()
for line in lines:
(key, value) = line.split('=')
value = value.replace('\n', '')
config[key] = value
print(f'Added key {key} with value {value}')
user_key = input('Which key would you like to see? ')
if user_key not in config:
print(f"I don't know the key {user_key}")
else:
val = config[user_key]
print(f'Current value for {user_key}:{val}')
next_step = input('Would you like to change?[y/n]')
if next_step == 'y':
new_val = input('What is the new value? ')
config[user_key] = new_val
with open('config.txt', 'w') as f:
for (key, value) in config.items():
l = f'{key}={value}\n'
f.write(l) |
# A little bit of molecular biology
# Codons are non-overlapping triplets of nucleotides.
# ATG CCC CTG GTA ... - this corresponds to four codons; spaces added for emphasis
# The start codon is 'ATG'
# Stop codons can be 'TGA' , 'TAA', or 'TAG', but they must be 'in frame' with the start codon. The first stop codon usually determines the end of the gene.
# In other words:
# 'ATGCCTGA...' - here TGA is not a stop codon, because the T is part of CCT
# 'ATGCCTTGA...' - here TGA is a stop codon because it is in frame (i.e. a multiple of 3 nucleic acids from ATG)
# The gene is start codon to stop codon, inclusive
# Example"
# dna - GGCATGAAAGTCAGGGCAGAGCCATCTATTTGAGCTTAC
# gene - ATGAAAGTCAGGGCAGAGCCATCTATTTGA
#dna ='GGCATGAAAGTCAGGGCAGAGCCATCTATTGCTTACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAGACACCATGGTGCACCTGACTCCTGAGGAGAAGTCTGCCGTTACTGCCCTGTGGGGCAAGGTGAACGTGGATGAAGTTGGTGGTGAGGCCCTGGGCAGGTTGGTATCAAGGTTACAAGACAGGTTTAAGGAGACCAATAGAAACTGGGCATGTGGAGACAGAGAAGACTCTTGGGTTTCTGATAGGCACTGACTCTCTCTGCCTATTGGTCTATTTTCCCACCCTTAGGCTGCTGGTGGTCTACCCTTGGACCCAGAGGTTCTTTGAGTCCTTTGGGGATCTGTCCACTCCTGATGCTGTTATGGGCAACCCTAAGGTGAAGGCTCATGGCAAGAAAGTGCTCGGTGCCTTTAGTGATGGCCTGGCTCACCTGGACAACCTCAAGGGCACCTTTGCCACACTGAGTGAGCTGCACTGTGACAAGCTGCACGTGGATCCTGAGAACTTCAGGGTGAGTCTATGGGACCCTTGATGTTTTCTTTCCCCTTCTTTTCTATGGTTAAGTTCATGTCATAGGAAGGGGAGAAGTAACAGGGTACAGTTTAGAATGGGAAACAGACGAATGATT'
dna = 'GGGATGTTTGGGCCCTACGGGCCCTGATCGGCT'
def startCodonIndex(seq):
# input: list of CAPs characters corresponding to DNA sequence
# output: index of first letter of start codon; return -1 if none are found
start_idx = seq.find('ATG')
return start_idx
def stopCodonIndex(seq, start_codon):
# input: list of CAPs characters corresponding to DNA sequence and index of start codon
# output: index of first stop codon; return -1 if none are found
stop_idx = -1
codon_length = 3
search_start = start_codon + codon_length
search_stop = len(seq)
for i in range(search_start, search_stop, codon_length):
codon = seq[i: i+codon_length]
if codon == "TAA" or codon == "TGA" or codon == "TAG":
stop_idx = i
break
return stop_idx
def codingDNA(seq):
# input: list of CAPs characters corresponding to DNA
# output: coding sequence only, including start and stop codons
start_idx = startCodonIndex(seq)
stop_idx = stopCodonIndex(seq, start_idx)
codon_length = 3
new_seq = dna[start_idx: stop_idx + codon_length]
return new_seq
def numCodons(seq):
# calculate the number of codons in the gene
# input: coding DNA sequence
# output: number of codons
codon_length = 3
num_codons = len(seq) / codon_length
# You don't need to run this line in python 2 because
# of integer division.
num_codons = int(num_codons)
return num_codons
def transcription(seq):
# Transcription: (A->U), (T->A), (C->G), (G->C)
# input: DNA coding squence
# ouput: RNA sequence
rna_seq=''
for base in seq:
if base == "A":
rna_seq += "U"
if base == "T":
rna_seq += "A"
if base == "C":
rna_seq += "G"
if base == "G":
rna_seq += "C"
return rna_seq
# calling the functions
# It would be more accurate to calculate the number of codons from coding_dna
codons = numCodons(dna)
start = startCodonIndex(dna)
stop = stopCodonIndex(dna, start)
coding_dna = codingDNA(dna)
coding_rna = transcription(coding_dna)
print(("DNA: {}".format(dna)))
print(("CODONS: {}".format(codons)))
print(("START: {}".format(start)))
print(("STOP: {}".format(stop)))
print(("CODING DNA: {}".format(coding_dna)))
print(("TRANSCRIBED RNA: {}".format(coding_rna)))
| dna = 'GGGATGTTTGGGCCCTACGGGCCCTGATCGGCT'
def start_codon_index(seq):
start_idx = seq.find('ATG')
return start_idx
def stop_codon_index(seq, start_codon):
stop_idx = -1
codon_length = 3
search_start = start_codon + codon_length
search_stop = len(seq)
for i in range(search_start, search_stop, codon_length):
codon = seq[i:i + codon_length]
if codon == 'TAA' or codon == 'TGA' or codon == 'TAG':
stop_idx = i
break
return stop_idx
def coding_dna(seq):
start_idx = start_codon_index(seq)
stop_idx = stop_codon_index(seq, start_idx)
codon_length = 3
new_seq = dna[start_idx:stop_idx + codon_length]
return new_seq
def num_codons(seq):
codon_length = 3
num_codons = len(seq) / codon_length
num_codons = int(num_codons)
return num_codons
def transcription(seq):
rna_seq = ''
for base in seq:
if base == 'A':
rna_seq += 'U'
if base == 'T':
rna_seq += 'A'
if base == 'C':
rna_seq += 'G'
if base == 'G':
rna_seq += 'C'
return rna_seq
codons = num_codons(dna)
start = start_codon_index(dna)
stop = stop_codon_index(dna, start)
coding_dna = coding_dna(dna)
coding_rna = transcription(coding_dna)
print('DNA: {}'.format(dna))
print('CODONS: {}'.format(codons))
print('START: {}'.format(start))
print('STOP: {}'.format(stop))
print('CODING DNA: {}'.format(coding_dna))
print('TRANSCRIBED RNA: {}'.format(coding_rna)) |
# REMISS
for i in range(int(input())):
A,B = map(int,input().split())
if A>B: print(str(A) + " " + str(A+B))
else: print(str(B) + " " + str(A+B)) | for i in range(int(input())):
(a, b) = map(int, input().split())
if A > B:
print(str(A) + ' ' + str(A + B))
else:
print(str(B) + ' ' + str(A + B)) |
#!/usr/bin/env python3
def hello(**kwargs):
print(f'Hello')
if __name__ == '__main__':
hello(hello())
| def hello(**kwargs):
print(f'Hello')
if __name__ == '__main__':
hello(hello()) |
#!/usr/bin/env python3
with open("dnsservers.txt", "r") as dnsfile:
for svr in dnsfile:
svr = svr.rstrip('\n')
if svr.endswith('org'):
with open("org-domain.txt", "a") as srvfile:
srvfile.write(svr + "\n")
elif svr.endswith('com'):
with open("com-domain.txt", "a") as srvfile:
srvfile.write(svr + "\n")
| with open('dnsservers.txt', 'r') as dnsfile:
for svr in dnsfile:
svr = svr.rstrip('\n')
if svr.endswith('org'):
with open('org-domain.txt', 'a') as srvfile:
srvfile.write(svr + '\n')
elif svr.endswith('com'):
with open('com-domain.txt', 'a') as srvfile:
srvfile.write(svr + '\n') |
class Solution:
def sumOfLeftLeaves(self, root: TreeNode) -> int:
if not root:
return 0
res = 0
q = deque([root])
while q:
node = q.popleft()
if node.left:
if not node.left.left and not node.left.right:
res += node.left.val
q.append(node.left)
if node.right:
q.append(node.right)
return res
| class Solution:
def sum_of_left_leaves(self, root: TreeNode) -> int:
if not root:
return 0
res = 0
q = deque([root])
while q:
node = q.popleft()
if node.left:
if not node.left.left and (not node.left.right):
res += node.left.val
q.append(node.left)
if node.right:
q.append(node.right)
return res |
'''
Given a string s, the power of the string is the maximum length of a non-empty substring that contains only one unique character.
Return the power of the string.
Example 1:
Input: s = "leetcode"
Output: 2
Explanation: The substring "ee" is of length 2 with the character 'e' only.
Example 2:
Input: s = "abbcccddddeeeeedcba"
Output: 5
Explanation: The substring "eeeee" is of length 5 with the character 'e' only.
'''
class Solution:
def maxPower(self, s: str) -> int:
current = 1
max_freq = 0
for i in range(1, len(s)):
if s[i] == s[i - 1]:
current += 1
else:
max_freq = max(current, max_freq)
current = 1
return max(max_freq, current)
| """
Given a string s, the power of the string is the maximum length of a non-empty substring that contains only one unique character.
Return the power of the string.
Example 1:
Input: s = "leetcode"
Output: 2
Explanation: The substring "ee" is of length 2 with the character 'e' only.
Example 2:
Input: s = "abbcccddddeeeeedcba"
Output: 5
Explanation: The substring "eeeee" is of length 5 with the character 'e' only.
"""
class Solution:
def max_power(self, s: str) -> int:
current = 1
max_freq = 0
for i in range(1, len(s)):
if s[i] == s[i - 1]:
current += 1
else:
max_freq = max(current, max_freq)
current = 1
return max(max_freq, current) |
MAP_HEIGHT_MIN = 20
MAP_HEIGHT_MAX = 50
MAP_WIDTH_MIN = 20
MAP_WIDTH_MAX = 50
MAP_KARBONITE_MIN = 0
MAP_KARBONITE_MAX = 50
ASTEROID_ROUND_MIN = 10
ASTEROID_ROUND_MAX = 20
ASTEROID_KARB_MIN = 20
ASTEROID_KARB_MAX = 100
ORBIT_FLIGHT_MIN = 50
ORBIT_FLIGHT_MAX = 200
ROUND_LIMIT = 1000
def validate_map_dims(h, w):
return (MAP_HEIGHT_MAX >= h >= MAP_HEIGHT_MIN) and (MAP_WIDTH_MAX >= w >= MAP_WIDTH_MIN)
def validate_num_bots(bot_list):
return 0 < len(bot_list) <= 6 and (len(bot_list) % 2 == 0)
def validate_asteroid_pattern(asteroid_list):
rounds = [i[0] for i in asteroid_list]
karb = [i[1] for i in asteroid_list]
for i in range(len(rounds)):
if rounds[i] < 1 or rounds[i] > ROUND_LIMIT:
print("fail round limit check")
return False
if karb[i] < ASTEROID_KARB_MIN or karb[i] > ASTEROID_KARB_MAX:
print("fail karb limit check")
return False
rounds.sort()
if rounds[0] > ASTEROID_ROUND_MAX:
print("fail minimum round")
return False
if ROUND_LIMIT - rounds[-1] > ASTEROID_ROUND_MAX:
print("fail maximum round")
return False
for i in range(len(rounds) - 1):
diff = rounds[i+1] - rounds[i]
if diff < ASTEROID_ROUND_MIN or diff > ASTEROID_ROUND_MAX:
print("fail diff {}".format(diff))
return False
return True
def validate_orbital_pattern(amplitude, period, center):
if center - amplitude < ORBIT_FLIGHT_MIN:
return False
if center + amplitude > ORBIT_FLIGHT_MAX:
return False
return True | map_height_min = 20
map_height_max = 50
map_width_min = 20
map_width_max = 50
map_karbonite_min = 0
map_karbonite_max = 50
asteroid_round_min = 10
asteroid_round_max = 20
asteroid_karb_min = 20
asteroid_karb_max = 100
orbit_flight_min = 50
orbit_flight_max = 200
round_limit = 1000
def validate_map_dims(h, w):
return MAP_HEIGHT_MAX >= h >= MAP_HEIGHT_MIN and MAP_WIDTH_MAX >= w >= MAP_WIDTH_MIN
def validate_num_bots(bot_list):
return 0 < len(bot_list) <= 6 and len(bot_list) % 2 == 0
def validate_asteroid_pattern(asteroid_list):
rounds = [i[0] for i in asteroid_list]
karb = [i[1] for i in asteroid_list]
for i in range(len(rounds)):
if rounds[i] < 1 or rounds[i] > ROUND_LIMIT:
print('fail round limit check')
return False
if karb[i] < ASTEROID_KARB_MIN or karb[i] > ASTEROID_KARB_MAX:
print('fail karb limit check')
return False
rounds.sort()
if rounds[0] > ASTEROID_ROUND_MAX:
print('fail minimum round')
return False
if ROUND_LIMIT - rounds[-1] > ASTEROID_ROUND_MAX:
print('fail maximum round')
return False
for i in range(len(rounds) - 1):
diff = rounds[i + 1] - rounds[i]
if diff < ASTEROID_ROUND_MIN or diff > ASTEROID_ROUND_MAX:
print('fail diff {}'.format(diff))
return False
return True
def validate_orbital_pattern(amplitude, period, center):
if center - amplitude < ORBIT_FLIGHT_MIN:
return False
if center + amplitude > ORBIT_FLIGHT_MAX:
return False
return True |
string = input().split(", ")
beggars = int(input())
beggars_list = []
for x in range(0, beggars):
temp = string[x::beggars]
for j in range(0, len(temp)):
temp[j] = int(temp[j])
beggars_list.append(sum(temp))
print(beggars_list) | string = input().split(', ')
beggars = int(input())
beggars_list = []
for x in range(0, beggars):
temp = string[x::beggars]
for j in range(0, len(temp)):
temp[j] = int(temp[j])
beggars_list.append(sum(temp))
print(beggars_list) |
# python to locate 1 in a 2D array
#below save it into a dictionary
# python to locate 1 in a 2D array
def check_zero(array1):
d = {}
print("array index zeros at:")
for i in range(len(array1)):
index = [k for k, v in enumerate(array1[i]) if v == 0]
d[i] = index
#print(i, index)
#print(d)
return(d)
array1 = [
[1, 1, 0, 0],
[0, 0, 1, 1],
[0, 1, 0, 1]
]
array2 = [
[1, 1, 0, 0, 0],
[0, 0, 1, 1, 0],
[0, 0, 1, 0, 1]
]
print(check_zero(array1))
print(check_zero(array2))
'''
array index zeros at:
{0: [2, 3], 1: [0, 1], 2: [0, 2]}
array index zeros at:
{0: [2, 3, 4], 1: [0, 1, 4], 2: [0, 1, 3]}
'''
# below is a function
def check_zero(array1):
print("array index zeros at:")
for i in range(len(array1)):
index = [k for k, v in enumerate(array1[i]) if v == 0]
print(i, index)
return(i,index)
array1 = [
[1, 1, 0, 0],
[0, 0, 1, 1],
[0, 1, 0, 1]
]
array2 = [
[1, 1, 0, 0, 0],
[0, 0, 1, 1, 0],
[0, 0, 1, 0, 1]
]
check_zero(array1)
check_zero(array2)
'''
array index zeros at:
0 [2, 3]
1 [0, 1]
2 [0, 2]
array index zeros at:
0 [2, 3, 4]
1 [0, 1, 4]
2 [0, 1, 3]
'''
array1 = [
[1, 1, 0, 0],
[0, 0, 1, 1],
[0, 1, 0, 1]
]
for i in range(len(array1)):
index = [ k for k,v in enumerate(array1[i]) if v ==0 ]
print(i, index)
'''
outputs
0 [2, 3]
1 [0, 1]
2 [0, 2]
'''
''' very primitive below,
for i in range(0,3):
for j in range(0,4):
if (array1[i][j] == 1):
print(i,j)
'''
'''
# https://docs.scipy.org/doc/numpy-1.15.0/reference/generated/numpy.nonzero.html
# not done yet
# import numpy
array2 = numpy.array([
[1, 1, 0, 0],
[0, 0, 1, 1],
[0, 0, 0, 0]])
print(numpy.nonzero(array2))
'''
# https://stackoverflow.com/questions/27175400/how-to-find-the-index-of-a-value-in-2d-array-in-python
'''
outputs from for i,j loop
D:\Go-workspace\walter\coding\python>python locate_zero.py
0 0
0 1
1 2
1 3
2 1
2 3
'''
| def check_zero(array1):
d = {}
print('array index zeros at:')
for i in range(len(array1)):
index = [k for (k, v) in enumerate(array1[i]) if v == 0]
d[i] = index
return d
array1 = [[1, 1, 0, 0], [0, 0, 1, 1], [0, 1, 0, 1]]
array2 = [[1, 1, 0, 0, 0], [0, 0, 1, 1, 0], [0, 0, 1, 0, 1]]
print(check_zero(array1))
print(check_zero(array2))
'\narray index zeros at:\n{0: [2, 3], 1: [0, 1], 2: [0, 2]}\narray index zeros at:\n{0: [2, 3, 4], 1: [0, 1, 4], 2: [0, 1, 3]}\n'
def check_zero(array1):
print('array index zeros at:')
for i in range(len(array1)):
index = [k for (k, v) in enumerate(array1[i]) if v == 0]
print(i, index)
return (i, index)
array1 = [[1, 1, 0, 0], [0, 0, 1, 1], [0, 1, 0, 1]]
array2 = [[1, 1, 0, 0, 0], [0, 0, 1, 1, 0], [0, 0, 1, 0, 1]]
check_zero(array1)
check_zero(array2)
'\narray index zeros at:\n0 [2, 3]\n1 [0, 1]\n2 [0, 2]\narray index zeros at:\n0 [2, 3, 4]\n1 [0, 1, 4]\n2 [0, 1, 3]\n'
array1 = [[1, 1, 0, 0], [0, 0, 1, 1], [0, 1, 0, 1]]
for i in range(len(array1)):
index = [k for (k, v) in enumerate(array1[i]) if v == 0]
print(i, index)
'\noutputs \n0 [2, 3]\n1 [0, 1]\n2 [0, 2]\n\n'
' very primitive below, \nfor i in range(0,3):\n for j in range(0,4):\n if (array1[i][j] == 1):\n print(i,j)\n'
'\n# https://docs.scipy.org/doc/numpy-1.15.0/reference/generated/numpy.nonzero.html\n# not done yet \n# import numpy\n\narray2 = numpy.array([ \n [1, 1, 0, 0],\n [0, 0, 1, 1],\n [0, 0, 0, 0]])\nprint(numpy.nonzero(array2))\n'
'\noutputs from for i,j loop\n\nD:\\Go-workspace\\walter\\coding\\python>python locate_zero.py\n0 0\n0 1\n1 2\n1 3\n2 1\n2 3\n' |
name = "Sharalanda"
age = 10
hobbies = ["draw", "swim", "dance"]
address = {"city": "Sebastopol", "Post Code": 1234, "country": "Enchantia"}
print("My name is", name)
print("I am", age, "years old")
print("My favourite hobbie is", hobbies[0])
print("I live in", address["city"])
| name = 'Sharalanda'
age = 10
hobbies = ['draw', 'swim', 'dance']
address = {'city': 'Sebastopol', 'Post Code': 1234, 'country': 'Enchantia'}
print('My name is', name)
print('I am', age, 'years old')
print('My favourite hobbie is', hobbies[0])
print('I live in', address['city']) |
# Copyright (c) 2018 Javier M. Mellid <[email protected]>
#
# Permission is hereby granted, free of charge, to any person obtaining a copy
# of this software and associated documentation files (the "Software"), to deal
# in the Software without restriction, including without limitation the rights
# to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
# copies of the Software, and to permit persons to whom the Software is
# furnished to do so, subject to the following conditions:
#
# The above copyright notice and this permission notice shall be included in all
# copies or substantial portions of the Software.
#
# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
# IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
# AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
# LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
# OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
# SOFTWARE.
class S3Owner:
def __init__(self, xid, display_name, id):
self.xid = xid
self.display_name = display_name
self.id = id
def __str__(self):
return "{} - {} - {}".format(self.xid,
self.display_name,
self.id)
class S3Object:
pass
class S3Version(S3Object):
xid = 0
last_modified = ''
version_id = ''
etag = ''
storage_class = ''
key = ''
owner = None
is_latest = True
size = 0
def __init__(self, xid, last_modified, version_id, etag, storage_class, key, owner, is_latest, size):
self.xid = xid
self.last_modified = last_modified
self.version_id = version_id
self.etag = etag
self.storage_class = storage_class
self.key = key
self.owner = owner
self.is_latest = is_latest
self.size = size
'''
"Versions": [
{
"LastModified": "2018-06-22T10:55:36.186Z",
"VersionId": "zWwD51VVELeSCN-mgn61yevKf4ETZB.",
"ETag": "\"b9c85244be9733bc79eca588db7bf306\"",
"StorageClass": "STANDARD",
"Key": "test-key-1",
"Owner": {
"DisplayName": "Test User",
"ID": "testuser1"
},
"IsLatest": true,
"Size": 151024
},
'''
def __str__(self):
return "{}:{}:{}:{}:{}:{}:{}:{}:{}:{}:{}".format(self.xid,
self.last_modified,
self.version_id,
self.etag,
self.storage_class,
self.key,
self.owner.xid,
self.owner.display_name,
self.owner.id,
self.is_latest,
self.size)
def pretty_str(self):
return "{}:{}:{}:{}:{}:{}:{}:{}:{}:{}".format('V',
'+' if self.is_latest is 1 else '-',
self.last_modified,
self.version_id,
self.key,
self.owner.display_name,
self.owner.id,
self.size,
self.etag,
self.storage_class)
class S3DeleteMarker(S3Version):
def __init__(self, xid, last_modified, version_id, key, owner, is_latest):
self.xid = xid
self.last_modified = last_modified
self.version_id = version_id
self.key = key
self.owner = owner
self.is_latest = is_latest
'''
"DeleteMarkers": [
{
"Owner": {
"DisplayName": "Test User",
"ID": "testuser1"
},
"IsLatest": true,
"VersionId": "0eU0xYMb3G2UiZVji4l8jhX-nL1tXqm",
"Key": "test-key-1",
"LastModified": "2018-06-22T11:22:31.955Z"
},
'''
def __str__(self):
return "{}:{}:{}:{}:{}:{}:{}:{}".format(self.xid,
self.last_modified,
self.version_id,
self.key,
self.owner.xid,
self.owner.display_name,
self.owner.id,
self.is_latest)
def pretty_str(self):
return "{}:{}:{}:{}:{}:{}:{}".format('D',
'+' if self.is_latest else '-',
self.last_modified,
self.version_id,
self.key,
self.owner.display_name,
self.owner.id)
| class S3Owner:
def __init__(self, xid, display_name, id):
self.xid = xid
self.display_name = display_name
self.id = id
def __str__(self):
return '{} - {} - {}'.format(self.xid, self.display_name, self.id)
class S3Object:
pass
class S3Version(S3Object):
xid = 0
last_modified = ''
version_id = ''
etag = ''
storage_class = ''
key = ''
owner = None
is_latest = True
size = 0
def __init__(self, xid, last_modified, version_id, etag, storage_class, key, owner, is_latest, size):
self.xid = xid
self.last_modified = last_modified
self.version_id = version_id
self.etag = etag
self.storage_class = storage_class
self.key = key
self.owner = owner
self.is_latest = is_latest
self.size = size
'\n "Versions": [\n {\n "LastModified": "2018-06-22T10:55:36.186Z",\n "VersionId": "zWwD51VVELeSCN-mgn61yevKf4ETZB.",\n "ETag": ""b9c85244be9733bc79eca588db7bf306"",\n "StorageClass": "STANDARD",\n "Key": "test-key-1",\n "Owner": {\n "DisplayName": "Test User",\n "ID": "testuser1"\n },\n "IsLatest": true,\n "Size": 151024\n },\n '
def __str__(self):
return '{}:{}:{}:{}:{}:{}:{}:{}:{}:{}:{}'.format(self.xid, self.last_modified, self.version_id, self.etag, self.storage_class, self.key, self.owner.xid, self.owner.display_name, self.owner.id, self.is_latest, self.size)
def pretty_str(self):
return '{}:{}:{}:{}:{}:{}:{}:{}:{}:{}'.format('V', '+' if self.is_latest is 1 else '-', self.last_modified, self.version_id, self.key, self.owner.display_name, self.owner.id, self.size, self.etag, self.storage_class)
class S3Deletemarker(S3Version):
def __init__(self, xid, last_modified, version_id, key, owner, is_latest):
self.xid = xid
self.last_modified = last_modified
self.version_id = version_id
self.key = key
self.owner = owner
self.is_latest = is_latest
'\n "DeleteMarkers": [\n {\n "Owner": {\n "DisplayName": "Test User",\n "ID": "testuser1"\n },\n "IsLatest": true,\n "VersionId": "0eU0xYMb3G2UiZVji4l8jhX-nL1tXqm",\n "Key": "test-key-1",\n "LastModified": "2018-06-22T11:22:31.955Z"\n },\n '
def __str__(self):
return '{}:{}:{}:{}:{}:{}:{}:{}'.format(self.xid, self.last_modified, self.version_id, self.key, self.owner.xid, self.owner.display_name, self.owner.id, self.is_latest)
def pretty_str(self):
return '{}:{}:{}:{}:{}:{}:{}'.format('D', '+' if self.is_latest else '-', self.last_modified, self.version_id, self.key, self.owner.display_name, self.owner.id) |
#Create a list using []
a = [1,2,3,7,66]
#print the list using print() function
print(a)
#Access using index using a[0], a[1], ....
print(a[2])
#Changing the value of the list
a[0] = 777
print(a)
#We can create a list with items of different type
b = [77,"Root",False,6.9]
print(b)
#List Slicing
friends = ["Root","Groot","Sam","Alex",99]
print(friends[0:3])
print(friends[-4:])
| a = [1, 2, 3, 7, 66]
print(a)
print(a[2])
a[0] = 777
print(a)
b = [77, 'Root', False, 6.9]
print(b)
friends = ['Root', 'Groot', 'Sam', 'Alex', 99]
print(friends[0:3])
print(friends[-4:]) |
singular = [
'this','as','is','thesis','hypothesis','less','obvious','us','yes','cos',
'always','perhaps','alias','plus','apropos',
'was','its','bus','his','is','us',
'this','thus','axis','bias','minus','basis',
'praxis','status','modulus','analysis',
'aparatus'
]
invariable = [ #frozen_list - cannot be given a synonym
'a','an','all','and','any','are','as','assume','be','by',
'case','classifier',
'coercion','conjecture','contradiction','contrary','corollary','declare',
'def',
'define','defined','definition','denote','division','do','document',
'does','dump','each','else','end','enddivision','endsection',
'endsubdivision','endsubsection','endsubsubsection','equal',
'equation','error','enter','every','exhaustive','exist','exit',
'false','fix','fixed','for','forall','formula','fun','function','has','have',
'having','hence','holding','hypothesis','if','iff','in','inferring',
'indeed','induction','inductive','introduce','is','it','left','lemma',
'let','library','make','map','match','moreover','mutual','namespace',
'no','not','notational','notation',
'notationless','obvious','of','off','on','only','ontored','or','over',
'pairwise','parameter','precedence','predicate','printgoal',
'proof','prop','property','prove','proposition',
'propped','qed','quotient','read','record','register','recursion','right',
'said','say','section','show','some','stand','structure','subdivision',
'subsection','subsubsection','such','suppose','synonym','take','that',
'the','then','theorem','there','therefore','thesis','this','timelimit',
'to','total','trivial','true','type','unique','us',
'warning','we','well','welldefined','well_defined','well_propped',
'where','with','write','wrong','yes',
#(* plural handled by sing 'classifiers', 'exists','implement',
# 'parameters','properties','propositions','synonyms','types',
]
transition = [ #phrase_list_transition_words
'a basic fact is','accordingly','additionally','again','also','and yet','as a result',
'as usual','as we have seen','as we see','at the same time','besides','but',
'by definition','certainly','clearly','computations show','consequently',
'conversely','equally important','explicitly','finally','first','for example',
'for instance','for simplicity','for that reason','for this purpose','further',
'furthermore','generally','hence','here','however','importantly','in addition',
'in any event','in brief','in consequence','in contrast','in contrast to this',
'in each case','in fact','in general','in other words','in particular','in short',
'in sum','in summary','in the present case','in the same way','in this computation',
'in this sense','indeed','it follows','it is clear','it is enough to show',
'it is known','it is routine','it is trivial to see','it is understood',
'it turns out','last','likewise','more precisely','moreover','most importantly',
'neverthess','next','nonetheless','note',
'notice','now','observe','obviously','of course','on the contrary','on the other hand',
'on the whole','otherwise','second','similarly','so','specifically','still',
'that is','the point is','then','therefore','third','this gives','this implies',
'this means','this yields','thus','thus far','to begin with','to this end',
'trivially','we claim','we emphasize','we first show','we get','we have seen',
'we have','we know','we check','we may check','we obtain','we remark','we say','we see',
'we show','we understand','we write','recall','we recall',
'without loss of generality','yet'
]
preposition_list = [
'aboard','about','above','according to', 'across', 'against', 'ahead of',
'along','alongside','amid','amidst','among','around','at','atop','away from',
'before',
'behind','below','beneath','beside','between','beyond','by','concerning','despite',
'except','except at','excluding','following',
'from','in','in addition to','in place of','in regard to',
'inside','instead of','into','near','next to','of',
'off','on','on behalf of','on top of','onto','opposite','out','out of',
'outside','outside of',
'over','owing to','per','prior to','regarding','save','through',
'throughout','till','to','towards','under','until',
'up','up to','upon','with','with respect to','wrt','within','without'
# 'for', 'as', 'like', 'after', 'round', 'plus', 'since', 'than', 'past',
# 'during',
# synonyms with\~respect\~to/wrt
]
prim_list = [
'prim_classifier',
'prim_term_op_controlseq',
'prim_binary_relation_controlseq',
'prim_propositional_op_controlseq',
'prim_type_op_controlseq',
'prim_term_controlseq',
'prim_type_controlseq',
'prim_lambda_binder',
'prim_pi_binder',
'prim_binder_prop',
'prim_typed_name',
'prim_adjective',
'prim_adjective_multisubject',
'prim_simple_adjective',
'prim_simple_adjective_multisubject',
'prim_field_term_accessor',
'prim_field_type_accessor',
'prim_field_prop_accessor',
'prim_definite_noun',
'prim_identifier_term',
'prim_identifier_type',
'prim_possessed_noun',
'prim_verb',
'prim_verb_multisubject',
'prim_structure',
'prim_type_op',
'prim_type_word',
'prim_term_op',
'prim_binary_relation_op',
'prim_propositional_op',
'prim_relation'
]
| singular = ['this', 'as', 'is', 'thesis', 'hypothesis', 'less', 'obvious', 'us', 'yes', 'cos', 'always', 'perhaps', 'alias', 'plus', 'apropos', 'was', 'its', 'bus', 'his', 'is', 'us', 'this', 'thus', 'axis', 'bias', 'minus', 'basis', 'praxis', 'status', 'modulus', 'analysis', 'aparatus']
invariable = ['a', 'an', 'all', 'and', 'any', 'are', 'as', 'assume', 'be', 'by', 'case', 'classifier', 'coercion', 'conjecture', 'contradiction', 'contrary', 'corollary', 'declare', 'def', 'define', 'defined', 'definition', 'denote', 'division', 'do', 'document', 'does', 'dump', 'each', 'else', 'end', 'enddivision', 'endsection', 'endsubdivision', 'endsubsection', 'endsubsubsection', 'equal', 'equation', 'error', 'enter', 'every', 'exhaustive', 'exist', 'exit', 'false', 'fix', 'fixed', 'for', 'forall', 'formula', 'fun', 'function', 'has', 'have', 'having', 'hence', 'holding', 'hypothesis', 'if', 'iff', 'in', 'inferring', 'indeed', 'induction', 'inductive', 'introduce', 'is', 'it', 'left', 'lemma', 'let', 'library', 'make', 'map', 'match', 'moreover', 'mutual', 'namespace', 'no', 'not', 'notational', 'notation', 'notationless', 'obvious', 'of', 'off', 'on', 'only', 'ontored', 'or', 'over', 'pairwise', 'parameter', 'precedence', 'predicate', 'printgoal', 'proof', 'prop', 'property', 'prove', 'proposition', 'propped', 'qed', 'quotient', 'read', 'record', 'register', 'recursion', 'right', 'said', 'say', 'section', 'show', 'some', 'stand', 'structure', 'subdivision', 'subsection', 'subsubsection', 'such', 'suppose', 'synonym', 'take', 'that', 'the', 'then', 'theorem', 'there', 'therefore', 'thesis', 'this', 'timelimit', 'to', 'total', 'trivial', 'true', 'type', 'unique', 'us', 'warning', 'we', 'well', 'welldefined', 'well_defined', 'well_propped', 'where', 'with', 'write', 'wrong', 'yes']
transition = ['a basic fact is', 'accordingly', 'additionally', 'again', 'also', 'and yet', 'as a result', 'as usual', 'as we have seen', 'as we see', 'at the same time', 'besides', 'but', 'by definition', 'certainly', 'clearly', 'computations show', 'consequently', 'conversely', 'equally important', 'explicitly', 'finally', 'first', 'for example', 'for instance', 'for simplicity', 'for that reason', 'for this purpose', 'further', 'furthermore', 'generally', 'hence', 'here', 'however', 'importantly', 'in addition', 'in any event', 'in brief', 'in consequence', 'in contrast', 'in contrast to this', 'in each case', 'in fact', 'in general', 'in other words', 'in particular', 'in short', 'in sum', 'in summary', 'in the present case', 'in the same way', 'in this computation', 'in this sense', 'indeed', 'it follows', 'it is clear', 'it is enough to show', 'it is known', 'it is routine', 'it is trivial to see', 'it is understood', 'it turns out', 'last', 'likewise', 'more precisely', 'moreover', 'most importantly', 'neverthess', 'next', 'nonetheless', 'note', 'notice', 'now', 'observe', 'obviously', 'of course', 'on the contrary', 'on the other hand', 'on the whole', 'otherwise', 'second', 'similarly', 'so', 'specifically', 'still', 'that is', 'the point is', 'then', 'therefore', 'third', 'this gives', 'this implies', 'this means', 'this yields', 'thus', 'thus far', 'to begin with', 'to this end', 'trivially', 'we claim', 'we emphasize', 'we first show', 'we get', 'we have seen', 'we have', 'we know', 'we check', 'we may check', 'we obtain', 'we remark', 'we say', 'we see', 'we show', 'we understand', 'we write', 'recall', 'we recall', 'without loss of generality', 'yet']
preposition_list = ['aboard', 'about', 'above', 'according to', 'across', 'against', 'ahead of', 'along', 'alongside', 'amid', 'amidst', 'among', 'around', 'at', 'atop', 'away from', 'before', 'behind', 'below', 'beneath', 'beside', 'between', 'beyond', 'by', 'concerning', 'despite', 'except', 'except at', 'excluding', 'following', 'from', 'in', 'in addition to', 'in place of', 'in regard to', 'inside', 'instead of', 'into', 'near', 'next to', 'of', 'off', 'on', 'on behalf of', 'on top of', 'onto', 'opposite', 'out', 'out of', 'outside', 'outside of', 'over', 'owing to', 'per', 'prior to', 'regarding', 'save', 'through', 'throughout', 'till', 'to', 'towards', 'under', 'until', 'up', 'up to', 'upon', 'with', 'with respect to', 'wrt', 'within', 'without']
prim_list = ['prim_classifier', 'prim_term_op_controlseq', 'prim_binary_relation_controlseq', 'prim_propositional_op_controlseq', 'prim_type_op_controlseq', 'prim_term_controlseq', 'prim_type_controlseq', 'prim_lambda_binder', 'prim_pi_binder', 'prim_binder_prop', 'prim_typed_name', 'prim_adjective', 'prim_adjective_multisubject', 'prim_simple_adjective', 'prim_simple_adjective_multisubject', 'prim_field_term_accessor', 'prim_field_type_accessor', 'prim_field_prop_accessor', 'prim_definite_noun', 'prim_identifier_term', 'prim_identifier_type', 'prim_possessed_noun', 'prim_verb', 'prim_verb_multisubject', 'prim_structure', 'prim_type_op', 'prim_type_word', 'prim_term_op', 'prim_binary_relation_op', 'prim_propositional_op', 'prim_relation'] |
#
# PySNMP MIB module JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB (http://snmplabs.com/pysmi)
# ASN.1 source file:///Users/davwang4/Dev/mibs.snmplabs.com/asn1/JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB
# Produced by pysmi-0.3.4 at Wed May 1 14:00:25 2019
# On host DAVWANG4-M-1475 platform Darwin version 18.5.0 by user davwang4
# Using Python version 3.7.3 (default, Mar 27 2019, 09:23:15)
#
Integer, OctetString, ObjectIdentifier = mibBuilder.importSymbols("ASN1", "Integer", "OctetString", "ObjectIdentifier")
NamedValues, = mibBuilder.importSymbols("ASN1-ENUMERATION", "NamedValues")
ConstraintsIntersection, ValueSizeConstraint, SingleValueConstraint, ValueRangeConstraint, ConstraintsUnion = mibBuilder.importSymbols("ASN1-REFINEMENT", "ConstraintsIntersection", "ValueSizeConstraint", "SingleValueConstraint", "ValueRangeConstraint", "ConstraintsUnion")
InetAddressPrefixLength, InetPortNumber, InetAddress, InetAddressType = mibBuilder.importSymbols("INET-ADDRESS-MIB", "InetAddressPrefixLength", "InetPortNumber", "InetAddress", "InetAddressType")
Ipv6AddressIfIdentifier, Ipv6AddressPrefix, Ipv6Address = mibBuilder.importSymbols("IPV6-TC", "Ipv6AddressIfIdentifier", "Ipv6AddressPrefix", "Ipv6Address")
jnxMobileGatewaySgw, = mibBuilder.importSymbols("JUNIPER-MBG-SMI", "jnxMobileGatewaySgw")
EnabledStatus, = mibBuilder.importSymbols("JUNIPER-MIMSTP-MIB", "EnabledStatus")
jnxMbgGwName, jnxMbgGwIndex = mibBuilder.importSymbols("JUNIPER-MOBILE-GATEWAYS", "jnxMbgGwName", "jnxMbgGwIndex")
ModuleCompliance, NotificationGroup = mibBuilder.importSymbols("SNMPv2-CONF", "ModuleCompliance", "NotificationGroup")
ModuleIdentity, MibScalar, MibTable, MibTableRow, MibTableColumn, Counter32, Counter64, Bits, TimeTicks, Integer32, iso, ObjectIdentity, MibIdentifier, Unsigned32, Gauge32, IpAddress, NotificationType = mibBuilder.importSymbols("SNMPv2-SMI", "ModuleIdentity", "MibScalar", "MibTable", "MibTableRow", "MibTableColumn", "Counter32", "Counter64", "Bits", "TimeTicks", "Integer32", "iso", "ObjectIdentity", "MibIdentifier", "Unsigned32", "Gauge32", "IpAddress", "NotificationType")
TextualConvention, RowStatus, TruthValue, DisplayString = mibBuilder.importSymbols("SNMPv2-TC", "TextualConvention", "RowStatus", "TruthValue", "DisplayString")
jnxMbgSgwGtpMib = ModuleIdentity((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2))
jnxMbgSgwGtpMib.setRevisions(('2011-09-21 12:00',))
if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0):
if mibBuilder.loadTexts: jnxMbgSgwGtpMib.setRevisionsDescriptions(('Initial version',))
if mibBuilder.loadTexts: jnxMbgSgwGtpMib.setLastUpdated('201109211200Z')
if mibBuilder.loadTexts: jnxMbgSgwGtpMib.setOrganization('Juniper Networks, Inc.')
if mibBuilder.loadTexts: jnxMbgSgwGtpMib.setContactInfo('Juniper Technical Assistance Center Juniper Networks, Inc. 1194 N. Mathilda Avenue Sunnyvale, CA 94089 E-mail: [email protected]')
if mibBuilder.loadTexts: jnxMbgSgwGtpMib.setDescription('This module defines some sample objects pertaining to GTP protocol.')
jnxMbgSgwGtpNotifications = MibIdentifier((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0))
jnxMbgSgwGtpObjects = MibIdentifier((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1))
jnxMbgSgwGtpCGlbStatsTable = MibTable((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2), )
if mibBuilder.loadTexts: jnxMbgSgwGtpCGlbStatsTable.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpCGlbStatsTable.setDescription('Each entry corresponds to a gateway level GTP Control statistic.')
jnxMbgSgwGtpGlbStatsEntry = MibTableRow((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1), ).setIndexNames((0, "JUNIPER-MOBILE-GATEWAYS", "jnxMbgGwIndex"))
if mibBuilder.loadTexts: jnxMbgSgwGtpGlbStatsEntry.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpGlbStatsEntry.setDescription('A specification of the GTP gateway level control Statistics.')
jnxMbgSgwRxPacketsDropped = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 1), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwRxPacketsDropped.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwRxPacketsDropped.setDescription('Number of Received Packets Dropped.')
jnxMbgSgwPacketAllocFail = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 2), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPacketAllocFail.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPacketAllocFail.setDescription('Number of Packet allocation failures.')
jnxMbgSgwPacketSendFail = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 3), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPacketSendFail.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPacketSendFail.setDescription('Number of Packet Send failures.')
jnxMbgSgwIPVerErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 4), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIPVerErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIPVerErrRx.setDescription('Number of IP Version Error Packets Received.')
jnxMbgSgwIPProtoErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 5), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIPProtoErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIPProtoErrRx.setDescription('Number of IP protocol Error packets Received.')
jnxMbgSgwGTPPortErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 6), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGTPPortErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGTPPortErrRx.setDescription('Number of Port Error Packets Received.')
jnxMbgSgwGTPUnknVerRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 7), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGTPUnknVerRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGTPUnknVerRx.setDescription('Number of Unknown Version Packets Received.')
jnxMbgSgwPcktLenErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 8), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPcktLenErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPcktLenErrRx.setDescription('Number of Packet Length Error Packets Received.')
jnxMbgSgwUnknMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 9), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUnknMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUnknMsgRx.setDescription('Number of Unknown Messages Received.')
jnxMbgSgwProtocolErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 10), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwProtocolErrRx.setDescription('Number of GTPv2 Protocol Errors Received.')
jnxMbgSgwUnSupportedMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 11), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUnSupportedMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUnSupportedMsgRx.setDescription('Number of GTPv2 Unsupported Messages received.')
jnxMbgSgwT3RespTmrExpRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 12), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwT3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwT3RespTmrExpRx.setDescription('Number of GTP V2 T3 timer expiries Received.')
jnxMbgSgwV2NumMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 13), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2NumMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2NumMsgRx.setDescription('Number of GTPv2 messages received.')
jnxMbgSgwV2NumMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 14), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2NumMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2NumMsgTx.setDescription('Number of V2 messages sent.')
jnxMbgSgwV2NumBytesRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 15), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2NumBytesRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2NumBytesRx.setDescription('Number of GTPv2 bytes received.')
jnxMbgSgwV2NumBytesTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 16), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2NumBytesTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2NumBytesTx.setDescription('Number of V2 bytes sent.')
jnxMbgSgwV2EchoReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 19), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2EchoReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2EchoReqRx.setDescription('Number of GTP V2 Echo Request received.')
jnxMbgSgwV2EchoReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 20), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2EchoReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2EchoReqTx.setDescription('Number of GTP V2 Echo Request Sent.')
jnxMbgSgwV2EchoRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 21), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2EchoRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2EchoRespRx.setDescription('Number of GTP V2 Echo Response received.')
jnxMbgSgwV2EchoRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 22), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2EchoRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2EchoRespTx.setDescription('Number of GTP V2 Echo Response Sent.')
jnxMbgSgwV2VerNotSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 23), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2VerNotSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2VerNotSupRx.setDescription('Number of GTP V2 Version Not supported messages received')
jnxMbgSgwV2VerNotSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 24), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwV2VerNotSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwV2VerNotSupTx.setDescription('Number of GTP V2 version not supported messages sent.')
jnxMbgSgwCreateSessReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 25), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCreateSessReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCreateSessReqRx.setDescription('Number of GTP V2 Create Session Requests received.')
jnxMbgSgwCreateSessReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 26), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCreateSessReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCreateSessReqTx.setDescription('Number of GTP V2 Create Session Requests Sent.')
jnxMbgSgwCreateSessRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 27), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCreateSessRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCreateSessRspRx.setDescription('Number of GTP V2 Create Session Responses received.')
jnxMbgSgwCreateSessRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 28), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCreateSessRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCreateSessRspTx.setDescription('Number of GTP V2 Create Session Responses Sent.')
jnxMbgSgwModBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 29), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrReqRx.setDescription('Number of GTP V2 Modify Bearer Requests received.')
jnxMbgSgwModBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 30), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrReqTx.setDescription('Number of GTP V2 Modify Bearer Requests Sent.')
jnxMbgSgwModBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 31), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrRspRx.setDescription('Number of GTP V2 Modify Bearer Responses received.')
jnxMbgSgwModBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 32), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrRspTx.setDescription('Number of GTP V2 Modify Bearer Responses Sent.')
jnxMbgSgwDelSessReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 33), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelSessReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelSessReqRx.setDescription('Number of GTP V2 Delete Session Requests received.')
jnxMbgSgwDelSessReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 34), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelSessReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelSessReqTx.setDescription('Number of GTP V2 Delete Session Requests Sent.')
jnxMbgSgwDelSessRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 35), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelSessRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelSessRspRx.setDescription('Number of GTP V2 Delete Session Responses received.')
jnxMbgSgwDelSessRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 36), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelSessRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelSessRspTx.setDescription('Number of GTP V2 Delete Session Responses Sent.')
jnxMbgSgwCrtBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 37), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrtBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrtBrReqRx.setDescription('Number of GTP V2 Create Bearer Requests received.')
jnxMbgSgwCrtBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 38), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrtBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrtBrReqTx.setDescription('Number of GTP V2 Create Bearer Requests Sent.')
jnxMbgSgwCrtBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 39), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrtBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrtBrRspRx.setDescription('Number of GTP V2 Create Bearer Response received.')
jnxMbgSgwCrtBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 40), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrtBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrtBrRspTx.setDescription('Number of GTP V2 Create Bearer Response Sent.')
jnxMbgSgwUpdBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 41), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdBrReqRx.setDescription('Number of GTP V2 Update Bearer Request received.')
jnxMbgSgwUpdBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 42), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdBrReqTx.setDescription('Number of GTP V2 Update Bearer Request Sent.')
jnxMbgSgwUpdBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 43), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdBrRspRx.setDescription('Number of GTP V2 Update Bearer Response received.')
jnxMbgSgwUpdBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 44), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdBrRspTx.setDescription('Number of GTP V2 Update Bearer Response Sent.')
jnxMbgSgwDelBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 45), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrReqRx.setDescription('Number of GTP V2 Delete Bearer Request received.')
jnxMbgSgwDelBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 46), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrReqTx.setDescription('Number of GTP V2 Delete Bearer Request Sent.')
jnxMbgSgwDelBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 47), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrRspRx.setDescription('Number of GTP V2 Delete Bearer Response received.')
jnxMbgSgwDelBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 48), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrRspTx.setDescription('Number of GTP V2 Delete Bearer Response Sent.')
jnxMbgSgwDelConnSetReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 49), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetReqRx.setDescription('Number of GTP V2 Delete PDN connection set Request received.')
jnxMbgSgwDelConnSetReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 50), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetReqTx.setDescription('Number of GTP V2 Delete PDN connection set Request Sent.')
jnxMbgSgwDelConnSetRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 51), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetRspRx.setDescription('Number of GTP V2 Delete PDN connection set Response received.')
jnxMbgSgwDelConnSetRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 52), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelConnSetRspTx.setDescription('Number of GTP V2 Delete PDN connection set Response Sent.')
jnxMbgSgwUpdConnSetReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 53), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetReqRx.setDescription('Number of GTP V2 Update Connection set Request received.')
jnxMbgSgwUpdConnSetReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 54), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetReqTx.setDescription('Number of GTP V2 Update Connection set Request Sent.')
jnxMbgSgwUpdConnSetRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 55), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetRspRx.setDescription('Number of GTP V2 Update Connection set Response received.')
jnxMbgSgwUpdConnSetRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 56), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwUpdConnSetRspTx.setDescription('Number of GTP V2 Update Connection set Response Sent.')
jnxMbgSgwModBrCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 57), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrCmdRx.setDescription('Number of GTP V2 Modify Bearer Command received.')
jnxMbgSgwModBrCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 58), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrCmdTx.setDescription('Number of GTP V2 Modify Bearer Command Sent.')
jnxMbgSgwModBrFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 59), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrFlrIndRx.setDescription('Number of GTP V2 Modify Bearer Failure received.')
jnxMbgSgwModBrFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 60), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwModBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwModBrFlrIndTx.setDescription('Number of GTP V2 Modify Bearer Failure Sent.')
jnxMbgSgwDelBrCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 61), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrCmdRx.setDescription('Number of GTP V2 Delete Bearer Command received.')
jnxMbgSgwDelBrCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 62), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrCmdTx.setDescription('Number of GTP V2 Delete Bearer Command Sent.')
jnxMbgSgwDelBrFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 63), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrFlrIndRx.setDescription('Number of GTP V2 Delete Bearer Failure received.')
jnxMbgSgwDelBrFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 64), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelBrFlrIndTx.setDescription('Number of GTP V2 Delete Bearer Failure Sent.')
jnxMbgSgwBrResCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 65), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwBrResCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwBrResCmdRx.setDescription('Number of GTP V2 Bearer Response Command received.')
jnxMbgSgwBrResCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 66), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwBrResCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwBrResCmdTx.setDescription('Number of GTP V2 Bearer Response Command Sent.')
jnxMbgSgwBrResFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 67), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwBrResFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwBrResFlrIndRx.setDescription('Number of GTP V2 Bearer Resource Failure received.')
jnxMbgSgwBrResFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 68), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwBrResFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwBrResFlrIndTx.setDescription('Number of GTP V2 Bearer Resource Failure Sent.')
jnxMbgSgwRelAcsBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 69), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrReqRx.setDescription('Number of GTP V2 Release Access Bearer Requests received.')
jnxMbgSgwRelAcsBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 70), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrReqTx.setDescription('Number of GTP V2 Release Access Bearer Requests sent.')
jnxMbgSgwRelAcsBrRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 71), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrRespRx.setDescription('Number of GTP V2 Release Access Bearer Response received.')
jnxMbgSgwRelAcsBrRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 72), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwRelAcsBrRespTx.setDescription('Number of GTP V2 Release Access Bearer Response sent.')
jnxMbgSgwCrIndTunReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 73), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunReqRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request Received')
jnxMbgSgwCrIndTunReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 74), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunReqTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request sent')
jnxMbgSgwCrIndTunRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 75), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunRespRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response Received')
jnxMbgSgwCrIndTunRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 76), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwCrIndTunRespTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response sent')
jnxMbgSgwDelIndTunReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 77), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunReqRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request Received')
jnxMbgSgwDelIndTunReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 78), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunReqTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request sent.')
jnxMbgSgwDelIndTunRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 79), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunRespRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response Received')
jnxMbgSgwDelIndTunRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 80), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDelIndTunRespTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response sent.')
jnxMbgSgwDlDataNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 81), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotifRx.setDescription('Number of GTP V2 Downlink Data Notify received.')
jnxMbgSgwDlDataNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 82), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotifTx.setDescription('Number of GTP V2 Downlink Data Notify Sent.')
jnxMbgSgwDlDataAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 83), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDlDataAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDlDataAckRx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement received.')
jnxMbgSgwDlDataAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 84), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDlDataAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDlDataAckTx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement Sent.')
jnxMbgSgwDlDataNotiFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 85), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotiFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotiFlrIndRx.setDescription('Number of GTP V2 Downlink Data Notification fail received.')
jnxMbgSgwDlDataNotiFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 86), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotiFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwDlDataNotiFlrIndTx.setDescription('Number of GTP V2 Downlink Data Notification fail Sent.')
jnxMbgSgwStopPagingIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 87), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwStopPagingIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwStopPagingIndRx.setDescription('Number of GTP V2 Number of Stop Paging Indication Messages Received.')
jnxMbgSgwStopPagingIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 88), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwStopPagingIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwStopPagingIndTx.setDescription('Number of GTP V2 Number of Stop Paging Indicaton messages sent')
jnxMbgSgwGtpV2ICsPageRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 89), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPageRx.setStatus('obsolete')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPageRx.setDescription('Number of GTPV2 packets received with cause Page.')
jnxMbgSgwGtpV2ICsPageTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 90), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPageTx.setStatus('obsolete')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPageTx.setDescription('Number of GTP packets sent with cause Page.')
jnxMbgSgwGtpV2ICsReqAcceptRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 91), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqAcceptRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqAcceptRx.setDescription('Number of GTPV2 packets received with cause Request Accept.')
jnxMbgSgwGtpV2ICsReqAcceptTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 92), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqAcceptTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqAcceptTx.setDescription('Number of GTP packets sent with cause Request Accept.')
jnxMbgSgwGtpV2ICsAcceptPartRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 93), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAcceptPartRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAcceptPartRx.setDescription('Number of GTPV2 packets received with cause Accept Partial.')
jnxMbgSgwGtpV2ICsAcceptPartTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 94), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAcceptPartTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAcceptPartTx.setDescription('Number of GTP packets sent with cause Accept Partial.')
jnxMbgSgwGtpV2ICsNewPTNPrefRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 95), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTNPrefRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTNPrefRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Network Preference.')
jnxMbgSgwGtpV2ICsNewPTNPrefTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 96), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTNPrefTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTNPrefTx.setDescription('Number of GTP packets sent with cause New PDN type due to Network Preference')
jnxMbgSgwGtpV2ICsNewPTSIAdbrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 97), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTSIAdbrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTSIAdbrRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Single Address Bearer.')
jnxMbgSgwGtpV2ICsNewPTSIAdbrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 98), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTSIAdbrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNewPTSIAdbrTx.setDescription('Number of GTP packets sent with cause New PDN type due to Single Address Bearer.')
jnxMbgSgwGtpV2ICsCtxNotFndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 99), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCtxNotFndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCtxNotFndRx.setDescription('Number of GTPV2 packets received with cause Context not found.')
jnxMbgSgwGtpV2ICsCtxNotFndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 100), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCtxNotFndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCtxNotFndTx.setDescription('Number of GTP packets sent with cause Context not found.')
jnxMbgSgwGtpV2ICsInvMsgFmtRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 101), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvMsgFmtRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvMsgFmtRx.setDescription('Number of GTPV2 packets received with cause Invalid Message Format.')
jnxMbgSgwGtpV2ICsInvMsgFmtTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 102), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvMsgFmtTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvMsgFmtTx.setDescription('Number of GTP packets sent with cause Invalid Message Format.')
jnxMbgSgwGtpV2ICsVerNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 103), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsVerNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsVerNotSuppRx.setDescription('Number of GTPV2 packets received with cause Version not Supported.')
jnxMbgSgwGtpV2ICsVerNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 104), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsVerNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsVerNotSuppTx.setDescription('Number of GTP packets sent with cause Version not Supported.')
jnxMbgSgwGtpV2ICsInvLenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 105), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvLenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvLenRx.setDescription('Number of GTPV2 packets received with cause Invalid Length.')
jnxMbgSgwGtpV2ICsInvLenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 106), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvLenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvLenTx.setDescription('Number of GTP packets sent with cause Invalid Length.')
jnxMbgSgwGtpV2ICsServNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 107), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServNotSuppRx.setDescription('Number of GTPV2 packets received with cause Service Not supported.')
jnxMbgSgwGtpV2ICsServNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 108), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServNotSuppTx.setDescription('Number of GTP packets sent with cause Service Not supported.')
jnxMbgSgwGtpV2ICsManIEIncorrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 109), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEIncorrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEIncorrRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE incorrect.')
jnxMbgSgwGtpV2ICsManIEIncorrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 110), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEIncorrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEIncorrTx.setDescription('Number of GTP packets sent with cause Mandatory IE incorrect.')
jnxMbgSgwGtpV2ICsManIEMissRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 111), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEMissRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEMissRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE Missing.')
jnxMbgSgwGtpV2ICsManIEMissTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 112), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEMissTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsManIEMissTx.setDescription('Number of GTP packets sent with cause Mandatory IE Missing.')
jnxMbgSgwGtpV2ICsOptIEIncorrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 113), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsOptIEIncorrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsOptIEIncorrRx.setDescription('Number of GTPV2 packets received with cause Optional IE Incorrect.')
jnxMbgSgwGtpV2ICsOptIEIncorrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 114), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsOptIEIncorrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsOptIEIncorrTx.setDescription('Number of GTP packets sent with cause Optional IE Incorrect.')
jnxMbgSgwGtpV2ICsSysFailRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 115), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSysFailRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSysFailRx.setDescription('Number of GTPV2 packets received with cause System Failure.')
jnxMbgSgwGtpV2ICsSysFailTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 116), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSysFailTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSysFailTx.setDescription('Number of GTP packets sent with cause System Failure.')
jnxMbgSgwGtpV2ICsNoResRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 117), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoResRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoResRx.setDescription('Number of GTPV2 packets received with cause No Resource.')
jnxMbgSgwGtpV2ICsNoResTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 118), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoResTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoResTx.setDescription('Number of GTP packets sent with cause No Resource.')
jnxMbgSgwGtpV2ICsTFTSMANTErRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 119), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSMANTErRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSMANTErRx.setDescription('Number of GTPV2 packets received with cause TFT Symantic Error.')
jnxMbgSgwGtpV2ICsTFTSMANTErTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 120), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSMANTErTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSMANTErTx.setDescription('Number of GTP packets sent with cause TFT Symantic Error.')
jnxMbgSgwGtpV2ICsTFTSysErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 121), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSysErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSysErrRx.setDescription('Number of GTPV2 packets received with cause TFT System Error.')
jnxMbgSgwGtpV2ICsTFTSysErrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 122), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSysErrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsTFTSysErrTx.setDescription('Number of GTP packets sent with cause TFT System Error.')
jnxMbgSgwGtpV2ICsPkFltManErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 123), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltManErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltManErrRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Symantic Error.')
jnxMbgSgwGtpV2ICsPkFltManErrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 124), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltManErrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltManErrTx.setDescription('Number of GTP packets sent with cause Packet Filter Symantic Error.')
jnxMbgSgwGtpV2ICsPkFltSynErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 125), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltSynErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltSynErrRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Syntax Error.')
jnxMbgSgwGtpV2ICsPkFltSynErrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 126), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltSynErrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPkFltSynErrTx.setDescription('Number of GTP packets sent with cause Packet Filter Syntax Error.')
jnxMbgSgwGtpV2ICsMisUnknAPNRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 127), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsMisUnknAPNRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsMisUnknAPNRx.setDescription('Number of GTPV2 packets received with cause Unknown APN.')
jnxMbgSgwGtpV2ICsMisUnknAPNTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 128), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsMisUnknAPNTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsMisUnknAPNTx.setDescription('Number of GTP packets sent with cause Unknown APN.')
jnxMbgSgwGtpV2ICsUnexpRptIERx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 129), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnexpRptIERx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnexpRptIERx.setDescription('Number of GTPV2 packets received with cause Unexpected Repeated IE.')
jnxMbgSgwGtpV2ICsUnexpRptIETx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 130), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnexpRptIETx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnexpRptIETx.setDescription('Number of GTP packets sent with cause Unexpected Repeated IE.')
jnxMbgSgwGtpV2ICsGREKeyNtFdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 131), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsGREKeyNtFdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsGREKeyNtFdRx.setDescription('Number of GTPV2 packets received with cause GRE Key Not Found.')
jnxMbgSgwGtpV2ICsGREKeyNtFdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 132), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsGREKeyNtFdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsGREKeyNtFdTx.setDescription('Number of GTP packets sent with cause GRE Key Not Found.')
jnxMbgSgwGtpV2ICsRelocFailRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 133), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRelocFailRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRelocFailRx.setDescription('Number of GTPV2 packets received with cause Relocation Failed.')
jnxMbgSgwGtpV2ICsRelocFailTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 134), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRelocFailTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRelocFailTx.setDescription('Number of GTP packets sent with cause Relocation Failed.')
jnxMbgSgwGtpV2ICsDeniedINRatRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 135), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDeniedINRatRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDeniedINRatRx.setDescription('Number of GTPV2 packets received with cause Denied in RAT.')
jnxMbgSgwGtpV2ICsDeniedINRatTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 136), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDeniedINRatTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDeniedINRatTx.setDescription('Number of GTP packets sent with cause Denied in RAT.')
jnxMbgSgwGtpV2ICsPTNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 137), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTNotSuppRx.setDescription('Number of GTPV2 packets received with cause PDN Type Not Supported.')
jnxMbgSgwGtpV2ICsPTNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 138), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTNotSuppTx.setDescription('Number of GTP packets sent with cause PDN Type Not Supported.')
jnxMbgSgwGtpV2ICsAllDynAdOccRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 139), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAllDynAdOccRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAllDynAdOccRx.setDescription('Number of GTPV2 packets received with cause Allocated Dynamic Address Occupied.')
jnxMbgSgwGtpV2ICsAllDynAdOccTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 140), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAllDynAdOccTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAllDynAdOccTx.setDescription('Number of GTP packets sent with cause Allocated Dynamic Address Occupied.')
jnxMbgSgwGtpV2ICsNOTFTUECTXRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 141), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNOTFTUECTXRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNOTFTUECTXRx.setDescription('Number of GTPV2 packets received with cause UE Context Without TFT Exists.')
jnxMbgSgwGtpV2ICsNOTFTUECTXTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 142), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNOTFTUECTXTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNOTFTUECTXTx.setDescription('Number of GTP packets sent with cause UE Context Without TFT Exists.')
jnxMbgSgwGtpV2ICsProtoNtSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 143), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsProtoNtSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsProtoNtSupRx.setDescription('Number of GTPV2 packets received with cause Protocol Not Supported.')
jnxMbgSgwGtpV2ICsProtoNtSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 144), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsProtoNtSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsProtoNtSupTx.setDescription('Number of GTP packets sent with cause Protocol Not Supported.')
jnxMbgSgwGtpV2ICsUENotRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 145), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUENotRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUENotRespRx.setDescription('Number of GTPV2 packets received with cause UE Not Responding.')
jnxMbgSgwGtpV2ICsUENotRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 146), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUENotRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUENotRespTx.setDescription('Number of GTP packets sent with cause UE Not Responding.')
jnxMbgSgwGtpV2ICsUERefusesRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 147), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUERefusesRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUERefusesRx.setDescription('Number of GTPV2 packets received with cause UE Refuses.')
jnxMbgSgwGtpV2ICsUERefusesTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 148), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUERefusesTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUERefusesTx.setDescription('Number of GTP packets sent with cause UE Refuses.')
jnxMbgSgwGtpV2ICsServDeniedRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 149), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServDeniedRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServDeniedRx.setDescription('Number of GTPV2 packets received with cause Service Denied.')
jnxMbgSgwGtpV2ICsServDeniedTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 150), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServDeniedTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsServDeniedTx.setDescription('Number of GTP packets sent with cause Service Denied.')
jnxMbgSgwGtpV2ICsUnabPageUERx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 151), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnabPageUERx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnabPageUERx.setDescription('Number of GTPV2 packets received with cause Unable to Page UE.')
jnxMbgSgwGtpV2ICsUnabPageUETx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 152), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnabPageUETx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnabPageUETx.setDescription('Number of GTP packets sent with cause Unable to Page UE.')
jnxMbgSgwGtpV2ICsNoMemRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 153), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoMemRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoMemRx.setDescription('Number of GTPV2 packets received with cause No Memory.')
jnxMbgSgwGtpV2ICsNoMemTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 154), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoMemTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsNoMemTx.setDescription('Number of GTP packets sent with cause No Memory.')
jnxMbgSgwGtpV2ICsUserAUTHFlRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 155), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUserAUTHFlRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUserAUTHFlRx.setDescription('Number of GTPV2 packets received with cause User AUTH Failed.')
jnxMbgSgwGtpV2ICsUserAUTHFlTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 156), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUserAUTHFlTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUserAUTHFlTx.setDescription('Number of GTP packets sent with cause User AUTH Failed.')
jnxMbgSgwGtpV2ICsAPNAcsDenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 157), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNAcsDenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNAcsDenRx.setDescription('Number of GTPV2 packets received with cause APN Access Denied.')
jnxMbgSgwGtpV2ICsAPNAcsDenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 158), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNAcsDenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNAcsDenTx.setDescription('Number of GTP packets sent with cause APN Access Denied.')
jnxMbgSgwGtpV2ICsReqRejRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 159), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqRejRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqRejRx.setDescription('Number of GTPV2 packets received with cause Request Rejected.')
jnxMbgSgwGtpV2ICsReqRejTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 160), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqRejTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsReqRejTx.setDescription('Number of GTP packets sent with cause Request Rejected.')
jnxMbgSgwGtpV2ICsPTMSISigMMRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 161), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTMSISigMMRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTMSISigMMRx.setDescription('Number of GTPV2 packets received with cause P-TMSI Signature Mismatch.')
jnxMbgSgwGtpV2ICsPTMSISigMMTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 162), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTMSISigMMTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsPTMSISigMMTx.setDescription('Number of GTP packets sent with cause P-TMSI Signature Mismatch')
jnxMbgSgwGtpV2ICsIMSINotKnRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 163), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsIMSINotKnRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsIMSINotKnRx.setDescription('Number of GTPV2 packets received with cause IMSI Not Known.')
jnxMbgSgwGtpV2ICsIMSINotKnTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 164), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsIMSINotKnTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsIMSINotKnTx.setDescription('Number of GTP packets sent with cause IMSI Not Known.')
jnxMbgSgwGtpV2ICsCondIEMsRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 165), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCondIEMsRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCondIEMsRx.setDescription('Number of GTPV2 packets received with cause Conditional IE Missing.')
jnxMbgSgwGtpV2ICsCondIEMsTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 166), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCondIEMsTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCondIEMsTx.setDescription('Number of GTP packets sent with cause Conditional IE Missing.')
jnxMbgSgwGtpV2ICsAPNResTIncRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 167), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNResTIncRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNResTIncRx.setDescription('Number of GTPV2 packets received with cause APN Restriction Type Incompatible.')
jnxMbgSgwGtpV2ICsAPNResTIncTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 168), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNResTIncTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsAPNResTIncTx.setDescription('Number of GTP packets sent with cause APN Restriction Type Incompatible.')
jnxMbgSgwGtpV2ICsUnknownRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 169), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnknownRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnknownRx.setDescription('Number of GTPV2 packets received with cause Unknown.')
jnxMbgSgwGtpV2ICsUnknownTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 170), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnknownTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnknownTx.setDescription('Number of GTP packets sent with cause Unknown.')
jnxMbgSgwGtpV2ICsLclDetRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 171), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsLclDetRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsLclDetRx.setDescription('Number of GTP packets received with cause Local Detach.')
jnxMbgSgwGtpV2ICsLclDetTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 172), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsLclDetTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsLclDetTx.setDescription('Number of GTP packets sent with cause Local Detach.')
jnxMbgSgwGtpV2ICsCmpDetRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 173), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCmpDetRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCmpDetRx.setDescription('Number of GTP packets received with cause Complete Detach.')
jnxMbgSgwGtpV2ICsCmpDetTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 174), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCmpDetTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsCmpDetTx.setDescription('Number of GTP packets sent with cause Complete Detach.')
jnxMbgSgwGtpV2ICsRATChgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 175), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRATChgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRATChgRx.setDescription('Number of GTP packets received with cause RAT changed from 3GPP to non 3GPP.')
jnxMbgSgwGtpV2ICsRATChgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 176), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRATChgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRATChgTx.setDescription('Number of GTP packets sent with cause RAT changed from 3GPP to non 3GPP.')
jnxMbgSgwGtpV2ICsISRDeactRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 177), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsISRDeactRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsISRDeactRx.setDescription('Number of GTP packets received with cause ISR Deactivated.')
jnxMbgSgwGtpV2ICsISRDeactTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 178), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsISRDeactTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsISRDeactTx.setDescription('Number of GTP packets sent with cause ISR Deactivated.')
jnxMbgSgwGtpV2ICsEIFRNCEnRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 179), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsEIFRNCEnRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsEIFRNCEnRx.setDescription('Number of GTP packets received with cause Error Indication from RNC eNodeB.')
jnxMbgSgwGtpV2ICsEIFRNCEnTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 180), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsEIFRNCEnTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsEIFRNCEnTx.setDescription('Number of GTP packets sent with cause Error Indication from RNC eNodeB.')
jnxMbgSgwGtpV2ICsSemErTADRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 181), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSemErTADRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSemErTADRx.setDescription('Number of GTP packets received with cause Semantic Error in TAD Operation.')
jnxMbgSgwGtpV2ICsSemErTADTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 182), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSemErTADTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSemErTADTx.setDescription('Number of GTP packets sent with cause Semantic Error in TAD Operation.')
jnxMbgSgwGtpV2ICsSynErTADRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 183), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSynErTADRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSynErTADRx.setDescription('Number of GTP packets received with cause Syntactic Error in TAD Operation.')
jnxMbgSgwGtpV2ICsSynErTADTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 184), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSynErTADTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsSynErTADTx.setDescription('Number of GTP packets sent with cause Syntactic Error in TAD Operation.')
jnxMbgSgwGtpV2ICsRMValRcvRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 185), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRMValRcvRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRMValRcvRx.setDescription('Number of GTP packets received with cause Reserved Message Value Received.')
jnxMbgSgwGtpV2ICsRMValRcvTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 186), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRMValRcvTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRMValRcvTx.setDescription('Number of GTP packets sent with cause Reserved Message Value Received.')
jnxMbgSgwGtpV2ICsRPrNtRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 187), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRPrNtRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRPrNtRspRx.setDescription('Number of GTP packets received with cause Remote peer not responding.')
jnxMbgSgwGtpV2ICsRPrNtRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 188), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRPrNtRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsRPrNtRspTx.setDescription('Number of GTP packets sent with cause Remote peer not responding.')
jnxMbgSgwGtpV2ICsColNWReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 189), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsColNWReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsColNWReqRx.setDescription('Number of GTP packets received with cause Collision with network initiated request.')
jnxMbgSgwGtpV2ICsColNWReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 190), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsColNWReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsColNWReqTx.setDescription('Number of GTP packets sent with cause Collision with network initiated request.')
jnxMbgSgwGtpV2ICsUnPgUESusRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 191), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnPgUESusRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnPgUESusRx.setDescription('Number of GTP packets received with cause Unable to page UE due to suspension.')
jnxMbgSgwGtpV2ICsUnPgUESusTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 192), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnPgUESusTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsUnPgUESusTx.setDescription('Number of GTP packets sent with cause Unable to page UE due to suspension.')
jnxMbgSgwGtpV2ICsInvTotLenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 193), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvTotLenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvTotLenRx.setDescription('Number of GTP packets received with cause Invalid total len.')
jnxMbgSgwGtpV2ICsInvTotLenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 194), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvTotLenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvTotLenTx.setDescription('Number of GTP packets sent with cause Invalid total len.')
jnxMbgSgwGtpV2ICsDtForNtSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 195), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDtForNtSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDtForNtSupRx.setDescription('Number of GTP packets received with cause Data forwarding not supported.')
jnxMbgSgwGtpV2ICsDtForNtSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 196), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDtForNtSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsDtForNtSupTx.setDescription('Number of GTP packets sent with cause Data forwarding not supported.')
jnxMbgSgwGtpV2ICsInReFRePrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 197), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInReFRePrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInReFRePrRx.setDescription('Number of GTP packets received with cause Invalid Reply from Remote peer.')
jnxMbgSgwGtpV2ICsInReFRePrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 198), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInReFRePrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInReFRePrTx.setDescription('Number of GTP packets sent with cause Invalid Reply from Remote peer.')
jnxMbgSgwGtpV2ICsInvPrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 199), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvPrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvPrRx.setDescription('Number of GTP packets received with cause Invalid peer.')
jnxMbgSgwGtpV2ICsInvPrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 200), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvPrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV2ICsInvPrTx.setDescription('Number of GTP packets sent with cause Invalid peer.')
jnxMbgSgwGtpV1ProtocolErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 201), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1ProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1ProtocolErrRx.setDescription('Number of GTPv1 Protocol Errors Received.')
jnxMbgSgwGtpV1UnSupMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 202), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1UnSupMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1UnSupMsgRx.setDescription('Number of GTPv1 Unsupported Messages received.')
jnxMbgSgwGtpV1T3RespTmrExpRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 203), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1T3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1T3RespTmrExpRx.setDescription('Number of GTP V1 T3 timer expiries Received.')
jnxMbgSgwGtpV1EndMarkerRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 204), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EndMarkerRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EndMarkerRx.setDescription('Number of GTP V1 end marker packets received.')
jnxMbgSgwGtpV1EndMarkerTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 205), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EndMarkerTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EndMarkerTx.setDescription('Number of GTP V1 end marker packets sent.')
jnxMbgSgwGtpV1EchoReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 206), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoReqRx.setDescription('Number of GTP V1 echo request packets received.')
jnxMbgSgwGtpV1EchoReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 207), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoReqTx.setDescription('Number of GTP V1 echo request packets sent.')
jnxMbgSgwGtpV1EchoRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 208), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoRespRx.setDescription('Number of GTP V1 echo response packets received.')
jnxMbgSgwGtpV1EchoRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 209), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1EchoRespTx.setDescription('Number of GTP V1 echo response packets sent.')
jnxMbgSgwGtpV1ErrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 210), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1ErrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1ErrIndRx.setDescription('Number of GTP V1 Error Indication packets received.')
jnxMbgSgwGtpV1ErrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 211), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwGtpV1ErrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpV1ErrIndTx.setDescription('Number of GTP V1 Error Indication packets sent.')
jnxMbgSgwSuspNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 212), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwSuspNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwSuspNotifRx.setDescription('Number of GTPv2 Suspend Notification messages received.')
jnxMbgSgwSuspNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 213), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwSuspNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwSuspNotifTx.setDescription('Number of GTPv2 Suspend Notification messages sent.')
jnxMbgSgwSuspAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 214), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwSuspAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwSuspAckRx.setDescription('Number of GTPv2 Suspend Acknowledgement messages received.')
jnxMbgSgwSuspAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 215), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwSuspAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwSuspAckTx.setDescription('Number of GTPv2 Suspend Acknowledgement messages sent.')
jnxMbgSgwResumeNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 216), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwResumeNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwResumeNotifRx.setDescription('Number of GTPv2 Resume Notification messages received.')
jnxMbgSgwResumeNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 217), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwResumeNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwResumeNotifTx.setDescription('Number of GTPv2 Resume Notification messages sent.')
jnxMbgSgwResumeAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 218), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwResumeAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwResumeAckRx.setDescription('Number of GTPv2 Resume Acknowledgement messages received.')
jnxMbgSgwResumeAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 219), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwResumeAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwResumeAckTx.setDescription('Number of GTPv2 Resume Acknowledgement messages sent.')
jnxMbgSgwS11PiggybackMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 220), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwS11PiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwS11PiggybackMsgRx.setDescription('Number of GTPv2 S11 Piggyback messages received.')
jnxMbgSgwS11PiggybackMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 221), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwS11PiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwS11PiggybackMsgTx.setDescription('Number of GTPv2 S11 Piggyback messages sent.')
jnxMbgSgwS4PiggybackMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 222), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwS4PiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwS4PiggybackMsgRx.setDescription('Number of GTPv2 S4 Piggyback messages received.')
jnxMbgSgwS4PiggybackMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 223), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwS4PiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwS4PiggybackMsgTx.setDescription('Number of GTPv2 S4 Piggyback messages sent.')
jnxMbgSgwS5PiggybackMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 224), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwS5PiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwS5PiggybackMsgRx.setDescription('Number of GTPv2 S5 Piggyback messages received.')
jnxMbgSgwS5PiggybackMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 225), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwS5PiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwS5PiggybackMsgTx.setDescription('Number of GTPv2 S5 Piggyback messages sent.')
jnxMbgSgwGtpCPerPeerStatsTable = MibTable((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1), )
if mibBuilder.loadTexts: jnxMbgSgwGtpCPerPeerStatsTable.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpCPerPeerStatsTable.setDescription('Each entry corresponds to a GTP per peer level control statistic.')
jnxMbgSgwGtpPerPeerStatsEntry = MibTableRow((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1), ).setIndexNames((0, "JUNIPER-MOBILE-GATEWAYS", "jnxMbgGwIndex"), (0, "JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwPPGtpRmtAddr"), (0, "JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwPPGtpLclAddr"), (0, "JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwPPGtpRtgInst"))
if mibBuilder.loadTexts: jnxMbgSgwGtpPerPeerStatsEntry.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpPerPeerStatsEntry.setDescription('A specification of the GTPC peer level Statistics.')
jnxMbgSgwPPGtpRmtAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 1), IpAddress())
if mibBuilder.loadTexts: jnxMbgSgwPPGtpRmtAddr.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpRmtAddr.setDescription('The Remote IP address of this GTP peer entry.')
jnxMbgSgwPPGtpLclAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 2), IpAddress())
if mibBuilder.loadTexts: jnxMbgSgwPPGtpLclAddr.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpLclAddr.setDescription('The Local IP address of this GTP peer entry.')
jnxMbgSgwPPGtpRtgInst = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 3), Unsigned32())
if mibBuilder.loadTexts: jnxMbgSgwPPGtpRtgInst.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpRtgInst.setDescription('The Routing Instance for this Peer.')
jnxMbgSgwPPRxPacketsDropped = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 4), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPRxPacketsDropped.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPRxPacketsDropped.setDescription('Number of Received Packets Dropped.')
jnxMbgSgwPPPacketAllocFail = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 5), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPPacketAllocFail.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPPacketAllocFail.setDescription('Number of Packet allocation failures.')
jnxMbgSgwPPPacketSendFail = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 6), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPPacketSendFail.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPPacketSendFail.setDescription('Number of Packet Send failures.')
jnxMbgSgwPPIPVerErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 7), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPIPVerErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPIPVerErrRx.setDescription('Number of IP Version Error Packets Received.')
jnxMbgSgwPPIPProtoErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 8), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPIPProtoErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPIPProtoErrRx.setDescription('Number of IP Protocol Error packets Received.')
jnxMbgSgwPPGTPPortErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 9), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGTPPortErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGTPPortErrRx.setDescription('Number of Port Error Packets Received.')
jnxMbgSgwPPGTPUnknVerRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 10), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGTPUnknVerRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGTPUnknVerRx.setDescription('Number of Unknown Version Packets Received.')
jnxMbgSgwPPPcktLenErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 11), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPPcktLenErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPPcktLenErrRx.setDescription('Number of Packet Length Error Packets Received.')
jnxMbgSgwPPUnknMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 12), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUnknMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUnknMsgRx.setDescription('Number of Unknown Messages Received.')
jnxMbgSgwPPProtocolErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 13), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPProtocolErrRx.setDescription('Number of GTPv2 Protocol Errors Received.')
jnxMbgSgwPPUnSupportedMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 14), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUnSupportedMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUnSupportedMsgRx.setDescription('Number of GTPv2 Unsupported Messages received.')
jnxMbgSgwPPT3RespTmrExpRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 15), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPT3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPT3RespTmrExpRx.setDescription('Number of GTP V2 T3 timer expiries Received.')
jnxMbgSgwPPV2NumMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 16), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumMsgRx.setDescription('Number of GTPv2 messages received.')
jnxMbgSgwPPV2NumMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 17), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumMsgTx.setDescription('Number of GTPV2 messages sent.')
jnxMbgSgwPPV2NumBytesRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 18), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumBytesRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumBytesRx.setDescription('Number of GTPv2 bytes received.')
jnxMbgSgwPPV2NumBytesTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 19), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumBytesTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2NumBytesTx.setDescription('Number of GTPV2 bytes sent.')
jnxMbgSgwPPV2EchoReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 20), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoReqRx.setDescription('Number of GTP V2 Echo Request received.')
jnxMbgSgwPPV2EchoReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 21), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoReqTx.setDescription('Number of GTP V2 Echo Request Sent.')
jnxMbgSgwPPV2EchoRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 22), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoRespRx.setDescription('Number of GTP V2 Echo Response received.')
jnxMbgSgwPPV2EchoRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 23), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2EchoRespTx.setDescription('Number of GTP V2 Echo Response Sent.')
jnxMbgSgwPPV2VerNotSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 24), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2VerNotSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2VerNotSupRx.setDescription('Number of GTP V2 Version Not supported messages received')
jnxMbgSgwPPV2VerNotSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 25), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPV2VerNotSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPV2VerNotSupTx.setDescription('Number of GTP V2 Number of version not supported messages sent.')
jnxMbgSgwPPCreateSessReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 26), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessReqRx.setDescription('Number of GTP V2 Create Session Requests received.')
jnxMbgSgwPPCreateSessReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 27), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessReqTx.setDescription('Number of GTP V2 Create Session Requests Sent.')
jnxMbgSgwPPCreateSessRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 28), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessRspRx.setDescription('Number of GTP V2 Create Session Responses received.')
jnxMbgSgwPPCreateSessRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 29), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCreateSessRspTx.setDescription('Number of GTP V2 Create Session Responses Sent.')
jnxMbgSgwPPModBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 30), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrReqRx.setDescription('Number of GTP V2 Modify Bearer Requests received.')
jnxMbgSgwPPModBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 31), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrReqTx.setDescription('Number of GTP V2 Modify Bearer Requests Sent.')
jnxMbgSgwPPModBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 32), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrRspRx.setDescription('Number of GTP V2 Modify Bearer Responses received.')
jnxMbgSgwPPModBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 33), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrRspTx.setDescription('Number of GTP V2 Modify Bearer Responses Sent.')
jnxMbgSgwPPDelSessReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 34), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessReqRx.setDescription('Number of GTP V2 Delete Session Requests received.')
jnxMbgSgwPPDelSessReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 35), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessReqTx.setDescription('Number of GTP V2 Delete Session Requests Sent.')
jnxMbgSgwPPDelSessRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 36), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessRspRx.setDescription('Number of GTP V2 Delete Session Responses received.')
jnxMbgSgwPPDelSessRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 37), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelSessRspTx.setDescription('Number of GTP V2 Delete Session Responses Sent.')
jnxMbgSgwPPCrtBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 38), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrReqRx.setDescription('Number of GTP V2 Create Bearer Requests received.')
jnxMbgSgwPPCrtBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 39), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrReqTx.setDescription('Number of GTP V2 Create Bearer Requests Sent.')
jnxMbgSgwPPCrtBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 40), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrRspRx.setDescription('Number of GTP V2 Create Bearer Response received.')
jnxMbgSgwPPCrtBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 41), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrtBrRspTx.setDescription('Number of GTP V2 Create Bearer Response Sent.')
jnxMbgSgwPPUpdBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 42), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrReqRx.setDescription('Number of GTP V2 Update Bearer Request received.')
jnxMbgSgwPPUpdBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 43), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrReqTx.setDescription('Number of GTP V2 Update Bearer Request Sent.')
jnxMbgSgwPPUpdBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 44), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrRspRx.setDescription('Number of GTP V2 Update Bearer Response received.')
jnxMbgSgwPPUpdBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 45), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdBrRspTx.setDescription('Number of GTP V2 Update Bearer Response Sent.')
jnxMbgSgwPPDelBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 46), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrReqRx.setDescription('Number of GTP V2 Delete Bearer Request received.')
jnxMbgSgwPPDelBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 47), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrReqTx.setDescription('Number of GTP V2 Delete Bearer Request Sent.')
jnxMbgSgwPPDelBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 48), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrRspRx.setDescription('Number of GTP V2 Delete Bearer Response received.')
jnxMbgSgwPPDelBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 49), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrRspTx.setDescription('Number of GTP V2 Delete Bearer Response Sent.')
jnxMbgSgwPPDelConnSetReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 50), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetReqRx.setDescription('Number of GTP V2 Delete PDN connection set Request received.')
jnxMbgSgwPPDelConnSetReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 51), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetReqTx.setDescription('Number of GTP V2 Delete PDN connection set Request Sent.')
jnxMbgSgwPPDelConnSetRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 52), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetRspRx.setDescription('Number of GTP V2 Delete PDN connection set Response received.')
jnxMbgSgwPPDelConnSetRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 53), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelConnSetRspTx.setDescription('Number of GTP V2 Delete PDN connection set Response Sent.')
jnxMbgSgwPPUpdConnSetReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 54), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetReqRx.setDescription('Number of GTP V2 Update Connection set Request received.')
jnxMbgSgwPPUpdConnSetReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 55), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetReqTx.setDescription('Number of GTP V2 Update Connection set Request Sent.')
jnxMbgSgwPPUpdConnSetRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 56), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetRspRx.setDescription('Number of GTP V2 Update Connection set Response received.')
jnxMbgSgwPPUpdConnSetRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 57), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPUpdConnSetRspTx.setDescription('Number of GTP V2 Update Connection set Response Sent.')
jnxMbgSgwPPModBrCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 58), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrCmdRx.setDescription('Number of GTP V2 Modify Bearer Command received.')
jnxMbgSgwPPModBrCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 59), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrCmdTx.setDescription('Number of GTP V2 Modify Bearer Command Sent.')
jnxMbgSgwPPModBrFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 60), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrFlrIndRx.setDescription('Number of GTP V2 Modify Bearer Failure received.')
jnxMbgSgwPPModBrFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 61), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPModBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPModBrFlrIndTx.setDescription('Number of GTP V2 Modify Bearer Failure Sent.')
jnxMbgSgwPPDelBrCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 62), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrCmdRx.setDescription('Number of GTP V2 Delete Bearer Command received.')
jnxMbgSgwPPDelBrCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 63), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrCmdTx.setDescription('Number of GTP V2 Delete Bearer Command Sent.')
jnxMbgSgwPPDelBrFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 64), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrFlrIndRx.setDescription('Number of GTP V2 Delete Bearer Failure received.')
jnxMbgSgwPPDelBrFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 65), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelBrFlrIndTx.setDescription('Number of GTP V2 Delete Bearer Failure Sent.')
jnxMbgSgwPPBrResCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 66), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPBrResCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPBrResCmdRx.setDescription('Number of GTP V2 Bearer Response Command received.')
jnxMbgSgwPPBrResCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 67), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPBrResCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPBrResCmdTx.setDescription('Number of GTP V2 Bearer Response Command Sent.')
jnxMbgSgwPPBrResFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 68), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPBrResFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPBrResFlrIndRx.setDescription('Number of GTP V2 Bearer Resource Failure received.')
jnxMbgSgwPPBrResFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 69), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPBrResFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPBrResFlrIndTx.setDescription('Number of GTP V2 Bearer Resource Failure Sent.')
jnxMbgSgwPPRelAcsBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 70), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrReqRx.setDescription('Number of GTP V2 Release Access Bearer Requests received.')
jnxMbgSgwPPRelAcsBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 71), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrReqTx.setDescription('Number of GTP V2 Release Access Bearer Requests sent.')
jnxMbgSgwPPRelAcsBrRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 72), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrRespRx.setDescription('Number of GTP V2 Release Access Bearer Response received.')
jnxMbgSgwPPRelAcsBrRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 73), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPRelAcsBrRespTx.setDescription('Number of GTP V2 Release Access Bearer Response sent.')
jnxMbgSgwPPCrIndTunReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 74), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunReqRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request Received')
jnxMbgSgwPPCrIndTunReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 75), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunReqTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request sent')
jnxMbgSgwPPCrIndTunRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 76), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunRespRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response Received')
jnxMbgSgwPPCrIndTunRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 77), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPCrIndTunRespTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response sent')
jnxMbgSgwPPDelIndTunReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 78), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunReqRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request Received')
jnxMbgSgwPPDelIndTunReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 79), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunReqTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request sent.')
jnxMbgSgwPPDelIndTunRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 80), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunRespRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response Received')
jnxMbgSgwPPDelIndTunRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 81), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDelIndTunRespTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response sent.')
jnxMbgSgwPPDlDataNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 82), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotifRx.setDescription('Number of GTP V2 Downlink Data Notify received.')
jnxMbgSgwPPDlDataNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 83), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotifTx.setDescription('Number of GTP V2 Downlink Data Notify Sent.')
jnxMbgSgwPPDlDataAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 84), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataAckRx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement received.')
jnxMbgSgwPPDlDataAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 85), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataAckTx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement Sent.')
jnxMbgSgwPPDlDataNotiFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 86), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotiFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotiFlrIndRx.setDescription('Number of GTP V2 Downlink Data Notification fail received.')
jnxMbgSgwPPDlDataNotiFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 87), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotiFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPDlDataNotiFlrIndTx.setDescription('Number of GTP V2 Downlink Data Notification fail Sent.')
jnxMbgSgwPPStopPagingIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 88), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPStopPagingIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPStopPagingIndRx.setDescription('Number of GTP V2 Number of Stop Paging Indication Messages Received.')
jnxMbgSgwPPStopPagingIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 89), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPStopPagingIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPStopPagingIndTx.setDescription('Number of GTP V2 Number of Stop Paging Indicaton messages sent')
jnxMbgSgwPPGtpV2ICsPageRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 90), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPageRx.setStatus('obsolete')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPageRx.setDescription('Number of GTPV2 packets received with cause Page.')
jnxMbgSgwPPGtpV2ICsPageTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 91), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPageTx.setStatus('obsolete')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPageTx.setDescription('Number of GTP packets sent with cause Page.')
jnxMbgSgwPPGtpV2ICsReqAcceptRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 92), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqAcceptRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqAcceptRx.setDescription('Number of GTPV2 packets received with cause Request Accept.')
jnxMbgSgwPPGtpV2ICsReqAcceptTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 93), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqAcceptTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqAcceptTx.setDescription('Number of GTP packets sent with cause Request Accept.')
jnxMbgSgwPPGtpV2ICsAcceptPartRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 94), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAcceptPartRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAcceptPartRx.setDescription('Number of GTPV2 packets received with cause Accept Partial.')
jnxMbgSgwPPGtpV2ICsAcceptPartTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 95), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAcceptPartTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAcceptPartTx.setDescription('Number of GTP packets sent with cause Accept Partial.')
jnxMbgSgwPPGtpV2ICsNewPTNPrefRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 96), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNewPTNPrefRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNewPTNPrefRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Network Preference.')
jnxMbgSgwPPGtpV2ICsNewPTNPrefTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 97), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNewPTNPrefTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNewPTNPrefTx.setDescription('Number of GTP packets sent with cause New PDN type due to Network Preference.')
jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 98), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Single Address Bearer.')
jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 99), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx.setDescription('Number of GTP packets sent with cause New PDN type due to Single Address Bearer.')
jnxMbgSgwPPGtpV2ICsCtxNotFndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 100), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCtxNotFndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCtxNotFndRx.setDescription('Number of GTPV2 packets received with cause Context not found.')
jnxMbgSgwPPGtpV2ICsCtxNotFndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 101), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCtxNotFndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCtxNotFndTx.setDescription('Number of GTP packets sent with cause Context not found.')
jnxMbgSgwPPGtpV2ICsInvMsgFmtRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 102), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvMsgFmtRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvMsgFmtRx.setDescription('Number of GTPV2 packets received with cause Invalid Message Format.')
jnxMbgSgwPPGtpV2ICsInvMsgFmtTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 103), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvMsgFmtTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvMsgFmtTx.setDescription('Number of GTP packets sent with cause Invalid Message Format.')
jnxMbgSgwPPGtpV2ICsVerNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 104), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsVerNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsVerNotSuppRx.setDescription('Number of GTPV2 packets received with cause Version not Supported.')
jnxMbgSgwPPGtpV2ICsVerNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 105), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsVerNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsVerNotSuppTx.setDescription('Number of GTP packets sent with cause Version not Supported.')
jnxMbgSgwPPGtpV2ICsInvLenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 106), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvLenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvLenRx.setDescription('Number of GTPV2 packets received with cause Invalid Length.')
jnxMbgSgwPPGtpV2ICsInvLenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 107), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvLenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvLenTx.setDescription('Number of GTP packets sent with cause Invalid Length.')
jnxMbgSgwPPGtpV2ICsServNotSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 108), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServNotSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServNotSupRx.setDescription('Number of GTPV2 packets received with cause Service Not supported.')
jnxMbgSgwPPGtpV2ICsServNotSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 109), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServNotSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServNotSupTx.setDescription('Number of GTP packets sent with cause Service Not supported.')
jnxMbgSgwPPGtpV2ICsManIEIncorRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 110), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEIncorRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEIncorRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE incorrect.')
jnxMbgSgwPPGtpV2ICsManIEIncorTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 111), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEIncorTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEIncorTx.setDescription('Number of GTP packets sent with cause Mandatory IE incorrect.')
jnxMbgSgwPPGtpV2ICsManIEMissRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 112), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEMissRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEMissRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE Missing.')
jnxMbgSgwPPGtpV2ICsManIEMissTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 113), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEMissTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsManIEMissTx.setDescription('Number of GTP packets sent with cause Mandatory IE Missing.')
jnxMbgSgwPPGtpV2ICsOptIEIncorRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 114), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsOptIEIncorRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsOptIEIncorRx.setDescription('Number of GTPV2 packets received with cause Optional IE Incorrect.')
jnxMbgSgwPPGtpV2ICsOptIEIncorTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 115), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsOptIEIncorTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsOptIEIncorTx.setDescription('Number of GTP packets sent with cause Optional IE Incorrect.')
jnxMbgSgwPPGtpV2ICsSysFailRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 116), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSysFailRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSysFailRx.setDescription('Number of GTPV2 packets received with cause System Failure.')
jnxMbgSgwPPGtpV2ICsSysFailTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 117), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSysFailTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSysFailTx.setDescription('Number of GTP packets sent with cause System Failure.')
jnxMbgSgwPPGtpV2ICsNoResRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 118), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoResRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoResRx.setDescription('Number of GTPV2 packets received with cause No Resource.')
jnxMbgSgwPPGtpV2ICsNoResTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 119), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoResTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoResTx.setDescription('Number of GTP packets sent with cause No Resource.')
jnxMbgSgwPPGtpV2ICsTFTSMANTErRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 120), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSMANTErRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSMANTErRx.setDescription('Number of GTPV2 packets received with cause TFT Symantic Error.')
jnxMbgSgwPPGtpV2ICsTFTSMANTErTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 121), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSMANTErTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSMANTErTx.setDescription('Number of GTP packets sent with cause TFT Symantic Error.')
jnxMbgSgwPPGtpV2ICsTFTSysErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 122), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSysErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSysErrRx.setDescription('Number of GTPV2 packets received with cause TFT System Error.')
jnxMbgSgwPPGtpV2ICsTFTSysErrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 123), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSysErrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsTFTSysErrTx.setDescription('Number of GTP packets sent with cause TFT System Error.')
jnxMbgSgwPPGtpV2ICsPkFltManErRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 124), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltManErRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltManErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Symantic Error.')
jnxMbgSgwPPGtpV2ICsPkFltManErTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 125), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltManErTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltManErTx.setDescription('Number of GTP packets sent with cause Packet Filter Symantic Error.')
jnxMbgSgwPPGtpV2ICsPkFltSynErRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 126), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltSynErRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltSynErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Syntax Error.')
jnxMbgSgwPPGtpV2ICsPkFltSynErTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 127), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltSynErTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPkFltSynErTx.setDescription('Number of GTP packets sent with cause Packet Filter Syntax Error.')
jnxMbgSgwPPGtpV2ICsMisUnknAPNRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 128), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsMisUnknAPNRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsMisUnknAPNRx.setDescription('Number of GTPV2 packets received with cause Unknown APN.')
jnxMbgSgwPPGtpV2ICsMisUnknAPNTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 129), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsMisUnknAPNTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsMisUnknAPNTx.setDescription('Number of GTP packets sent with cause Unknown APN.')
jnxMbgSgwPPGtpV2ICsUnexpRptIERx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 130), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnexpRptIERx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnexpRptIERx.setDescription('Number of GTPV2 packets received with cause Unexpected Repeated IE.')
jnxMbgSgwPPGtpV2ICsUnexpRptIETx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 131), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnexpRptIETx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnexpRptIETx.setDescription('Number of GTP packets sent with cause Unexpected Repeated IE.')
jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 132), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx.setDescription('Number of GTPV2 packets received with cause GRE Key Not Found.')
jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 133), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx.setDescription('Number of GTP packets sent with cause GRE Key Not Found.')
jnxMbgSgwPPGtpV2ICsRelocFailRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 134), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRelocFailRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRelocFailRx.setDescription('Number of GTPV2 packets received with cause Relocation Failed.')
jnxMbgSgwPPGtpV2ICsRelocFailTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 135), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRelocFailTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRelocFailTx.setDescription('Number of GTP packets sent with cause Relocation Failed.')
jnxMbgSgwPPGtpV2ICsDenINRatRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 136), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDenINRatRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDenINRatRx.setDescription('Number of GTPV2 packets received with cause Denied in RAT.')
jnxMbgSgwPPGtpV2ICsDenINRatTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 137), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDenINRatTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDenINRatTx.setDescription('Number of GTP packets sent with cause Denied in RAT.')
jnxMbgSgwPPGtpV2ICsPTNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 138), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTNotSuppRx.setDescription('Number of GTPV2 packets received with cause PDN Type Not Supported.')
jnxMbgSgwPPGtpV2ICsPTNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 139), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTNotSuppTx.setDescription('Number of GTP packets sent with cause PDN Type Not Supported.')
jnxMbgSgwPPGtpV2ICsAllDynAdOcRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 140), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAllDynAdOcRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAllDynAdOcRx.setDescription('Number of GTPV2 packets received with cause Allocated Dynamic Address Occupied.')
jnxMbgSgwPPGtpV2ICsAllDynAdOcTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 141), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAllDynAdOcTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAllDynAdOcTx.setDescription('Number of GTP packets sent with cause Allocated Dynamic Address Occupied.')
jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 142), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx.setDescription('Number of GTPV2 packets received with cause UE Context Without TFT Exists.')
jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 143), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx.setDescription('Number of GTP packets sent with cause UE Context Without TFT Exists.')
jnxMbgSgwPPGtpV2ICsProtoNtSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 144), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsProtoNtSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsProtoNtSupRx.setDescription('Number of GTPV2 packets received with cause Protocol Not Supported.')
jnxMbgSgwPPGtpV2ICsProtoNtSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 145), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsProtoNtSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsProtoNtSupTx.setDescription('Number of GTP packets sent with cause Protocol Not Supported.')
jnxMbgSgwPPGtpV2ICsUENotRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 146), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUENotRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUENotRespRx.setDescription('Number of GTPV2 packets received with cause UE Not Responding.')
jnxMbgSgwPPGtpV2ICsUENotRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 147), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUENotRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUENotRespTx.setDescription('Number of GTP packets sent with cause UE Not Responding.')
jnxMbgSgwPPGtpV2ICsUERefusesRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 148), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUERefusesRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUERefusesRx.setDescription('Number of GTPV2 packets received with cause UE Refuses.')
jnxMbgSgwPPGtpV2ICsUERefusesTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 149), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUERefusesTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUERefusesTx.setDescription('Number of GTP packets sent with cause UE Refuses.')
jnxMbgSgwPPGtpV2ICsServDeniedRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 150), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServDeniedRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServDeniedRx.setDescription('Number of GTPV2 packets received with cause Service Denied.')
jnxMbgSgwPPGtpV2ICsServDeniedTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 151), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServDeniedTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsServDeniedTx.setDescription('Number of GTP packets sent with cause Service Denied.')
jnxMbgSgwPPGtpV2ICsUnabPageUERx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 152), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnabPageUERx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnabPageUERx.setDescription('Number of GTPV2 packets received with cause Unable to Page UE.')
jnxMbgSgwPPGtpV2ICsUnabPageUETx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 153), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnabPageUETx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnabPageUETx.setDescription('Number of GTP packets sent with cause Unable to Page UE.')
jnxMbgSgwPPGtpV2ICsNoMemRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 154), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoMemRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoMemRx.setDescription('Number of GTPV2 packets received with cause No Memory.')
jnxMbgSgwPPGtpV2ICsNoMemTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 155), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoMemTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsNoMemTx.setDescription('Number of GTP packets sent with cause No Memory.')
jnxMbgSgwPPGtpV2ICsUserAUTHFlRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 156), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUserAUTHFlRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUserAUTHFlRx.setDescription('Number of GTPV2 packets received with cause User AUTH Failed.')
jnxMbgSgwPPGtpV2ICsUserAUTHFlTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 157), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUserAUTHFlTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUserAUTHFlTx.setDescription('Number of GTP packets sent with cause User AUTH Failed.')
jnxMbgSgwPPGtpV2ICsAPNAcsDenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 158), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNAcsDenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNAcsDenRx.setDescription('Number of GTPV2 packets received with cause APN Access Denied.')
jnxMbgSgwPPGtpV2ICsAPNAcsDenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 159), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNAcsDenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNAcsDenTx.setDescription('Number of GTP packets sent with cause APN Access Denied.')
jnxMbgSgwPPGtpV2ICsReqRejRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 160), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqRejRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqRejRx.setDescription('Number of GTPV2 packets received with cause Request Rejected.')
jnxMbgSgwPPGtpV2ICsReqRejTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 161), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqRejTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsReqRejTx.setDescription('Number of GTP packets sent with cause Request Rejected.')
jnxMbgSgwPPGtpV2ICsPTMSISigMMRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 162), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTMSISigMMRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTMSISigMMRx.setDescription('Number of GTPV2 packets received with cause P-TMSI Signature Mismatch.')
jnxMbgSgwPPGtpV2ICsPTMSISigMMTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 163), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTMSISigMMTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsPTMSISigMMTx.setDescription('Number of GTP packets sent with cause P-TMSI Signature Mismatch.')
jnxMbgSgwPPGtpV2ICsIMSINotKnRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 164), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsIMSINotKnRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsIMSINotKnRx.setDescription('Number of GTPV2 packets received with cause IMSI Not Known.')
jnxMbgSgwPPGtpV2ICsIMSINotKnTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 165), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsIMSINotKnTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsIMSINotKnTx.setDescription('Number of GTP packets sent with cause IMSI Not Known.')
jnxMbgSgwPPGtpV2ICsCondIEMsRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 166), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCondIEMsRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCondIEMsRx.setDescription('Number of GTPV2 packets received with cause Conditional IE Missing.')
jnxMbgSgwPPGtpV2ICsCondIEMsTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 167), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCondIEMsTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCondIEMsTx.setDescription('Number of GTP packets sent with cause Conditional IE Missing.')
jnxMbgSgwPPGtpV2ICsAPNResTIncRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 168), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNResTIncRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNResTIncRx.setDescription('Number of GTPV2 packets received with cause APN Restriction Type Incompatible.')
jnxMbgSgwPPGtpV2ICsAPNResTIncTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 169), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNResTIncTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsAPNResTIncTx.setDescription('Number of GTP packets sent with cause APN Restriction Type Incompatible.')
jnxMbgSgwPPGtpV2ICsUnknownRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 170), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnknownRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnknownRx.setDescription('Number of GTPV2 packets received with cause Unknown.')
jnxMbgSgwPPGtpV2ICsUnknownTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 171), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnknownTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnknownTx.setDescription('Number of GTP packets sent with cause Unknown.')
jnxMbgSgwPPGtpV2ICsLclDetRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 172), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsLclDetRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsLclDetRx.setDescription('Number of GTP packets received with cause Local Detach.')
jnxMbgSgwPPGtpV2ICsLclDetTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 173), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsLclDetTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsLclDetTx.setDescription('Number of GTP packets sent with cause Local Detach.')
jnxMbgSgwPPGtpV2ICsCmpDetRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 174), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCmpDetRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCmpDetRx.setDescription('Number of GTP packets received with cause Complete Detach.')
jnxMbgSgwPPGtpV2ICsCmpDetTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 175), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCmpDetTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsCmpDetTx.setDescription('Number of GTP packets sent with cause Complete Detach.')
jnxMbgSgwPPGtpV2ICsRATChgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 176), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRATChgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRATChgRx.setDescription('Number of GTP packets received with cause RAT changed from 3GPP to non 3GPP.')
jnxMbgSgwPPGtpV2ICsRATChgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 177), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRATChgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRATChgTx.setDescription('Number of GTP packets sent with cause RAT changed from 3GPP to non 3GPP.')
jnxMbgSgwPPGtpV2ICsISRDeactRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 178), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsISRDeactRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsISRDeactRx.setDescription('Number of GTP packets received with cause ISR Deactivated.')
jnxMbgSgwPPGtpV2ICsISRDeactTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 179), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsISRDeactTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsISRDeactTx.setDescription('Number of GTP packets sent with cause ISR Deactivated.')
jnxMbgSgwPPGtpV2ICsEIFRNCEnRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 180), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsEIFRNCEnRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsEIFRNCEnRx.setDescription('Number of GTP packets received with cause Error Indication from RNC eNodeB.')
jnxMbgSgwPPGtpV2ICsEIFRNCEnTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 181), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsEIFRNCEnTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsEIFRNCEnTx.setDescription('Number of GTP packets sent with cause Error Indication from RNC eNodeB.')
jnxMbgSgwPPGtpV2ICsSemErTADRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 182), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSemErTADRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSemErTADRx.setDescription('Number of GTP packets received with cause Semantic Error in TAD Operation.')
jnxMbgSgwPPGtpV2ICsSemErTADTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 183), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSemErTADTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSemErTADTx.setDescription('Number of GTP packets sent with cause Semantic Error in TAD Operation.')
jnxMbgSgwPPGtpV2ICsSynErTADRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 184), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSynErTADRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSynErTADRx.setDescription('Number of GTP packets received with cause Syntactic Error in TAD Operation.')
jnxMbgSgwPPGtpV2ICsSynErTADTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 185), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSynErTADTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsSynErTADTx.setDescription('Number of GTP packets sent with cause Syntactic Error in TAD Operation.')
jnxMbgSgwPPGtpV2ICsRMValRcvRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 186), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRMValRcvRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRMValRcvRx.setDescription('Number of GTP packets received with cause Reserved Message Value Received.')
jnxMbgSgwPPGtpV2ICsRMValRcvTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 187), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRMValRcvTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRMValRcvTx.setDescription('Number of GTP packets sent with cause Reserved Message Value Received.')
jnxMbgSgwPPGtpV2ICsRPrNtRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 188), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRPrNtRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRPrNtRspRx.setDescription('Number of GTP packets received with cause Remote peer not responding.')
jnxMbgSgwPPGtpV2ICsRPrNtRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 189), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRPrNtRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsRPrNtRspTx.setDescription('Number of GTP packets sent with cause Remote peer not responding.')
jnxMbgSgwPPGtpV2ICsColNWReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 190), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsColNWReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsColNWReqRx.setDescription('Number of GTP packets received with cause Collision with network initiated request.')
jnxMbgSgwPPGtpV2ICsColNWReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 191), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsColNWReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsColNWReqTx.setDescription('Number of GTP packets sent with cause Collision with network initiated request.')
jnxMbgSgwPPGtpV2ICsUnPgUESusRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 192), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnPgUESusRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnPgUESusRx.setDescription('Number of GTP packets received with cause Unable to page UE due to suspension.')
jnxMbgSgwPPGtpV2ICsUnPgUESusTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 193), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnPgUESusTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsUnPgUESusTx.setDescription('Number of GTP packets sent with cause Unable to page UE due to suspension.')
jnxMbgSgwPPGtpV2ICsInvTotLenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 194), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvTotLenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvTotLenRx.setDescription('Number of GTP packets received with cause Invalid total len.')
jnxMbgSgwPPGtpV2ICsInvTotLenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 195), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvTotLenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvTotLenTx.setDescription('Number of GTP packets sent with cause Invalid total len.')
jnxMbgSgwPPGtpV2ICsDtForNtSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 196), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDtForNtSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDtForNtSupRx.setDescription('Number of GTP packets received with cause Data forwarding not supported.')
jnxMbgSgwPPGtpV2ICsDtForNtSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 197), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDtForNtSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsDtForNtSupTx.setDescription('Number of GTP packets sent with cause Data forwarding not supported.')
jnxMbgSgwPPGtpV2ICsInReFRePrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 198), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInReFRePrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInReFRePrRx.setDescription('Number of GTP packets received with cause Invalid Reply from Remote peer.')
jnxMbgSgwPPGtpV2ICsInReFRePrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 199), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInReFRePrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInReFRePrTx.setDescription('Number of GTP packets sent with cause Invalid Reply from Remote peer.')
jnxMbgSgwPPGtpV2ICsInvPrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 200), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvPrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvPrRx.setDescription('Number of GTP packets received with cause Invalid peer.')
jnxMbgSgwPPGtpV2ICsInvPrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 201), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvPrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV2ICsInvPrTx.setDescription('Number of GTP packets sent with cause Invalid peer.')
jnxMbgSgwPPGtpV1ProtocolErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 202), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1ProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1ProtocolErrRx.setDescription('Number of GTPv1 Protocol Errors Received.')
jnxMbgSgwPPGtpV1UnSupMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 203), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1UnSupMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1UnSupMsgRx.setDescription('Number of GTPv1 Unsupported Messages received.')
jnxMbgSgwPPGtpV1T3RespTmrExpRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 204), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1T3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1T3RespTmrExpRx.setDescription('Number of GTP V1 T3 timer expiries Received.')
jnxMbgSgwPPGtpV1EndMarkerRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 205), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EndMarkerRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EndMarkerRx.setDescription('Number of GTP V1 end marker packets received.')
jnxMbgSgwPPGtpV1EndMarkerTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 206), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EndMarkerTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EndMarkerTx.setDescription('Number of GTP V1 end marker packets sent.')
jnxMbgSgwPPGtpV1EchoReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 207), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoReqRx.setDescription('Number of GTP V1 echo request packets received.')
jnxMbgSgwPPGtpV1EchoReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 208), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoReqTx.setDescription('Number of GTP iV1 echo request packets sent.')
jnxMbgSgwPPGtpV1EchoRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 209), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoRespRx.setDescription('Number of GTP V1 echo response packets received.')
jnxMbgSgwPPGtpV1EchoRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 210), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1EchoRespTx.setDescription('Number of GTP V1 echo response packets sent.')
jnxMbgSgwPPGtpV1ErrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 211), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1ErrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1ErrIndRx.setDescription('Number of GTP V1 Error Indication packets received.')
jnxMbgSgwPPGtpV1ErrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 212), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1ErrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPGtpV1ErrIndTx.setDescription('Number of GTP V1 Error Indication packets sent.')
jnxMbgSgwPPSuspNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 213), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPSuspNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPSuspNotifRx.setDescription('Number of GTPv2 Suspend Notification messages received.')
jnxMbgSgwPPSuspNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 214), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPSuspNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPSuspNotifTx.setDescription('Number of GTPv2 Suspend Notification messages sent.')
jnxMbgSgwPPSuspAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 215), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPSuspAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPSuspAckRx.setDescription('Number of GTPv2 Suspend Acknowledgement messages received.')
jnxMbgSgwPPSuspAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 216), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPSuspAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPSuspAckTx.setDescription('Number of GTPv2 Suspend Acknowledgement messages sent.')
jnxMbgSgwPPResumeNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 217), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPResumeNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPResumeNotifRx.setDescription('Number of GTPv2 Resume Notification messages received.')
jnxMbgSgwPPResumeNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 218), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPResumeNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPResumeNotifTx.setDescription('Number of GTPv2 Resume Notification messages sent.')
jnxMbgSgwPPResumeAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 219), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPResumeAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPResumeAckRx.setDescription('Number of GTPv2 Resume Acknowledgement messages received.')
jnxMbgSgwPPResumeAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 220), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPResumeAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPResumeAckTx.setDescription('Number of GTPv2 Resume Acknowledgement messages sent.')
jnxMbgSgwPPPiggybackMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 221), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPPiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPPiggybackMsgRx.setDescription('Number of GTPv2 Piggyback messages received.')
jnxMbgSgwPPPiggybackMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 222), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwPPPiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwPPPiggybackMsgTx.setDescription('Number of GTPv2 S11 Piggyback messages sent.')
jnxMbgSgwGtpIfStatsTable = MibTable((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4), )
if mibBuilder.loadTexts: jnxMbgSgwGtpIfStatsTable.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpIfStatsTable.setDescription('Each entry corresponds to an interface level GTP statistic.')
jnxMbgSgwGtpIfStatsEntry = MibTableRow((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1), ).setIndexNames((0, "JUNIPER-MOBILE-GATEWAYS", "jnxMbgGwIndex"), (0, "JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwIfIndex"))
if mibBuilder.loadTexts: jnxMbgSgwGtpIfStatsEntry.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpIfStatsEntry.setDescription('A specification of the GTP interface level control Statistics.')
jnxMbgSgwIfIndex = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 1), Unsigned32())
if mibBuilder.loadTexts: jnxMbgSgwIfIndex.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfIndex.setDescription('GTP Interface Index')
jnxMbgSgwIfType = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 2), DisplayString()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfType.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfType.setDescription('Interface Name.')
jnxMbgSgwIfRxPacketsDropped = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 3), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfRxPacketsDropped.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfRxPacketsDropped.setDescription('Number of Received GTP Packets Dropped by the Gateway.')
jnxMbgSgwIfPacketAllocFail = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 4), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfPacketAllocFail.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfPacketAllocFail.setDescription('Number of Packet allocation failures in the Gateway.')
jnxMbgSgwIfPacketSendFail = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 5), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfPacketSendFail.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfPacketSendFail.setDescription('Number of GTP Packet Send failures in the Gateway.')
jnxMbgSgwIfIPVerErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 6), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfIPVerErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfIPVerErrRx.setDescription('Number of IP Version Error Packets Received.')
jnxMbgSgwIfIPProtoErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 7), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfIPProtoErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfIPProtoErrRx.setDescription('Number of IP Protocol Error packets Received.')
jnxMbgSgwIfGTPPortErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 8), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGTPPortErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGTPPortErrRx.setDescription('Number of Port Error Packets Received.')
jnxMbgSgwIfGTPUnknVerRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 9), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGTPUnknVerRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGTPUnknVerRx.setDescription('Number of Unknown Version Packets Received.')
jnxMbgSgwIfPcktLenErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 10), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfPcktLenErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfPcktLenErrRx.setDescription('Number of Packet Length Error Packets Received.')
jnxMbgSgwIfUnknMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 11), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUnknMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUnknMsgRx.setDescription('Number of Unknown Messages Received.')
jnxMbgSgwIfProtocolErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 12), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfProtocolErrRx.setDescription('Number of GTPv2 Protocol Errors Received.')
jnxMbgSgwIfUnSupportedMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 13), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUnSupportedMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUnSupportedMsgRx.setDescription('Number of GTPv2 Unsupported Messages received.')
jnxMbgSgwIfT3RespTmrExpRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 14), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfT3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfT3RespTmrExpRx.setDescription('Number of GTP V2 T3 timer expiries Received.')
jnxMbgSgwIfV2NumMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 15), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumMsgRx.setDescription('Number of GTPv2 messages received.')
jnxMbgSgwIfV2NumMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 16), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumMsgTx.setDescription('Number of V2 messages sent.')
jnxMbgSgwIfV2NumBytesRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 17), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumBytesRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumBytesRx.setDescription('Number of GTPv2 bytes received.')
jnxMbgSgwIfV2NumBytesTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 18), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumBytesTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2NumBytesTx.setDescription('Number of V2 bytes sent.')
jnxMbgSgwIfV2EchoReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 19), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoReqRx.setDescription('Number of GTP V2 Echo Request received.')
jnxMbgSgwIfV2EchoReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 20), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoReqTx.setDescription('Number of GTP V2 Echo Request Sent.')
jnxMbgSgwIfV2EchoRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 21), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoRespRx.setDescription('Number of GTP V2 Echo Response received.')
jnxMbgSgwIfV2EchoRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 22), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2EchoRespTx.setDescription('Number of GTP V2 Echo Response Sent.')
jnxMbgSgwIfV2VerNotSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 23), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2VerNotSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2VerNotSupRx.setDescription('Number of GTP V2 Version Not supported messages received')
jnxMbgSgwIfV2VerNotSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 24), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfV2VerNotSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfV2VerNotSupTx.setDescription('Number of GTP V2 version not supported messages sent.')
jnxMbgSgwIfCreateSessReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 25), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessReqRx.setDescription('Number of GTP V2 Create Session Requests received.')
jnxMbgSgwIfCreateSessReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 26), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessReqTx.setDescription('Number of GTP V2 Create Session Requests Sent.')
jnxMbgSgwIfCreateSessRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 27), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessRspRx.setDescription('Number of GTP V2 Create Session Responses received.')
jnxMbgSgwIfCreateSessRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 28), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCreateSessRspTx.setDescription('Number of GTP V2 Create Session Responses Sent.')
jnxMbgSgwIfModBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 29), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrReqRx.setDescription('Number of GTP V2 Modify Bearer Requests received.')
jnxMbgSgwIfModBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 30), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrReqTx.setDescription('Number of GTP V2 Modify Bearer Requests Sent.')
jnxMbgSgwIfModBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 31), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrRspRx.setDescription('Number of GTP V2 Modify Bearer Responses received.')
jnxMbgSgwIfModBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 32), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrRspTx.setDescription('Number of GTP V2 Modify Bearer Responses Sent.')
jnxMbgSgwIfDelSessReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 33), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessReqRx.setDescription('Number of GTP V2 Delete Session Requests received.')
jnxMbgSgwIfDelSessReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 34), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessReqTx.setDescription('Number of GTP V2 Delete Session Requests Sent.')
jnxMbgSgwIfDelSessRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 35), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessRspRx.setDescription('Number of GTP V2 Delete Session Responses received.')
jnxMbgSgwIfDelSessRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 36), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelSessRspTx.setDescription('Number of GTP V2 Delete Session Responses Sent.')
jnxMbgSgwIfCrtBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 37), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrReqRx.setDescription('Number of GTP V2 Create Bearer Requests received.')
jnxMbgSgwIfCrtBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 38), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrReqTx.setDescription('Number of GTP V2 Create Bearer Requests Sent.')
jnxMbgSgwIfCrtBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 39), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrRspRx.setDescription('Number of GTP V2 Create Bearer Response received.')
jnxMbgSgwIfCrtBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 40), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrtBrRspTx.setDescription('Number of GTP V2 Create Bearer Response Sent.')
jnxMbgSgwIfUpdBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 41), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrReqRx.setDescription('Number of GTP V2 Update Bearer Request received.')
jnxMbgSgwIfUpdBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 42), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrReqTx.setDescription('Number of GTP V2 Update Bearer Request Sent.')
jnxMbgSgwIfUpdBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 43), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrRspRx.setDescription('Number of GTP V2 Update Bearer Response received.')
jnxMbgSgwIfUpdBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 44), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdBrRspTx.setDescription('Number of GTP V2 Update Bearer Response Sent.')
jnxMbgSgwIfDelBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 45), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrReqRx.setDescription('Number of GTP V2 Delete Bearer Request received.')
jnxMbgSgwIfDelBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 46), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrReqTx.setDescription('Number of GTP V2 Delete Bearer Request Sent.')
jnxMbgSgwIfDelBrRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 47), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrRspRx.setDescription('Number of GTP V2 Delete Bearer Response received.')
jnxMbgSgwIfDelBrRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 48), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrRspTx.setDescription('Number of GTP V2 Delete Bearer Response Sent.')
jnxMbgSgwIfDelConnSetReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 49), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetReqRx.setDescription('Number of GTP V2 Delete PDN connection set Request received.')
jnxMbgSgwIfDelConnSetReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 50), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetReqTx.setDescription('Number of GTP V2 Delete PDN connection set Request Sent.')
jnxMbgSgwIfDelConnSetRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 51), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetRspRx.setDescription('Number of GTP V2 Delete PDN connection set Response received.')
jnxMbgSgwIfDelConnSetRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 52), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelConnSetRspTx.setDescription('Number of GTP V2 Delete PDN connection set Response Sent.')
jnxMbgSgwIfUpdConnSetReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 53), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetReqRx.setDescription('Number of GTP V2 Update Connection set Request received.')
jnxMbgSgwIfUpdConnSetReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 54), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetReqTx.setDescription('Number of GTP V2 Update Connection set Request Sent.')
jnxMbgSgwIfUpdConnSetRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 55), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetRspRx.setDescription('Number of GTP V2 Update Connection set Response received.')
jnxMbgSgwIfUpdConnSetRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 56), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfUpdConnSetRspTx.setDescription('Number of GTP V2 Update Connection set Response Sent.')
jnxMbgSgwIfModBrCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 57), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrCmdRx.setDescription('Number of GTP V2 Modify Bearer Command received.')
jnxMbgSgwIfModBrCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 58), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrCmdTx.setDescription('Number of GTP V2 Modify Bearer Command Sent.')
jnxMbgSgwIfModBrFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 59), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrFlrIndRx.setDescription('Number of GTP V2 Modify Bearer Failure received.')
jnxMbgSgwIfModBrFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 60), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfModBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfModBrFlrIndTx.setDescription('Number of GTP V2 Modify Bearer Failure Sent.')
jnxMbgSgwIfDelBrCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 61), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrCmdRx.setDescription('Number of GTP V2 Delete Bearer Command received.')
jnxMbgSgwIfDelBrCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 62), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrCmdTx.setDescription('Number of GTP V2 Delete Bearer Command Sent.')
jnxMbgSgwIfDelBrFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 63), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrFlrIndRx.setDescription('Number of GTP V2 Delete Bearer Failure received.')
jnxMbgSgwIfDelBrFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 64), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelBrFlrIndTx.setDescription('Number of GTP V2 Delete Bearer Failure Sent.')
jnxMbgSgwIfBrResCmdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 65), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfBrResCmdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfBrResCmdRx.setDescription('Number of GTP V2 Bearer Response Command received.')
jnxMbgSgwIfBrResCmdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 66), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfBrResCmdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfBrResCmdTx.setDescription('Number of GTP V2 Bearer Response Command Sent.')
jnxMbgSgwIfBrResFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 67), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfBrResFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfBrResFlrIndRx.setDescription('Number of GTP V2 Bearer Resource Failure received.')
jnxMbgSgwIfBrResFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 68), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfBrResFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfBrResFlrIndTx.setDescription('Number of GTP V2 Bearer Resource Failure Sent.')
jnxMbgSgwIfRelAcsBrReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 69), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrReqRx.setDescription('Number of GTP V2 Release Access Bearer Requests received.')
jnxMbgSgwIfRelAcsBrReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 70), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrReqTx.setDescription('Number of GTP V2 Release Access Bearer Requests sent.')
jnxMbgSgwIfRelAcsBrRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 71), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrRespRx.setDescription('Number of GTP V2 Release Access Bearer Response received.')
jnxMbgSgwIfRelAcsBrRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 72), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfRelAcsBrRespTx.setDescription('Number of GTP V2 Release Access Bearer Response sent.')
jnxMbgSgwIfCrIndTunReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 73), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunReqRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request Received')
jnxMbgSgwIfCrIndTunReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 74), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunReqTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request sent')
jnxMbgSgwIfCrIndTunRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 75), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunRespRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response Received')
jnxMbgSgwIfCrIndTunRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 76), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfCrIndTunRespTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response sent')
jnxMbgSgwIfDelIndTunReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 77), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunReqRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request Received')
jnxMbgSgwIfDelIndTunReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 78), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunReqTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request sent.')
jnxMbgSgwIfDelIndTunRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 79), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunRespRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response Received')
jnxMbgSgwIfDelIndTunRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 80), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDelIndTunRespTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response sent.')
jnxMbgSgwIfDlDataNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 81), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotifRx.setDescription('Number of GTP V2 Downlink Data Notify received.')
jnxMbgSgwIfDlDataNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 82), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotifTx.setDescription('Number of GTP V2 Downlink Data Notify Sent.')
jnxMbgSgwIfDlDataAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 83), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataAckRx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement received.')
jnxMbgSgwIfDlDataAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 84), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataAckTx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement Sent.')
jnxMbgSgwIfDlDataNotiFlrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 85), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotiFlrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotiFlrIndRx.setDescription('Number of GTP V2 Downlink Data Notification fail received.')
jnxMbgSgwIfDlDataNotiFlrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 86), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotiFlrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfDlDataNotiFlrIndTx.setDescription('Number of GTP V2 Downlink Data Notification fail Sent.')
jnxMbgSgwIfStopPagingIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 87), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfStopPagingIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfStopPagingIndRx.setDescription('Number of GTP V2 Number of Stop Paging Indication Messages Received.')
jnxMbgSgwIfStopPagingIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 88), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfStopPagingIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfStopPagingIndTx.setDescription('Number of GTP V2 Number of Stop Paging Indicaton messages sent')
jnxMbgSgwIfGtpV2ICsReqAcceptRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 89), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqAcceptRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqAcceptRx.setDescription('Number of GTPV2 packets received with cause Request Accept.')
jnxMbgSgwIfGtpV2ICsReqAcceptTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 90), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqAcceptTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqAcceptTx.setDescription('Number of GTP packets sent with cause Request Accept.')
jnxMbgSgwIfGtpV2ICsAcceptPartRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 91), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAcceptPartRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAcceptPartRx.setDescription('Number of GTPV2 packets received with cause Accept Partial.')
jnxMbgSgwIfGtpV2ICsAcceptPartTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 92), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAcceptPartTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAcceptPartTx.setDescription('Number of GTP packets sent with cause Accept Partial.')
jnxMbgSgwIfGtpV2ICsNewPTNPrefRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 93), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNewPTNPrefRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNewPTNPrefRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Network Preference.')
jnxMbgSgwIfGtpV2ICsNewPTNPrefTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 94), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNewPTNPrefTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNewPTNPrefTx.setDescription('Number of GTP packets sent with cause New PDN type due to Network Preference')
jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 95), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Single Address Bearer.')
jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 96), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx.setDescription('Number of GTP packets sent with cause New PDN type due to Single Address Bearer.')
jnxMbgSgwIfGtpV2ICsCtxNotFndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 97), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCtxNotFndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCtxNotFndRx.setDescription('Number of GTPV2 packets received with cause Context not found.')
jnxMbgSgwIfGtpV2ICsCtxNotFndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 98), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCtxNotFndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCtxNotFndTx.setDescription('Number of GTP packets sent with cause Context not found.')
jnxMbgSgwIfGtpV2ICsInvMsgFmtRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 99), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvMsgFmtRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvMsgFmtRx.setDescription('Number of GTPV2 packets received with cause Invalid Message Format.')
jnxMbgSgwIfGtpV2ICsInvMsgFmtTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 100), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvMsgFmtTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvMsgFmtTx.setDescription('Number of GTP packets sent with cause Invalid Message Format.')
jnxMbgSgwIfGtpV2ICsVerNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 101), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsVerNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsVerNotSuppRx.setDescription('Number of GTPV2 packets received with cause Version not Supported.')
jnxMbgSgwIfGtpV2ICsVerNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 102), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsVerNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsVerNotSuppTx.setDescription('Number of GTP packets sent with cause Version not Supported.')
jnxMbgSgwIfGtpV2ICsInvLenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 103), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvLenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvLenRx.setDescription('Number of GTPV2 packets received with cause Invalid Length.')
jnxMbgSgwIfGtpV2ICsInvLenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 104), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvLenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvLenTx.setDescription('Number of GTP packets sent with cause Invalid Length.')
jnxMbgSgwIfGtpV2ICsSrvNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 105), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSrvNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSrvNotSuppRx.setDescription('Number of GTPV2 packets received with cause Service Not supported.')
jnxMbgSgwIfGtpV2ICsSrvNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 106), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSrvNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSrvNotSuppTx.setDescription('Number of GTP packets sent with cause Service Not supported.')
jnxMbgSgwIfGtpV2ICsManIEIncorRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 107), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEIncorRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEIncorRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE incorrect.')
jnxMbgSgwIfGtpV2ICsManIEIncorTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 108), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEIncorTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEIncorTx.setDescription('Number of GTP packets sent with cause Mandatory IE incorrect.')
jnxMbgSgwIfGtpV2ICsManIEMissRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 109), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEMissRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEMissRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE Missing.')
jnxMbgSgwIfGtpV2ICsManIEMissTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 110), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEMissTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsManIEMissTx.setDescription('Number of GTP packets sent with cause Mandatory IE Missing.')
jnxMbgSgwIfGtpV2ICsOptIEIncorRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 111), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsOptIEIncorRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsOptIEIncorRx.setDescription('Number of GTPV2 packets received with cause Optional IE Incorrect.')
jnxMbgSgwIfGtpV2ICsOptIEIncorTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 112), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsOptIEIncorTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsOptIEIncorTx.setDescription('Number of GTP packets sent with cause Optional IE Incorrect.')
jnxMbgSgwIfGtpV2ICsSysFailRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 113), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSysFailRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSysFailRx.setDescription('Number of GTPV2 packets received with cause System Failure.')
jnxMbgSgwIfGtpV2ICsSysFailTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 114), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSysFailTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSysFailTx.setDescription('Number of GTP packets sent with cause System Failure.')
jnxMbgSgwIfGtpV2ICsNoResRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 115), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoResRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoResRx.setDescription('Number of GTPV2 packets received with cause No Resource.')
jnxMbgSgwIfGtpV2ICsNoResTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 116), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoResTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoResTx.setDescription('Number of GTP packets sent with cause No Resource.')
jnxMbgSgwIfGtpV2ICsTFTSMANTErRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 117), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSMANTErRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSMANTErRx.setDescription('Number of GTPV2 packets received with cause TFT Symantic Error.')
jnxMbgSgwIfGtpV2ICsTFTSMANTErTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 118), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSMANTErTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSMANTErTx.setDescription('Number of GTP packets sent with cause TFT Symantic Error.')
jnxMbgSgwIfGtpV2ICsTFTSysErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 119), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSysErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSysErrRx.setDescription('Number of GTPV2 packets received with cause TFT System Error.')
jnxMbgSgwIfGtpV2ICsTFTSysErrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 120), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSysErrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsTFTSysErrTx.setDescription('Number of GTP packets sent with cause TFT System Error.')
jnxMbgSgwIfGtpV2ICsPkFltManErRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 121), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltManErRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltManErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Symantic Error.')
jnxMbgSgwIfGtpV2ICsPkFltManErTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 122), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltManErTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltManErTx.setDescription('Number of GTP packets sent with cause Packet Filter Symantic Error.')
jnxMbgSgwIfGtpV2ICsPkFltSynErRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 123), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltSynErRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltSynErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Syntax Error.')
jnxMbgSgwIfGtpV2ICsPkFltSynErTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 124), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltSynErTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPkFltSynErTx.setDescription('Number of GTP packets sent with cause Packet Filter Syntax Error.')
jnxMbgSgwIfGtpV2ICsMisUnknAPNRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 125), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsMisUnknAPNRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsMisUnknAPNRx.setDescription('Number of GTPV2 packets received with cause Unknown APN.')
jnxMbgSgwIfGtpV2ICsMisUnknAPNTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 126), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsMisUnknAPNTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsMisUnknAPNTx.setDescription('Number of GTP packets sent with cause Unknown APN.')
jnxMbgSgwIfGtpV2ICsUnexpRptIERx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 127), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnexpRptIERx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnexpRptIERx.setDescription('Number of GTPV2 packets received with cause Unexpected Repeated IE.')
jnxMbgSgwIfGtpV2ICsUnexpRptIETx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 128), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnexpRptIETx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnexpRptIETx.setDescription('Number of GTP packets sent with cause Unexpected Repeated IE.')
jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 129), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx.setDescription('Number of GTPV2 packets received with cause GRE Key Not Found.')
jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 130), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx.setDescription('Number of GTP packets sent with cause GRE Key Not Found.')
jnxMbgSgwIfGtpV2ICsRelocFailRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 131), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRelocFailRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRelocFailRx.setDescription('Number of GTPV2 packets received with cause Relocation Failed.')
jnxMbgSgwIfGtpV2ICsRelocFailTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 132), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRelocFailTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRelocFailTx.setDescription('Number of GTP packets sent with cause Relocation Failed.')
jnxMbgSgwIfGtpV2ICsDenINRatRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 133), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDenINRatRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDenINRatRx.setDescription('Number of GTPV2 packets received with cause Denied in RAT.')
jnxMbgSgwIfGtpV2ICsDenINRatTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 134), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDenINRatTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDenINRatTx.setDescription('Number of GTP packets sent with cause Denied in RAT.')
jnxMbgSgwIfGtpV2ICsPTNotSuppRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 135), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTNotSuppRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTNotSuppRx.setDescription('Number of GTPV2 packets received with cause PDN Type Not Supported.')
jnxMbgSgwIfGtpV2ICsPTNotSuppTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 136), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTNotSuppTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTNotSuppTx.setDescription('Number of GTP packets sent with cause PDN Type Not Supported.')
jnxMbgSgwIfGtpV2ICsAlDynAdOccRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 137), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAlDynAdOccRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAlDynAdOccRx.setDescription('Number of GTPV2 packets received with cause Allocated Dynamic Address Occupied.')
jnxMbgSgwIfGtpV2ICsAlDynAdOccTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 138), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAlDynAdOccTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAlDynAdOccTx.setDescription('Number of GTP packets sent with cause Allocated Dynamic Address Occupied.')
jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 139), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx.setDescription('Number of GTPV2 packets received with cause UE Context Without TFT Exists.')
jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 140), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx.setDescription('Number of GTP packets sent with cause UE Context Without TFT Exists.')
jnxMbgSgwIfGtpV2ICsProtoNtSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 141), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsProtoNtSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsProtoNtSupRx.setDescription('Number of GTPV2 packets received with cause Protocol Not Supported.')
jnxMbgSgwIfGtpV2ICsProtoNtSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 142), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsProtoNtSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsProtoNtSupTx.setDescription('Number of GTP packets sent with cause Protocol Not Supported.')
jnxMbgSgwIfGtpV2ICsUENotRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 143), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUENotRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUENotRespRx.setDescription('Number of GTPV2 packets received with cause UE Not Responding.')
jnxMbgSgwIfGtpV2ICsUENotRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 144), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUENotRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUENotRespTx.setDescription('Number of GTP packets sent with cause UE Not Responding.')
jnxMbgSgwIfGtpV2ICsUERefusesRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 145), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUERefusesRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUERefusesRx.setDescription('Number of GTPV2 packets received with cause UE Refuses.')
jnxMbgSgwIfGtpV2ICsUERefusesTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 146), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUERefusesTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUERefusesTx.setDescription('Number of GTP packets sent with cause UE Refuses.')
jnxMbgSgwIfGtpV2ICsServDeniedRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 147), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsServDeniedRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsServDeniedRx.setDescription('Number of GTPV2 packets received with cause Service Denied.')
jnxMbgSgwIfGtpV2ICsServDeniedTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 148), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsServDeniedTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsServDeniedTx.setDescription('Number of GTP packets sent with cause Service Denied.')
jnxMbgSgwIfGtpV2ICsUnabPageUERx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 149), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnabPageUERx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnabPageUERx.setDescription('Number of GTPV2 packets received with cause Unable to Page UE.')
jnxMbgSgwIfGtpV2ICsUnabPageUETx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 150), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnabPageUETx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnabPageUETx.setDescription('Number of GTP packets sent with cause Unable to Page UE.')
jnxMbgSgwIfGtpV2ICsNoMemRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 151), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoMemRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoMemRx.setDescription('Number of GTPV2 packets received with cause No Memory.')
jnxMbgSgwIfGtpV2ICsNoMemTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 152), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoMemTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsNoMemTx.setDescription('Number of GTP packets sent with cause No Memory.')
jnxMbgSgwIfGtpV2ICsUserAUTHFlRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 153), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUserAUTHFlRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUserAUTHFlRx.setDescription('Number of GTPV2 packets received with cause User AUTH Failed.')
jnxMbgSgwIfGtpV2ICsUserAUTHFlTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 154), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUserAUTHFlTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUserAUTHFlTx.setDescription('Number of GTP packets sent with cause User AUTH Failed.')
jnxMbgSgwIfGtpV2ICsAPNAcsDenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 155), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNAcsDenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNAcsDenRx.setDescription('Number of GTPV2 packets received with cause APN Access Denied.')
jnxMbgSgwIfGtpV2ICsAPNAcsDenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 156), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNAcsDenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNAcsDenTx.setDescription('Number of GTP packets sent with cause APN Access Denied.')
jnxMbgSgwIfGtpV2ICsReqRejRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 157), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqRejRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqRejRx.setDescription('Number of GTPV2 packets received with cause Request Rejected.')
jnxMbgSgwIfGtpV2ICsReqRejTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 158), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqRejTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsReqRejTx.setDescription('Number of GTP packets sent with cause Request Rejected.')
jnxMbgSgwIfGtpV2ICsPTMSISigMMRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 159), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTMSISigMMRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTMSISigMMRx.setDescription('Number of GTPV2 packets received with cause P-TMSI Signature Mismatch.')
jnxMbgSgwIfGtpV2ICsPTMSISigMMTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 160), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTMSISigMMTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsPTMSISigMMTx.setDescription('Number of GTP packets sent with cause P-TMSI Signature Mismatch')
jnxMbgSgwIfGtpV2ICsIMSINotKnRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 161), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsIMSINotKnRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsIMSINotKnRx.setDescription('Number of GTPV2 packets received with cause IMSI Not Known.')
jnxMbgSgwIfGtpV2ICsIMSINotKnTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 162), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsIMSINotKnTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsIMSINotKnTx.setDescription('Number of GTP packets sent with cause IMSI Not Known.')
jnxMbgSgwIfGtpV2ICsCondIEMsRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 163), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCondIEMsRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCondIEMsRx.setDescription('Number of GTPV2 packets received with cause Conditional IE Missing.')
jnxMbgSgwIfGtpV2ICsCondIEMsTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 164), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCondIEMsTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCondIEMsTx.setDescription('Number of GTP packets sent with cause Conditional IE Missing.')
jnxMbgSgwIfGtpV2ICsAPNResTIncRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 165), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNResTIncRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNResTIncRx.setDescription('Number of GTPV2 packets received with cause APN Restriction Type Incompatible.')
jnxMbgSgwIfGtpV2ICsAPNResTIncTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 166), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNResTIncTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsAPNResTIncTx.setDescription('Number of GTP packets sent with cause APN Restriction Type Incompatible.')
jnxMbgSgwIfGtpV2ICsUnknownRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 167), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnknownRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnknownRx.setDescription('Number of GTPV2 packets received with cause Unknown.')
jnxMbgSgwIfGtpV2ICsUnknownTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 168), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnknownTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnknownTx.setDescription('Number of GTP packets sent with cause Unknown.')
jnxMbgSgwIfGtpV2ICsLclDetRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 169), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsLclDetRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsLclDetRx.setDescription('Number of GTP packets received with cause Local Detach.')
jnxMbgSgwIfGtpV2ICsLclDetTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 170), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsLclDetTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsLclDetTx.setDescription('Number of GTP packets sent with cause Local Detach.')
jnxMbgSgwIfGtpV2ICsCmpDetRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 171), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCmpDetRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCmpDetRx.setDescription('Number of GTP packets received with cause Complete Detach.')
jnxMbgSgwIfGtpV2ICsCmpDetTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 172), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCmpDetTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsCmpDetTx.setDescription('Number of GTP packets sent with cause Complete Detach.')
jnxMbgSgwIfGtpV2ICsRATChgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 173), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRATChgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRATChgRx.setDescription('Number of GTP packets received with cause RAT changed from 3GPP to non 3GPP.')
jnxMbgSgwIfGtpV2ICsRATChgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 174), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRATChgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRATChgTx.setDescription('Number of GTP packets sent with cause RAT changed from 3GPP to non 3GPP.')
jnxMbgSgwIfGtpV2ICsISRDeactRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 175), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsISRDeactRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsISRDeactRx.setDescription('Number of GTP packets received with cause ISR Deactivated.')
jnxMbgSgwIfGtpV2ICsISRDeactTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 176), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsISRDeactTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsISRDeactTx.setDescription('Number of GTP packets sent with cause ISR Deactivated.')
jnxMbgSgwIfGtpV2ICsEIFRNCEnRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 177), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsEIFRNCEnRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsEIFRNCEnRx.setDescription('Number of GTP packets received with cause Error Indication from RNC eNodeB.')
jnxMbgSgwIfGtpV2ICsEIFRNCEnTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 178), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsEIFRNCEnTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsEIFRNCEnTx.setDescription('Number of GTP packets sent with cause Error Indication from RNC eNodeB.')
jnxMbgSgwIfGtpV2ICsSemErTADRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 179), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSemErTADRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSemErTADRx.setDescription('Number of GTP packets received with cause Semantic Error in TAD Operation.')
jnxMbgSgwIfGtpV2ICsSemErTADTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 180), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSemErTADTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSemErTADTx.setDescription('Number of GTP packets sent with cause Semantic Error in TAD Operation.')
jnxMbgSgwIfGtpV2ICsSynErTADRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 181), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSynErTADRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSynErTADRx.setDescription('Number of GTP packets received with cause Syntactic Error in TAD Operation.')
jnxMbgSgwIfGtpV2ICsSynErTADTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 182), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSynErTADTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsSynErTADTx.setDescription('Number of GTP packets sent with cause Syntactic Error in TAD Operation.')
jnxMbgSgwIfGtpV2ICsRMValRcvRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 183), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRMValRcvRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRMValRcvRx.setDescription('Number of GTP packets received with cause Reserved Message Value Received.')
jnxMbgSgwIfGtpV2ICsRMValRcvTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 184), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRMValRcvTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRMValRcvTx.setDescription('Number of GTP packets sent with cause Reserved Message Value Received.')
jnxMbgSgwIfGtpV2ICsRPrNtRspRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 185), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRPrNtRspRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRPrNtRspRx.setDescription('Number of GTP packets received with cause Remote peer not responding.')
jnxMbgSgwIfGtpV2ICsRPrNtRspTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 186), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRPrNtRspTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsRPrNtRspTx.setDescription('Number of GTP packets sent with cause Remote peer not responding.')
jnxMbgSgwIfGtpV2ICsColNWReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 187), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsColNWReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsColNWReqRx.setDescription('Number of GTP packets received with cause Collision with network initiated request.')
jnxMbgSgwIfGtpV2ICsColNWReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 188), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsColNWReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsColNWReqTx.setDescription('Number of GTP packets sent with cause Collision with network initiated request.')
jnxMbgSgwIfGtpV2ICsUnPgUESusRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 189), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnPgUESusRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnPgUESusRx.setDescription('Number of GTP packets received with cause Unable to page UE due to suspension.')
jnxMbgSgwIfGtpV2ICsUnPgUESusTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 190), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnPgUESusTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsUnPgUESusTx.setDescription('Number of GTP packets sent with cause Unable to page UE due to suspension.')
jnxMbgSgwIfGtpV2ICsInvTotLenRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 191), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvTotLenRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvTotLenRx.setDescription('Number of GTP packets received with cause Invalid total len.')
jnxMbgSgwIfGtpV2ICsInvTotLenTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 192), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvTotLenTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvTotLenTx.setDescription('Number of GTP packets sent with cause Invalid total len.')
jnxMbgSgwIfGtpV2ICsDtForNtSupRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 193), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDtForNtSupRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDtForNtSupRx.setDescription('Number of GTP packets received with cause Data forwarding not supported.')
jnxMbgSgwIfGtpV2ICsDtForNtSupTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 194), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDtForNtSupTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsDtForNtSupTx.setDescription('Number of GTP packets sent with cause Data forwarding not supported.')
jnxMbgSgwIfGtpV2ICsInReFRePrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 195), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInReFRePrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInReFRePrRx.setDescription('Number of GTP packets received with cause Invalid Reply from Remote peer.')
jnxMbgSgwIfGtpV2ICsInReFRePrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 196), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInReFRePrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInReFRePrTx.setDescription('Number of GTP packets sent with cause Invalid Reply from Remote peer.')
jnxMbgSgwIfGtpV2ICsInvPrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 197), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvPrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvPrRx.setDescription('Number of GTP packets received with cause Invalid peer.')
jnxMbgSgwIfGtpV2ICsInvPrTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 198), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvPrTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV2ICsInvPrTx.setDescription('Number of GTP packets sent with cause Invalid peer.')
jnxMbgSgwIfGtpV1ProtocolErrRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 199), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1ProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1ProtocolErrRx.setDescription('Number of GTPv1 Protocol Errors Received.')
jnxMbgSgwIfGtpV1UnSupMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 200), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1UnSupMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1UnSupMsgRx.setDescription('Number of GTPv1 Unsupported Messages received.')
jnxMbgSgwIfGtpV1T3RespTmrExpRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 201), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1T3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1T3RespTmrExpRx.setDescription('Number of GTP V1 T3 timer expiries Received.')
jnxMbgSgwIfGtpV1EndMarkerRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 202), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EndMarkerRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EndMarkerRx.setDescription('Number of GTP V1 end marker packets received.')
jnxMbgSgwIfGtpV1EndMarkerTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 203), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EndMarkerTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EndMarkerTx.setDescription('Number of GTP V1 end marker packets sent.')
jnxMbgSgwIfGtpV1EchoReqRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 204), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoReqRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoReqRx.setDescription('Number of GTP V1 echo request packets received.')
jnxMbgSgwIfGtpV1EchoReqTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 205), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoReqTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoReqTx.setDescription('Number of GTP V1 echo request packets sent.')
jnxMbgSgwIfGtpV1EchoRespRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 206), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoRespRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoRespRx.setDescription('Number of GTP V1 echo response packets received.')
jnxMbgSgwIfGtpV1EchoRespTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 207), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoRespTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1EchoRespTx.setDescription('Number of GTP V1 echo response packets sent.')
jnxMbgSgwIfGtpV1ErrIndRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 208), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1ErrIndRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1ErrIndRx.setDescription('Number of GTP packets V1 Error Indication packets received.')
jnxMbgSgwIfGtpV1ErrIndTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 209), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1ErrIndTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfGtpV1ErrIndTx.setDescription('Number of GTP packets V1 Error Indication packets sent.')
jnxMbgSgwIfSuspNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 210), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfSuspNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfSuspNotifRx.setDescription('Number of GTPv2 Suspend Notification messages received.')
jnxMbgSgwIfSuspNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 211), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfSuspNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfSuspNotifTx.setDescription('Number of GTPv2 Suspend Notification messages sent.')
jnxMbgSgwIfSuspAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 212), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfSuspAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfSuspAckRx.setDescription('Number of GTPv2 Suspend Acknowledgement messages received.')
jnxMbgSgwIfSuspAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 213), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfSuspAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfSuspAckTx.setDescription('Number of GTPv2 Suspend Acknowledgement messages sent.')
jnxMbgSgwIfResumeNotifRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 214), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfResumeNotifRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfResumeNotifRx.setDescription('Number of GTPv2 Resume Notification messages received.')
jnxMbgSgwIfResumeNotifTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 215), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfResumeNotifTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfResumeNotifTx.setDescription('Number of GTPv2 Resume Notification messages sent.')
jnxMbgSgwIfResumeAckRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 216), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfResumeAckRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfResumeAckRx.setDescription('Number of GTPv2 Resume Acknowledgement messages received.')
jnxMbgSgwIfResumeAckTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 217), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfResumeAckTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfResumeAckTx.setDescription('Number of GTPv2 Resume Acknowledgement messages sent.')
jnxMbgSgwIfPiggybackMsgRx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 218), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfPiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfPiggybackMsgRx.setDescription('Number of GTPv2 Piggyback messages received.')
jnxMbgSgwIfPiggybackMsgTx = MibTableColumn((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 219), Counter64()).setMaxAccess("readonly")
if mibBuilder.loadTexts: jnxMbgSgwIfPiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwIfPiggybackMsgTx.setDescription('Number of GTPv2 S11 Piggyback messages sent.')
jnxMbgSgwGtpNotificationVars = MibIdentifier((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3))
jnxMbgSgwGtpPeerName = MibScalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 1), DisplayString()).setMaxAccess("accessiblefornotify")
if mibBuilder.loadTexts: jnxMbgSgwGtpPeerName.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpPeerName.setDescription('GTP Peer Name/IP')
jnxMbgSgwGtpAlarmStatCounter = MibScalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 2), Unsigned32()).setMaxAccess("accessiblefornotify")
if mibBuilder.loadTexts: jnxMbgSgwGtpAlarmStatCounter.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpAlarmStatCounter.setDescription('Current Value of (Alarm) Statistics Counter eg: in jnxMbgSgwGtpPrDNTPerPrAlrmActv it spefies the number of times peer is down with in the monitoring interval')
jnxMbgSgwGtpInterfaceType = MibScalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 3), DisplayString()).setMaxAccess("accessiblefornotify")
if mibBuilder.loadTexts: jnxMbgSgwGtpInterfaceType.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpInterfaceType.setDescription('GTP Interface Type which can be one of S5/S8/S11/S1U/S12/S4')
jnxMbgSgwGtpGwName = MibScalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 4), DisplayString()).setMaxAccess("accessiblefornotify")
if mibBuilder.loadTexts: jnxMbgSgwGtpGwName.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpGwName.setDescription('A string that indicates the gateway name')
jnxMbgSgwGtpGwIndex = MibScalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 5), Unsigned32()).setMaxAccess("accessiblefornotify")
if mibBuilder.loadTexts: jnxMbgSgwGtpGwIndex.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpGwIndex.setDescription('Current Gateway ID value')
jnxMbgSgwGtpPeerGwUpNotif = NotificationType((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 1)).setObjects(("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwIndex"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwName"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpInterfaceType"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpPeerName"))
if mibBuilder.loadTexts: jnxMbgSgwGtpPeerGwUpNotif.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpPeerGwUpNotif.setDescription('GTPC Peer UP Notification. This trap is sent when a new peer is added or an existing peer goes down and comes back up.')
jnxMbgSgwGtpPeerGwDnNotif = NotificationType((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 2)).setObjects(("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwIndex"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwName"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpInterfaceType"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpPeerName"))
if mibBuilder.loadTexts: jnxMbgSgwGtpPeerGwDnNotif.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpPeerGwDnNotif.setDescription('GTPC Peer Down Notification. This trap is sent when a peer connection goes down.')
jnxMbgSgwGtpPrDnTPerPrAlrmActv = NotificationType((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 3)).setObjects(("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwIndex"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwName"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpInterfaceType"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpPeerName"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpAlarmStatCounter"))
if mibBuilder.loadTexts: jnxMbgSgwGtpPrDnTPerPrAlrmActv.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpPrDnTPerPrAlrmActv.setDescription('Peer down Threshold trap Active. This is sent when a peer connection flaps for more than a higher threshold number of times with in a monitor interval.')
jnxMbgSgwGtpPrDnTPerPrAlrmClr = NotificationType((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 4)).setObjects(("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwIndex"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpGwName"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpInterfaceType"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpPeerName"), ("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", "jnxMbgSgwGtpAlarmStatCounter"))
if mibBuilder.loadTexts: jnxMbgSgwGtpPrDnTPerPrAlrmClr.setStatus('current')
if mibBuilder.loadTexts: jnxMbgSgwGtpPrDnTPerPrAlrmClr.setDescription('Peer down Threshold trap Cleared. This is sent when the number of times a peer connection flaps in a monitor interval come down below the lower threshold.')
mibBuilder.exportSymbols("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", jnxMbgSgwIfGtpV2ICsPkFltManErRx=jnxMbgSgwIfGtpV2ICsPkFltManErRx, jnxMbgSgwGtpV2ICsGREKeyNtFdTx=jnxMbgSgwGtpV2ICsGREKeyNtFdTx, jnxMbgSgwPPIPProtoErrRx=jnxMbgSgwPPIPProtoErrRx, jnxMbgSgwCrtBrReqRx=jnxMbgSgwCrtBrReqRx, jnxMbgSgwPPV2NumMsgRx=jnxMbgSgwPPV2NumMsgRx, jnxMbgSgwPPGtpV2ICsTFTSMANTErRx=jnxMbgSgwPPGtpV2ICsTFTSMANTErRx, jnxMbgSgwIPProtoErrRx=jnxMbgSgwIPProtoErrRx, jnxMbgSgwPPModBrCmdRx=jnxMbgSgwPPModBrCmdRx, jnxMbgSgwGtpPeerGwUpNotif=jnxMbgSgwGtpPeerGwUpNotif, jnxMbgSgwPPGtpV2ICsCtxNotFndTx=jnxMbgSgwPPGtpV2ICsCtxNotFndTx, jnxMbgSgwGtpMib=jnxMbgSgwGtpMib, jnxMbgSgwIfUnSupportedMsgRx=jnxMbgSgwIfUnSupportedMsgRx, jnxMbgSgwPPGtpV2ICsOptIEIncorTx=jnxMbgSgwPPGtpV2ICsOptIEIncorTx, jnxMbgSgwIfGtpV1ErrIndTx=jnxMbgSgwIfGtpV1ErrIndTx, jnxMbgSgwGtpV2ICsUERefusesRx=jnxMbgSgwGtpV2ICsUERefusesRx, jnxMbgSgwPPCreateSessReqRx=jnxMbgSgwPPCreateSessReqRx, jnxMbgSgwPcktLenErrRx=jnxMbgSgwPcktLenErrRx, jnxMbgSgwGtpV2ICsOptIEIncorrTx=jnxMbgSgwGtpV2ICsOptIEIncorrTx, jnxMbgSgwPPGtpV2ICsSysFailTx=jnxMbgSgwPPGtpV2ICsSysFailTx, jnxMbgSgwGtpV2ICsUENotRespTx=jnxMbgSgwGtpV2ICsUENotRespTx, jnxMbgSgwIfGtpV2ICsManIEMissTx=jnxMbgSgwIfGtpV2ICsManIEMissTx, jnxMbgSgwPPGtpV2ICsAPNAcsDenTx=jnxMbgSgwPPGtpV2ICsAPNAcsDenTx, jnxMbgSgwPPGtpV2ICsEIFRNCEnTx=jnxMbgSgwPPGtpV2ICsEIFRNCEnTx, jnxMbgSgwPPGtpV2ICsNoResRx=jnxMbgSgwPPGtpV2ICsNoResRx, jnxMbgSgwGtpV2ICsOptIEIncorrRx=jnxMbgSgwGtpV2ICsOptIEIncorrRx, jnxMbgSgwPPUpdConnSetReqTx=jnxMbgSgwPPUpdConnSetReqTx, jnxMbgSgwUnSupportedMsgRx=jnxMbgSgwUnSupportedMsgRx, jnxMbgSgwRelAcsBrReqTx=jnxMbgSgwRelAcsBrReqTx, jnxMbgSgwPPDelBrCmdRx=jnxMbgSgwPPDelBrCmdRx, jnxMbgSgwIfCrIndTunRespTx=jnxMbgSgwIfCrIndTunRespTx, jnxMbgSgwPPCrIndTunRespRx=jnxMbgSgwPPCrIndTunRespRx, jnxMbgSgwIfGtpV2ICsTFTSMANTErRx=jnxMbgSgwIfGtpV2ICsTFTSMANTErRx, jnxMbgSgwPPModBrCmdTx=jnxMbgSgwPPModBrCmdTx, jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx=jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx, jnxMbgSgwIfGtpV2ICsAcceptPartRx=jnxMbgSgwIfGtpV2ICsAcceptPartRx, jnxMbgSgwPPGtpV2ICsInvPrRx=jnxMbgSgwPPGtpV2ICsInvPrRx, PYSNMP_MODULE_ID=jnxMbgSgwGtpMib, jnxMbgSgwGtpV2ICsAPNAcsDenTx=jnxMbgSgwGtpV2ICsAPNAcsDenTx, jnxMbgSgwPPGTPUnknVerRx=jnxMbgSgwPPGTPUnknVerRx, jnxMbgSgwPPGtpV2ICsRATChgRx=jnxMbgSgwPPGtpV2ICsRATChgRx, jnxMbgSgwPPGtpV2ICsAcceptPartTx=jnxMbgSgwPPGtpV2ICsAcceptPartTx, jnxMbgSgwPPGtpV2ICsRATChgTx=jnxMbgSgwPPGtpV2ICsRATChgTx, jnxMbgSgwGtpV2ICsServDeniedTx=jnxMbgSgwGtpV2ICsServDeniedTx, jnxMbgSgwIfGtpV2ICsInvPrRx=jnxMbgSgwIfGtpV2ICsInvPrRx, jnxMbgSgwIfCrIndTunReqTx=jnxMbgSgwIfCrIndTunReqTx, jnxMbgSgwRelAcsBrRespRx=jnxMbgSgwRelAcsBrRespRx, jnxMbgSgwCreateSessRspTx=jnxMbgSgwCreateSessRspTx, jnxMbgSgwUpdBrRspTx=jnxMbgSgwUpdBrRspTx, jnxMbgSgwPPRxPacketsDropped=jnxMbgSgwPPRxPacketsDropped, jnxMbgSgwDelBrCmdRx=jnxMbgSgwDelBrCmdRx, jnxMbgSgwGtpV2ICsLclDetRx=jnxMbgSgwGtpV2ICsLclDetRx, jnxMbgSgwPPStopPagingIndTx=jnxMbgSgwPPStopPagingIndTx, jnxMbgSgwGtpPrDnTPerPrAlrmClr=jnxMbgSgwGtpPrDnTPerPrAlrmClr, jnxMbgSgwPPModBrRspRx=jnxMbgSgwPPModBrRspRx, jnxMbgSgwPPUpdBrReqRx=jnxMbgSgwPPUpdBrReqRx, jnxMbgSgwGtpV2ICsPTMSISigMMTx=jnxMbgSgwGtpV2ICsPTMSISigMMTx, jnxMbgSgwPPGtpV2ICsMisUnknAPNTx=jnxMbgSgwPPGtpV2ICsMisUnknAPNTx, jnxMbgSgwGtpV2ICsReqRejTx=jnxMbgSgwGtpV2ICsReqRejTx, jnxMbgSgwGtpV2ICsCtxNotFndRx=jnxMbgSgwGtpV2ICsCtxNotFndRx, jnxMbgSgwIfCrtBrReqTx=jnxMbgSgwIfCrtBrReqTx, jnxMbgSgwIfResumeAckTx=jnxMbgSgwIfResumeAckTx, jnxMbgSgwV2NumMsgTx=jnxMbgSgwV2NumMsgTx, jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx=jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx, jnxMbgSgwPPGtpV2ICsInvMsgFmtRx=jnxMbgSgwPPGtpV2ICsInvMsgFmtRx, jnxMbgSgwIfGtpV2ICsInvTotLenTx=jnxMbgSgwIfGtpV2ICsInvTotLenTx, jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx=jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx, jnxMbgSgwPPGtpV2ICsIMSINotKnTx=jnxMbgSgwPPGtpV2ICsIMSINotKnTx, jnxMbgSgwGtpV2ICsUnknownRx=jnxMbgSgwGtpV2ICsUnknownRx, jnxMbgSgwUpdConnSetRspTx=jnxMbgSgwUpdConnSetRspTx, jnxMbgSgwCreateSessReqRx=jnxMbgSgwCreateSessReqRx, jnxMbgSgwGtpV2ICsInvTotLenRx=jnxMbgSgwGtpV2ICsInvTotLenRx, jnxMbgSgwDelBrReqRx=jnxMbgSgwDelBrReqRx, jnxMbgSgwIfV2EchoRespTx=jnxMbgSgwIfV2EchoRespTx, jnxMbgSgwIfGtpV2ICsVerNotSuppTx=jnxMbgSgwIfGtpV2ICsVerNotSuppTx, jnxMbgSgwIfGtpV2ICsRPrNtRspRx=jnxMbgSgwIfGtpV2ICsRPrNtRspRx, jnxMbgSgwIfGtpV2ICsUnexpRptIETx=jnxMbgSgwIfGtpV2ICsUnexpRptIETx, jnxMbgSgwGtpV2ICsRelocFailTx=jnxMbgSgwGtpV2ICsRelocFailTx, jnxMbgSgwGtpV2ICsAllDynAdOccRx=jnxMbgSgwGtpV2ICsAllDynAdOccRx, jnxMbgSgwPPDelSessReqTx=jnxMbgSgwPPDelSessReqTx, jnxMbgSgwDelSessReqRx=jnxMbgSgwDelSessReqRx, jnxMbgSgwPPResumeAckTx=jnxMbgSgwPPResumeAckTx, jnxMbgSgwPPGtpV2ICsSynErTADTx=jnxMbgSgwPPGtpV2ICsSynErTADTx, jnxMbgSgwGtpV2ICsUserAUTHFlRx=jnxMbgSgwGtpV2ICsUserAUTHFlRx, jnxMbgSgwIfGtpV2ICsCmpDetTx=jnxMbgSgwIfGtpV2ICsCmpDetTx, jnxMbgSgwGtpV2ICsDtForNtSupRx=jnxMbgSgwGtpV2ICsDtForNtSupRx, jnxMbgSgwIfGtpV2ICsUnabPageUERx=jnxMbgSgwIfGtpV2ICsUnabPageUERx, jnxMbgSgwPPGtpV2ICsProtoNtSupRx=jnxMbgSgwPPGtpV2ICsProtoNtSupRx, jnxMbgSgwV2VerNotSupTx=jnxMbgSgwV2VerNotSupTx, jnxMbgSgwGtpV2ICsInReFRePrRx=jnxMbgSgwGtpV2ICsInReFRePrRx, jnxMbgSgwIfGtpV2ICsSysFailRx=jnxMbgSgwIfGtpV2ICsSysFailRx, jnxMbgSgwIfGtpV2ICsInReFRePrTx=jnxMbgSgwIfGtpV2ICsInReFRePrTx, jnxMbgSgwPPDlDataNotifTx=jnxMbgSgwPPDlDataNotifTx, jnxMbgSgwIfGtpV2ICsRelocFailRx=jnxMbgSgwIfGtpV2ICsRelocFailRx, jnxMbgSgwDelConnSetRspTx=jnxMbgSgwDelConnSetRspTx, jnxMbgSgwT3RespTmrExpRx=jnxMbgSgwT3RespTmrExpRx, jnxMbgSgwStopPagingIndRx=jnxMbgSgwStopPagingIndRx, jnxMbgSgwDelSessReqTx=jnxMbgSgwDelSessReqTx, jnxMbgSgwGtpV2ICsTFTSysErrRx=jnxMbgSgwGtpV2ICsTFTSysErrRx, jnxMbgSgwPPRelAcsBrRespRx=jnxMbgSgwPPRelAcsBrRespRx, jnxMbgSgwIfDelSessReqRx=jnxMbgSgwIfDelSessReqRx, jnxMbgSgwGtpV2ICsReqAcceptTx=jnxMbgSgwGtpV2ICsReqAcceptTx, jnxMbgSgwPPRelAcsBrRespTx=jnxMbgSgwPPRelAcsBrRespTx, jnxMbgSgwIfGtpV1EchoRespTx=jnxMbgSgwIfGtpV1EchoRespTx, jnxMbgSgwGtpV2ICsAcceptPartTx=jnxMbgSgwGtpV2ICsAcceptPartTx, jnxMbgSgwIfModBrReqRx=jnxMbgSgwIfModBrReqRx, jnxMbgSgwGtpCGlbStatsTable=jnxMbgSgwGtpCGlbStatsTable, jnxMbgSgwGtpV2ICsPkFltSynErrTx=jnxMbgSgwGtpV2ICsPkFltSynErrTx, jnxMbgSgwIfDelBrRspTx=jnxMbgSgwIfDelBrRspTx, jnxMbgSgwV2EchoReqRx=jnxMbgSgwV2EchoReqRx, jnxMbgSgwPPGtpV1EchoReqTx=jnxMbgSgwPPGtpV1EchoReqTx, jnxMbgSgwPPGtpV2ICsUERefusesRx=jnxMbgSgwPPGtpV2ICsUERefusesRx, jnxMbgSgwGtpV2ICsInReFRePrTx=jnxMbgSgwGtpV2ICsInReFRePrTx, jnxMbgSgwIfGtpV2ICsSrvNotSuppRx=jnxMbgSgwIfGtpV2ICsSrvNotSuppRx, jnxMbgSgwPPDelBrRspTx=jnxMbgSgwPPDelBrRspTx, jnxMbgSgwResumeAckRx=jnxMbgSgwResumeAckRx, jnxMbgSgwPPPacketAllocFail=jnxMbgSgwPPPacketAllocFail, jnxMbgSgwPPGtpV2ICsDenINRatTx=jnxMbgSgwPPGtpV2ICsDenINRatTx, jnxMbgSgwUnknMsgRx=jnxMbgSgwUnknMsgRx, jnxMbgSgwPPDelIndTunRespTx=jnxMbgSgwPPDelIndTunRespTx, jnxMbgSgwIfGtpV2ICsUnexpRptIERx=jnxMbgSgwIfGtpV2ICsUnexpRptIERx, jnxMbgSgwIfCrtBrRspTx=jnxMbgSgwIfCrtBrRspTx, jnxMbgSgwGtpV2ICsNewPTNPrefTx=jnxMbgSgwGtpV2ICsNewPTNPrefTx, jnxMbgSgwIfGtpV2ICsUnknownRx=jnxMbgSgwIfGtpV2ICsUnknownRx, jnxMbgSgwGtpPrDnTPerPrAlrmActv=jnxMbgSgwGtpPrDnTPerPrAlrmActv, jnxMbgSgwPPGtpV2ICsPkFltManErRx=jnxMbgSgwPPGtpV2ICsPkFltManErRx, jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx=jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx, jnxMbgSgwIfDelBrFlrIndTx=jnxMbgSgwIfDelBrFlrIndTx, jnxMbgSgwIfGtpV2ICsPkFltManErTx=jnxMbgSgwIfGtpV2ICsPkFltManErTx, jnxMbgSgwStopPagingIndTx=jnxMbgSgwStopPagingIndTx, jnxMbgSgwGtpV2ICsProtoNtSupTx=jnxMbgSgwGtpV2ICsProtoNtSupTx, jnxMbgSgwIfRelAcsBrReqRx=jnxMbgSgwIfRelAcsBrReqRx, jnxMbgSgwGtpV2ICsCmpDetRx=jnxMbgSgwGtpV2ICsCmpDetRx, jnxMbgSgwIfDelBrRspRx=jnxMbgSgwIfDelBrRspRx, jnxMbgSgwPPDelIndTunRespRx=jnxMbgSgwPPDelIndTunRespRx, jnxMbgSgwPPGtpV1UnSupMsgRx=jnxMbgSgwPPGtpV1UnSupMsgRx, jnxMbgSgwPPGtpV1EchoReqRx=jnxMbgSgwPPGtpV1EchoReqRx, jnxMbgSgwIfGtpV2ICsPkFltSynErTx=jnxMbgSgwIfGtpV2ICsPkFltSynErTx, jnxMbgSgwIfCrIndTunReqRx=jnxMbgSgwIfCrIndTunReqRx, jnxMbgSgwGtpV2ICsManIEIncorrTx=jnxMbgSgwGtpV2ICsManIEIncorrTx, jnxMbgSgwIfGtpV2ICsManIEMissRx=jnxMbgSgwIfGtpV2ICsManIEMissRx, jnxMbgSgwPPCreateSessReqTx=jnxMbgSgwPPCreateSessReqTx, jnxMbgSgwIfDelConnSetReqTx=jnxMbgSgwIfDelConnSetReqTx, jnxMbgSgwPPGtpV2ICsPTNotSuppTx=jnxMbgSgwPPGtpV2ICsPTNotSuppTx, jnxMbgSgwPPDlDataAckTx=jnxMbgSgwPPDlDataAckTx, jnxMbgSgwIfDelConnSetRspTx=jnxMbgSgwIfDelConnSetRspTx, jnxMbgSgwPPModBrReqRx=jnxMbgSgwPPModBrReqRx, jnxMbgSgwRxPacketsDropped=jnxMbgSgwRxPacketsDropped, jnxMbgSgwIfGtpV2ICsColNWReqTx=jnxMbgSgwIfGtpV2ICsColNWReqTx, jnxMbgSgwPPGtpV2ICsUnPgUESusRx=jnxMbgSgwPPGtpV2ICsUnPgUESusRx, jnxMbgSgwDelConnSetReqTx=jnxMbgSgwDelConnSetReqTx, jnxMbgSgwGtpV1EchoReqTx=jnxMbgSgwGtpV1EchoReqTx, jnxMbgSgwPPCrtBrRspRx=jnxMbgSgwPPCrtBrRspRx, jnxMbgSgwIfStopPagingIndRx=jnxMbgSgwIfStopPagingIndRx, jnxMbgSgwIfGtpV2ICsLclDetRx=jnxMbgSgwIfGtpV2ICsLclDetRx, jnxMbgSgwIfModBrRspRx=jnxMbgSgwIfModBrRspRx, jnxMbgSgwS11PiggybackMsgTx=jnxMbgSgwS11PiggybackMsgTx, jnxMbgSgwGtpV2ICsSynErTADRx=jnxMbgSgwGtpV2ICsSynErTADRx, jnxMbgSgwPPGtpV2ICsISRDeactTx=jnxMbgSgwPPGtpV2ICsISRDeactTx, jnxMbgSgwIfGtpV2ICsUnPgUESusTx=jnxMbgSgwIfGtpV2ICsUnPgUESusTx, jnxMbgSgwGtpV2ICsUnexpRptIERx=jnxMbgSgwGtpV2ICsUnexpRptIERx, jnxMbgSgwGtpV2ICsUnabPageUETx=jnxMbgSgwGtpV2ICsUnabPageUETx, jnxMbgSgwGtpV2ICsRATChgRx=jnxMbgSgwGtpV2ICsRATChgRx, jnxMbgSgwGtpV2ICsColNWReqTx=jnxMbgSgwGtpV2ICsColNWReqTx, jnxMbgSgwPPGtpV2ICsDtForNtSupRx=jnxMbgSgwPPGtpV2ICsDtForNtSupRx, jnxMbgSgwPPDelConnSetRspRx=jnxMbgSgwPPDelConnSetRspRx, jnxMbgSgwPPResumeNotifRx=jnxMbgSgwPPResumeNotifRx, jnxMbgSgwIfCrtBrRspRx=jnxMbgSgwIfCrtBrRspRx, jnxMbgSgwIfGtpV2ICsInvLenRx=jnxMbgSgwIfGtpV2ICsInvLenRx, jnxMbgSgwPPGtpV2ICsPTNotSuppRx=jnxMbgSgwPPGtpV2ICsPTNotSuppRx, jnxMbgSgwPPGtpV2ICsRMValRcvTx=jnxMbgSgwPPGtpV2ICsRMValRcvTx, jnxMbgSgwPPGtpV2ICsMisUnknAPNRx=jnxMbgSgwPPGtpV2ICsMisUnknAPNRx, jnxMbgSgwGtpV2ICsDeniedINRatRx=jnxMbgSgwGtpV2ICsDeniedINRatRx, jnxMbgSgwGtpV2ICsManIEIncorrRx=jnxMbgSgwGtpV2ICsManIEIncorrRx, jnxMbgSgwGtpV2ICsReqRejRx=jnxMbgSgwGtpV2ICsReqRejRx, jnxMbgSgwPPPiggybackMsgTx=jnxMbgSgwPPPiggybackMsgTx, jnxMbgSgwPPGtpV2ICsInvLenRx=jnxMbgSgwPPGtpV2ICsInvLenRx, jnxMbgSgwIfGtpV2ICsEIFRNCEnRx=jnxMbgSgwIfGtpV2ICsEIFRNCEnRx, jnxMbgSgwPPBrResFlrIndTx=jnxMbgSgwPPBrResFlrIndTx, jnxMbgSgwIfModBrCmdRx=jnxMbgSgwIfModBrCmdRx, jnxMbgSgwIfDelIndTunRespRx=jnxMbgSgwIfDelIndTunRespRx, jnxMbgSgwGtpV1EchoReqRx=jnxMbgSgwGtpV1EchoReqRx, jnxMbgSgwIfDelBrReqTx=jnxMbgSgwIfDelBrReqTx, jnxMbgSgwIfGtpV2ICsUserAUTHFlTx=jnxMbgSgwIfGtpV2ICsUserAUTHFlTx, jnxMbgSgwIfGtpV2ICsCmpDetRx=jnxMbgSgwIfGtpV2ICsCmpDetRx, jnxMbgSgwIfSuspAckTx=jnxMbgSgwIfSuspAckTx, jnxMbgSgwGtpV2ICsCtxNotFndTx=jnxMbgSgwGtpV2ICsCtxNotFndTx, jnxMbgSgwPPGtpV1ErrIndTx=jnxMbgSgwPPGtpV1ErrIndTx, jnxMbgSgwGtpV2ICsUERefusesTx=jnxMbgSgwGtpV2ICsUERefusesTx, jnxMbgSgwPPCrIndTunRespTx=jnxMbgSgwPPCrIndTunRespTx, jnxMbgSgwPPIPVerErrRx=jnxMbgSgwPPIPVerErrRx, jnxMbgSgwIfUpdBrReqTx=jnxMbgSgwIfUpdBrReqTx, jnxMbgSgwIfGtpV2ICsCtxNotFndRx=jnxMbgSgwIfGtpV2ICsCtxNotFndRx, jnxMbgSgwIfGtpV2ICsTFTSysErrTx=jnxMbgSgwIfGtpV2ICsTFTSysErrTx, jnxMbgSgwGtpV2ICsLclDetTx=jnxMbgSgwGtpV2ICsLclDetTx, jnxMbgSgwPPGtpV2ICsPkFltManErTx=jnxMbgSgwPPGtpV2ICsPkFltManErTx, jnxMbgSgwPPGtpV2ICsUENotRespTx=jnxMbgSgwPPGtpV2ICsUENotRespTx, jnxMbgSgwGtpV1ErrIndRx=jnxMbgSgwGtpV1ErrIndRx, jnxMbgSgwIfModBrFlrIndTx=jnxMbgSgwIfModBrFlrIndTx, jnxMbgSgwPPGtpV2ICsPTMSISigMMTx=jnxMbgSgwPPGtpV2ICsPTMSISigMMTx, jnxMbgSgwIfGtpV2ICsSemErTADTx=jnxMbgSgwIfGtpV2ICsSemErTADTx, jnxMbgSgwPPUnSupportedMsgRx=jnxMbgSgwPPUnSupportedMsgRx, jnxMbgSgwIfDelSessRspTx=jnxMbgSgwIfDelSessRspTx, jnxMbgSgwIfGTPUnknVerRx=jnxMbgSgwIfGTPUnknVerRx, jnxMbgSgwPPGTPPortErrRx=jnxMbgSgwPPGTPPortErrRx, jnxMbgSgwIfGtpV2ICsUERefusesTx=jnxMbgSgwIfGtpV2ICsUERefusesTx, jnxMbgSgwDelBrFlrIndRx=jnxMbgSgwDelBrFlrIndRx, jnxMbgSgwS4PiggybackMsgTx=jnxMbgSgwS4PiggybackMsgTx, jnxMbgSgwIfGtpV1EndMarkerRx=jnxMbgSgwIfGtpV1EndMarkerRx, jnxMbgSgwGtpV2ICsGREKeyNtFdRx=jnxMbgSgwGtpV2ICsGREKeyNtFdRx, jnxMbgSgwGtpV2ICsTFTSMANTErTx=jnxMbgSgwGtpV2ICsTFTSMANTErTx, jnxMbgSgwIfBrResCmdTx=jnxMbgSgwIfBrResCmdTx, jnxMbgSgwPPResumeNotifTx=jnxMbgSgwPPResumeNotifTx, jnxMbgSgwIfGtpV2ICsPTNotSuppRx=jnxMbgSgwIfGtpV2ICsPTNotSuppRx, jnxMbgSgwIfGtpV2ICsSrvNotSuppTx=jnxMbgSgwIfGtpV2ICsSrvNotSuppTx, jnxMbgSgwPPGtpV2ICsInReFRePrTx=jnxMbgSgwPPGtpV2ICsInReFRePrTx, jnxMbgSgwPPDelBrFlrIndTx=jnxMbgSgwPPDelBrFlrIndTx, jnxMbgSgwIfGtpV2ICsTFTSysErrRx=jnxMbgSgwIfGtpV2ICsTFTSysErrRx, jnxMbgSgwIfGTPPortErrRx=jnxMbgSgwIfGTPPortErrRx, jnxMbgSgwPPGtpV2ICsSynErTADRx=jnxMbgSgwPPGtpV2ICsSynErTADRx, jnxMbgSgwPPGtpV2ICsPTMSISigMMRx=jnxMbgSgwPPGtpV2ICsPTMSISigMMRx, jnxMbgSgwGtpV2ICsInvMsgFmtTx=jnxMbgSgwGtpV2ICsInvMsgFmtTx, jnxMbgSgwPPGtpV2ICsInvPrTx=jnxMbgSgwPPGtpV2ICsInvPrTx, jnxMbgSgwIfV2NumBytesTx=jnxMbgSgwIfV2NumBytesTx, jnxMbgSgwIfGtpV2ICsUnPgUESusRx=jnxMbgSgwIfGtpV2ICsUnPgUESusRx, jnxMbgSgwPPGtpV1EchoRespRx=jnxMbgSgwPPGtpV1EchoRespRx, jnxMbgSgwGtpV2ICsPageTx=jnxMbgSgwGtpV2ICsPageTx, jnxMbgSgwGtpV2ICsNewPTSIAdbrRx=jnxMbgSgwGtpV2ICsNewPTSIAdbrRx, jnxMbgSgwIfGtpV2ICsAPNAcsDenRx=jnxMbgSgwIfGtpV2ICsAPNAcsDenRx, jnxMbgSgwIfModBrFlrIndRx=jnxMbgSgwIfModBrFlrIndRx, jnxMbgSgwS5PiggybackMsgRx=jnxMbgSgwS5PiggybackMsgRx, jnxMbgSgwIfGtpV2ICsInvMsgFmtRx=jnxMbgSgwIfGtpV2ICsInvMsgFmtRx, jnxMbgSgwGtpV2ICsPTMSISigMMRx=jnxMbgSgwGtpV2ICsPTMSISigMMRx, jnxMbgSgwIfGtpV2ICsRATChgTx=jnxMbgSgwIfGtpV2ICsRATChgTx, jnxMbgSgwPPGtpV2ICsUnknownRx=jnxMbgSgwPPGtpV2ICsUnknownRx, jnxMbgSgwPPDelSessReqRx=jnxMbgSgwPPDelSessReqRx, jnxMbgSgwPPT3RespTmrExpRx=jnxMbgSgwPPT3RespTmrExpRx, jnxMbgSgwIfGtpV2ICsLclDetTx=jnxMbgSgwIfGtpV2ICsLclDetTx, jnxMbgSgwGtpV2ICsServNotSuppRx=jnxMbgSgwGtpV2ICsServNotSuppRx, jnxMbgSgwPPDelConnSetRspTx=jnxMbgSgwPPDelConnSetRspTx, jnxMbgSgwPacketSendFail=jnxMbgSgwPacketSendFail, jnxMbgSgwIfModBrCmdTx=jnxMbgSgwIfModBrCmdTx, jnxMbgSgwGtpV2ICsNoMemTx=jnxMbgSgwGtpV2ICsNoMemTx, jnxMbgSgwIfGtpV2ICsIMSINotKnTx=jnxMbgSgwIfGtpV2ICsIMSINotKnTx, jnxMbgSgwPPGtpV2ICsVerNotSuppRx=jnxMbgSgwPPGtpV2ICsVerNotSuppRx, jnxMbgSgwGtpV2ICsRMValRcvTx=jnxMbgSgwGtpV2ICsRMValRcvTx, jnxMbgSgwIfGtpV2ICsDtForNtSupRx=jnxMbgSgwIfGtpV2ICsDtForNtSupRx, jnxMbgSgwIfUpdBrReqRx=jnxMbgSgwIfUpdBrReqRx, jnxMbgSgwModBrFlrIndTx=jnxMbgSgwModBrFlrIndTx, jnxMbgSgwDlDataNotifTx=jnxMbgSgwDlDataNotifTx, jnxMbgSgwGtpV2ICsPkFltSynErrRx=jnxMbgSgwGtpV2ICsPkFltSynErrRx, jnxMbgSgwPPGtpV2ICsManIEMissRx=jnxMbgSgwPPGtpV2ICsManIEMissRx, jnxMbgSgwCrIndTunRespTx=jnxMbgSgwCrIndTunRespTx, jnxMbgSgwPPCrtBrReqTx=jnxMbgSgwPPCrtBrReqTx, jnxMbgSgwPPGtpV2ICsServDeniedRx=jnxMbgSgwPPGtpV2ICsServDeniedRx)
mibBuilder.exportSymbols("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", jnxMbgSgwBrResFlrIndRx=jnxMbgSgwBrResFlrIndRx, jnxMbgSgwPPModBrReqTx=jnxMbgSgwPPModBrReqTx, jnxMbgSgwIfDlDataAckRx=jnxMbgSgwIfDlDataAckRx, jnxMbgSgwIfGtpV2ICsUENotRespTx=jnxMbgSgwIfGtpV2ICsUENotRespTx, jnxMbgSgwGtpV2ICsRelocFailRx=jnxMbgSgwGtpV2ICsRelocFailRx, jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx=jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx, jnxMbgSgwDelConnSetRspRx=jnxMbgSgwDelConnSetRspRx, jnxMbgSgwGtpV1EndMarkerTx=jnxMbgSgwGtpV1EndMarkerTx, jnxMbgSgwPPSuspNotifRx=jnxMbgSgwPPSuspNotifRx, jnxMbgSgwGtpV2ICsUnexpRptIETx=jnxMbgSgwGtpV2ICsUnexpRptIETx, jnxMbgSgwIfGtpV2ICsReqRejRx=jnxMbgSgwIfGtpV2ICsReqRejRx, jnxMbgSgwModBrRspTx=jnxMbgSgwModBrRspTx, jnxMbgSgwGtpV2ICsAcceptPartRx=jnxMbgSgwGtpV2ICsAcceptPartRx, jnxMbgSgwIfSuspNotifRx=jnxMbgSgwIfSuspNotifRx, jnxMbgSgwPPV2NumMsgTx=jnxMbgSgwPPV2NumMsgTx, jnxMbgSgwPPGtpV2ICsNoMemTx=jnxMbgSgwPPGtpV2ICsNoMemTx, jnxMbgSgwIfGtpV2ICsReqAcceptRx=jnxMbgSgwIfGtpV2ICsReqAcceptRx, jnxMbgSgwPPPcktLenErrRx=jnxMbgSgwPPPcktLenErrRx, jnxMbgSgwBrResCmdTx=jnxMbgSgwBrResCmdTx, jnxMbgSgwIfGtpV2ICsCondIEMsTx=jnxMbgSgwIfGtpV2ICsCondIEMsTx, jnxMbgSgwGtpV2ICsInvLenRx=jnxMbgSgwGtpV2ICsInvLenRx, jnxMbgSgwPPGtpV1T3RespTmrExpRx=jnxMbgSgwPPGtpV1T3RespTmrExpRx, jnxMbgSgwPPGtpV2ICsRMValRcvRx=jnxMbgSgwPPGtpV2ICsRMValRcvRx, jnxMbgSgwS5PiggybackMsgTx=jnxMbgSgwS5PiggybackMsgTx, jnxMbgSgwIfDelIndTunReqTx=jnxMbgSgwIfDelIndTunReqTx, jnxMbgSgwIfDelBrCmdTx=jnxMbgSgwIfDelBrCmdTx, jnxMbgSgwIfGtpV2ICsMisUnknAPNRx=jnxMbgSgwIfGtpV2ICsMisUnknAPNRx, jnxMbgSgwPPGtpV2ICsNoMemRx=jnxMbgSgwPPGtpV2ICsNoMemRx, jnxMbgSgwPPUpdConnSetReqRx=jnxMbgSgwPPUpdConnSetReqRx, jnxMbgSgwDlDataNotiFlrIndRx=jnxMbgSgwDlDataNotiFlrIndRx, jnxMbgSgwPPDlDataNotiFlrIndRx=jnxMbgSgwPPDlDataNotiFlrIndRx, jnxMbgSgwIfV2VerNotSupTx=jnxMbgSgwIfV2VerNotSupTx, jnxMbgSgwPPGtpV2ICsIMSINotKnRx=jnxMbgSgwPPGtpV2ICsIMSINotKnRx, jnxMbgSgwPPRelAcsBrReqRx=jnxMbgSgwPPRelAcsBrReqRx, jnxMbgSgwPPGtpV2ICsInReFRePrRx=jnxMbgSgwPPGtpV2ICsInReFRePrRx, jnxMbgSgwGtpV2ICsPageRx=jnxMbgSgwGtpV2ICsPageRx, jnxMbgSgwIfResumeNotifTx=jnxMbgSgwIfResumeNotifTx, jnxMbgSgwPPGtpV2ICsUnabPageUERx=jnxMbgSgwPPGtpV2ICsUnabPageUERx, jnxMbgSgwIfRxPacketsDropped=jnxMbgSgwIfRxPacketsDropped, jnxMbgSgwGtpV1EchoRespTx=jnxMbgSgwGtpV1EchoRespTx, jnxMbgSgwPPGtpV2ICsUserAUTHFlRx=jnxMbgSgwPPGtpV2ICsUserAUTHFlRx, jnxMbgSgwIfCreateSessReqTx=jnxMbgSgwIfCreateSessReqTx, jnxMbgSgwPPDelIndTunReqTx=jnxMbgSgwPPDelIndTunReqTx, jnxMbgSgwIfDelIndTunReqRx=jnxMbgSgwIfDelIndTunReqRx, jnxMbgSgwPPGtpV2ICsAcceptPartRx=jnxMbgSgwPPGtpV2ICsAcceptPartRx, jnxMbgSgwPPV2EchoRespTx=jnxMbgSgwPPV2EchoRespTx, jnxMbgSgwPPGtpV2ICsColNWReqTx=jnxMbgSgwPPGtpV2ICsColNWReqTx, jnxMbgSgwGtpV2ICsCondIEMsRx=jnxMbgSgwGtpV2ICsCondIEMsRx, jnxMbgSgwGTPPortErrRx=jnxMbgSgwGTPPortErrRx, jnxMbgSgwIfGtpV2ICsInReFRePrRx=jnxMbgSgwIfGtpV2ICsInReFRePrRx, jnxMbgSgwPPGtpV2ICsPkFltSynErTx=jnxMbgSgwPPGtpV2ICsPkFltSynErTx, jnxMbgSgwIfGtpV2ICsUENotRespRx=jnxMbgSgwIfGtpV2ICsUENotRespRx, jnxMbgSgwDelBrRspRx=jnxMbgSgwDelBrRspRx, jnxMbgSgwIfType=jnxMbgSgwIfType, jnxMbgSgwIfGtpV2ICsServDeniedTx=jnxMbgSgwIfGtpV2ICsServDeniedTx, jnxMbgSgwSuspAckRx=jnxMbgSgwSuspAckRx, jnxMbgSgwPPGtpV2ICsManIEIncorTx=jnxMbgSgwPPGtpV2ICsManIEIncorTx, jnxMbgSgwIfGtpV2ICsISRDeactRx=jnxMbgSgwIfGtpV2ICsISRDeactRx, jnxMbgSgwGtpIfStatsEntry=jnxMbgSgwGtpIfStatsEntry, jnxMbgSgwIfGtpV2ICsServDeniedRx=jnxMbgSgwIfGtpV2ICsServDeniedRx, jnxMbgSgwGtpV2ICsNoResTx=jnxMbgSgwGtpV2ICsNoResTx, jnxMbgSgwPPGtpV2ICsReqAcceptRx=jnxMbgSgwPPGtpV2ICsReqAcceptRx, jnxMbgSgwDelBrCmdTx=jnxMbgSgwDelBrCmdTx, jnxMbgSgwGtpV2ICsNoMemRx=jnxMbgSgwGtpV2ICsNoMemRx, jnxMbgSgwGtpV2ICsUnPgUESusTx=jnxMbgSgwGtpV2ICsUnPgUESusTx, jnxMbgSgwIfDelConnSetRspRx=jnxMbgSgwIfDelConnSetRspRx, jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx=jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx, jnxMbgSgwPPDelIndTunReqRx=jnxMbgSgwPPDelIndTunReqRx, jnxMbgSgwIfGtpV2ICsPTNotSuppTx=jnxMbgSgwIfGtpV2ICsPTNotSuppTx, jnxMbgSgwCrtBrRspRx=jnxMbgSgwCrtBrRspRx, jnxMbgSgwGtpV2ICsInvLenTx=jnxMbgSgwGtpV2ICsInvLenTx, jnxMbgSgwGtpV2ICsNewPTNPrefRx=jnxMbgSgwGtpV2ICsNewPTNPrefRx, jnxMbgSgwGtpV2ICsIMSINotKnRx=jnxMbgSgwGtpV2ICsIMSINotKnRx, jnxMbgSgwIfCreateSessRspRx=jnxMbgSgwIfCreateSessRspRx, jnxMbgSgwIfDelSessRspRx=jnxMbgSgwIfDelSessRspRx, jnxMbgSgwGtpV2ICsEIFRNCEnTx=jnxMbgSgwGtpV2ICsEIFRNCEnTx, jnxMbgSgwIfBrResFlrIndRx=jnxMbgSgwIfBrResFlrIndRx, jnxMbgSgwIfGtpV2ICsColNWReqRx=jnxMbgSgwIfGtpV2ICsColNWReqRx, jnxMbgSgwIfProtocolErrRx=jnxMbgSgwIfProtocolErrRx, jnxMbgSgwGtpV2ICsInvPrTx=jnxMbgSgwGtpV2ICsInvPrTx, jnxMbgSgwGtpNotifications=jnxMbgSgwGtpNotifications, jnxMbgSgwGtpV2ICsPkFltManErrTx=jnxMbgSgwGtpV2ICsPkFltManErrTx, jnxMbgSgwPPGtpV2ICsNewPTNPrefRx=jnxMbgSgwPPGtpV2ICsNewPTNPrefRx, jnxMbgSgwGtpV2ICsRPrNtRspTx=jnxMbgSgwGtpV2ICsRPrNtRspTx, jnxMbgSgwRelAcsBrRespTx=jnxMbgSgwRelAcsBrRespTx, jnxMbgSgwGtpV2ICsAPNResTIncTx=jnxMbgSgwGtpV2ICsAPNResTIncTx, jnxMbgSgwPPGtpV2ICsCondIEMsTx=jnxMbgSgwPPGtpV2ICsCondIEMsTx, jnxMbgSgwUpdConnSetReqTx=jnxMbgSgwUpdConnSetReqTx, jnxMbgSgwPPGtpV2ICsAPNResTIncRx=jnxMbgSgwPPGtpV2ICsAPNResTIncRx, jnxMbgSgwGtpV2ICsServNotSuppTx=jnxMbgSgwGtpV2ICsServNotSuppTx, jnxMbgSgwUpdBrRspRx=jnxMbgSgwUpdBrRspRx, jnxMbgSgwDelIndTunReqTx=jnxMbgSgwDelIndTunReqTx, jnxMbgSgwIfGtpV2ICsNewPTNPrefRx=jnxMbgSgwIfGtpV2ICsNewPTNPrefRx, jnxMbgSgwDelConnSetReqRx=jnxMbgSgwDelConnSetReqRx, jnxMbgSgwGtpV2ICsInvPrRx=jnxMbgSgwGtpV2ICsInvPrRx, jnxMbgSgwIfGtpV1EndMarkerTx=jnxMbgSgwIfGtpV1EndMarkerTx, jnxMbgSgwBrResFlrIndTx=jnxMbgSgwBrResFlrIndTx, jnxMbgSgwIPVerErrRx=jnxMbgSgwIPVerErrRx, jnxMbgSgwIfGtpV1T3RespTmrExpRx=jnxMbgSgwIfGtpV1T3RespTmrExpRx, jnxMbgSgwIfModBrRspTx=jnxMbgSgwIfModBrRspTx, jnxMbgSgwPPGtpV2ICsProtoNtSupTx=jnxMbgSgwPPGtpV2ICsProtoNtSupTx, jnxMbgSgwIfGtpV2ICsInvMsgFmtTx=jnxMbgSgwIfGtpV2ICsInvMsgFmtTx, jnxMbgSgwPPSuspAckTx=jnxMbgSgwPPSuspAckTx, jnxMbgSgwGtpV2ICsNOTFTUECTXRx=jnxMbgSgwGtpV2ICsNOTFTUECTXRx, jnxMbgSgwPPGtpV2ICsOptIEIncorRx=jnxMbgSgwPPGtpV2ICsOptIEIncorRx, jnxMbgSgwUpdConnSetRspRx=jnxMbgSgwUpdConnSetRspRx, jnxMbgSgwGtpV2ICsPTNotSuppRx=jnxMbgSgwGtpV2ICsPTNotSuppRx, jnxMbgSgwPPGtpV2ICsAPNAcsDenRx=jnxMbgSgwPPGtpV2ICsAPNAcsDenRx, jnxMbgSgwPPGtpV2ICsUnexpRptIERx=jnxMbgSgwPPGtpV2ICsUnexpRptIERx, jnxMbgSgwCreateSessRspRx=jnxMbgSgwCreateSessRspRx, jnxMbgSgwIfGtpV1UnSupMsgRx=jnxMbgSgwIfGtpV1UnSupMsgRx, jnxMbgSgwUpdBrReqTx=jnxMbgSgwUpdBrReqTx, jnxMbgSgwPPGtpV2ICsServNotSupRx=jnxMbgSgwPPGtpV2ICsServNotSupRx, jnxMbgSgwIfGtpV2ICsUERefusesRx=jnxMbgSgwIfGtpV2ICsUERefusesRx, jnxMbgSgwPPGtpV2ICsRPrNtRspTx=jnxMbgSgwPPGtpV2ICsRPrNtRspTx, jnxMbgSgwIfGtpV1EchoReqTx=jnxMbgSgwIfGtpV1EchoReqTx, jnxMbgSgwPPGtpV2ICsCmpDetRx=jnxMbgSgwPPGtpV2ICsCmpDetRx, jnxMbgSgwCrIndTunRespRx=jnxMbgSgwCrIndTunRespRx, jnxMbgSgwIfGtpV2ICsOptIEIncorRx=jnxMbgSgwIfGtpV2ICsOptIEIncorRx, jnxMbgSgwPPGtpV2ICsCmpDetTx=jnxMbgSgwPPGtpV2ICsCmpDetTx, jnxMbgSgwGtpAlarmStatCounter=jnxMbgSgwGtpAlarmStatCounter, jnxMbgSgwPPV2EchoReqRx=jnxMbgSgwPPV2EchoReqRx, jnxMbgSgwDlDataAckRx=jnxMbgSgwDlDataAckRx, jnxMbgSgwIfIPVerErrRx=jnxMbgSgwIfIPVerErrRx, jnxMbgSgwPPStopPagingIndRx=jnxMbgSgwPPStopPagingIndRx, jnxMbgSgwGtpV2ICsInvTotLenTx=jnxMbgSgwGtpV2ICsInvTotLenTx, jnxMbgSgwIfModBrReqTx=jnxMbgSgwIfModBrReqTx, jnxMbgSgwGtpV1ProtocolErrRx=jnxMbgSgwGtpV1ProtocolErrRx, jnxMbgSgwGtpV2ICsUENotRespRx=jnxMbgSgwGtpV2ICsUENotRespRx, jnxMbgSgwIfGtpV2ICsManIEIncorRx=jnxMbgSgwIfGtpV2ICsManIEIncorRx, jnxMbgSgwPPGtpV2ICsUnexpRptIETx=jnxMbgSgwPPGtpV2ICsUnexpRptIETx, jnxMbgSgwIfGtpV2ICsPkFltSynErRx=jnxMbgSgwIfGtpV2ICsPkFltSynErRx, jnxMbgSgwPPDlDataNotifRx=jnxMbgSgwPPDlDataNotifRx, jnxMbgSgwGtpV2ICsCondIEMsTx=jnxMbgSgwGtpV2ICsCondIEMsTx, jnxMbgSgwDelIndTunRespTx=jnxMbgSgwDelIndTunRespTx, jnxMbgSgwPPGtpV2ICsDenINRatRx=jnxMbgSgwPPGtpV2ICsDenINRatRx, jnxMbgSgwGtpPeerGwDnNotif=jnxMbgSgwGtpPeerGwDnNotif, jnxMbgSgwGtpV2ICsPkFltManErrRx=jnxMbgSgwGtpV2ICsPkFltManErrRx, jnxMbgSgwV2NumMsgRx=jnxMbgSgwV2NumMsgRx, jnxMbgSgwPPModBrFlrIndTx=jnxMbgSgwPPModBrFlrIndTx, jnxMbgSgwIfUpdConnSetReqRx=jnxMbgSgwIfUpdConnSetReqRx, jnxMbgSgwGtpObjects=jnxMbgSgwGtpObjects, jnxMbgSgwGtpV2ICsSynErTADTx=jnxMbgSgwGtpV2ICsSynErTADTx, jnxMbgSgwIfPacketAllocFail=jnxMbgSgwIfPacketAllocFail, jnxMbgSgwIfCreateSessReqRx=jnxMbgSgwIfCreateSessReqRx, jnxMbgSgwPPCrIndTunReqRx=jnxMbgSgwPPCrIndTunReqRx, jnxMbgSgwCrtBrRspTx=jnxMbgSgwCrtBrRspTx, jnxMbgSgwPPV2NumBytesTx=jnxMbgSgwPPV2NumBytesTx, jnxMbgSgwGtpIfStatsTable=jnxMbgSgwGtpIfStatsTable, jnxMbgSgwGtpV2ICsColNWReqRx=jnxMbgSgwGtpV2ICsColNWReqRx, jnxMbgSgwPPGtpV2ICsUserAUTHFlTx=jnxMbgSgwPPGtpV2ICsUserAUTHFlTx, jnxMbgSgwIfGtpV2ICsEIFRNCEnTx=jnxMbgSgwIfGtpV2ICsEIFRNCEnTx, jnxMbgSgwPPV2EchoReqTx=jnxMbgSgwPPV2EchoReqTx, jnxMbgSgwDlDataNotifRx=jnxMbgSgwDlDataNotifRx, jnxMbgSgwPPGtpV2ICsRPrNtRspRx=jnxMbgSgwPPGtpV2ICsRPrNtRspRx, jnxMbgSgwS11PiggybackMsgRx=jnxMbgSgwS11PiggybackMsgRx, jnxMbgSgwPPGtpV2ICsSysFailRx=jnxMbgSgwPPGtpV2ICsSysFailRx, jnxMbgSgwGtpV2ICsVerNotSuppRx=jnxMbgSgwGtpV2ICsVerNotSuppRx, jnxMbgSgwDlDataAckTx=jnxMbgSgwDlDataAckTx, jnxMbgSgwPPGtpV2ICsCtxNotFndRx=jnxMbgSgwPPGtpV2ICsCtxNotFndRx, jnxMbgSgwIfGtpV2ICsAlDynAdOccTx=jnxMbgSgwIfGtpV2ICsAlDynAdOccTx, jnxMbgSgwPPGtpV1ProtocolErrRx=jnxMbgSgwPPGtpV1ProtocolErrRx, jnxMbgSgwModBrCmdTx=jnxMbgSgwModBrCmdTx, jnxMbgSgwPPProtocolErrRx=jnxMbgSgwPPProtocolErrRx, jnxMbgSgwPPRelAcsBrReqTx=jnxMbgSgwPPRelAcsBrReqTx, jnxMbgSgwGtpV1UnSupMsgRx=jnxMbgSgwGtpV1UnSupMsgRx, jnxMbgSgwResumeAckTx=jnxMbgSgwResumeAckTx, jnxMbgSgwIfGtpV2ICsSysFailTx=jnxMbgSgwIfGtpV2ICsSysFailTx, jnxMbgSgwIfV2EchoReqTx=jnxMbgSgwIfV2EchoReqTx, jnxMbgSgwIfGtpV2ICsRMValRcvRx=jnxMbgSgwIfGtpV2ICsRMValRcvRx, jnxMbgSgwPPUpdBrRspTx=jnxMbgSgwPPUpdBrRspTx, jnxMbgSgwIfGtpV2ICsSynErTADRx=jnxMbgSgwIfGtpV2ICsSynErTADRx, jnxMbgSgwPPSuspAckRx=jnxMbgSgwPPSuspAckRx, jnxMbgSgwProtocolErrRx=jnxMbgSgwProtocolErrRx, jnxMbgSgwCrtBrReqTx=jnxMbgSgwCrtBrReqTx, jnxMbgSgwIfCrtBrReqRx=jnxMbgSgwIfCrtBrReqRx, jnxMbgSgwIfGtpV2ICsProtoNtSupTx=jnxMbgSgwIfGtpV2ICsProtoNtSupTx, jnxMbgSgwIfGtpV2ICsUserAUTHFlRx=jnxMbgSgwIfGtpV2ICsUserAUTHFlRx, jnxMbgSgwGtpV2ICsSemErTADTx=jnxMbgSgwGtpV2ICsSemErTADTx, jnxMbgSgwGtpV2ICsSysFailTx=jnxMbgSgwGtpV2ICsSysFailTx, jnxMbgSgwGtpV2ICsDtForNtSupTx=jnxMbgSgwGtpV2ICsDtForNtSupTx, jnxMbgSgwPPDelBrFlrIndRx=jnxMbgSgwPPDelBrFlrIndRx, jnxMbgSgwPPGtpV2ICsUnPgUESusTx=jnxMbgSgwPPGtpV2ICsUnPgUESusTx, jnxMbgSgwGtpV2ICsManIEMissTx=jnxMbgSgwGtpV2ICsManIEMissTx, jnxMbgSgwCreateSessReqTx=jnxMbgSgwCreateSessReqTx, jnxMbgSgwPPUpdBrReqTx=jnxMbgSgwPPUpdBrReqTx, jnxMbgSgwIfPiggybackMsgTx=jnxMbgSgwIfPiggybackMsgTx, jnxMbgSgwIfResumeAckRx=jnxMbgSgwIfResumeAckRx, jnxMbgSgwPPGtpV2ICsPageRx=jnxMbgSgwPPGtpV2ICsPageRx, jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx=jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx, jnxMbgSgwIfGtpV2ICsInvTotLenRx=jnxMbgSgwIfGtpV2ICsInvTotLenRx, jnxMbgSgwGTPUnknVerRx=jnxMbgSgwGTPUnknVerRx, jnxMbgSgwV2EchoReqTx=jnxMbgSgwV2EchoReqTx, jnxMbgSgwPPGtpV2ICsManIEMissTx=jnxMbgSgwPPGtpV2ICsManIEMissTx, jnxMbgSgwIfGtpV2ICsAPNResTIncRx=jnxMbgSgwIfGtpV2ICsAPNResTIncRx, jnxMbgSgwIfDlDataNotiFlrIndRx=jnxMbgSgwIfDlDataNotiFlrIndRx, jnxMbgSgwPPGtpV2ICsInvTotLenTx=jnxMbgSgwPPGtpV2ICsInvTotLenTx, jnxMbgSgwGtpV2ICsMisUnknAPNRx=jnxMbgSgwGtpV2ICsMisUnknAPNRx, jnxMbgSgwModBrReqRx=jnxMbgSgwModBrReqRx, jnxMbgSgwModBrReqTx=jnxMbgSgwModBrReqTx, jnxMbgSgwIfGtpV2ICsReqRejTx=jnxMbgSgwIfGtpV2ICsReqRejTx, jnxMbgSgwIfRelAcsBrRespTx=jnxMbgSgwIfRelAcsBrRespTx, jnxMbgSgwCrIndTunReqRx=jnxMbgSgwCrIndTunReqRx, jnxMbgSgwIfGtpV2ICsProtoNtSupRx=jnxMbgSgwIfGtpV2ICsProtoNtSupRx, jnxMbgSgwPPDelBrRspRx=jnxMbgSgwPPDelBrRspRx, jnxMbgSgwPPGtpV2ICsLclDetTx=jnxMbgSgwPPGtpV2ICsLclDetTx, jnxMbgSgwIfGtpV2ICsIMSINotKnRx=jnxMbgSgwIfGtpV2ICsIMSINotKnRx, jnxMbgSgwIfRelAcsBrRespRx=jnxMbgSgwIfRelAcsBrRespRx, jnxMbgSgwPPV2VerNotSupTx=jnxMbgSgwPPV2VerNotSupTx, jnxMbgSgwIfGtpV2ICsPTMSISigMMTx=jnxMbgSgwIfGtpV2ICsPTMSISigMMTx, jnxMbgSgwIfGtpV2ICsRATChgRx=jnxMbgSgwIfGtpV2ICsRATChgRx, jnxMbgSgwGtpGwName=jnxMbgSgwGtpGwName, jnxMbgSgwPPGtpV2ICsUnabPageUETx=jnxMbgSgwPPGtpV2ICsUnabPageUETx, jnxMbgSgwGtpV2ICsNewPTSIAdbrTx=jnxMbgSgwGtpV2ICsNewPTSIAdbrTx, jnxMbgSgwSuspNotifRx=jnxMbgSgwSuspNotifRx, jnxMbgSgwPPV2VerNotSupRx=jnxMbgSgwPPV2VerNotSupRx, jnxMbgSgwIfGtpV2ICsNoMemRx=jnxMbgSgwIfGtpV2ICsNoMemRx, jnxMbgSgwDelBrRspTx=jnxMbgSgwDelBrRspTx, jnxMbgSgwIfGtpV2ICsSynErTADTx=jnxMbgSgwIfGtpV2ICsSynErTADTx, jnxMbgSgwIfIPProtoErrRx=jnxMbgSgwIfIPProtoErrRx, jnxMbgSgwIfGtpV1EchoRespRx=jnxMbgSgwIfGtpV1EchoRespRx, jnxMbgSgwPPGtpV2ICsInvLenTx=jnxMbgSgwPPGtpV2ICsInvLenTx, jnxMbgSgwSuspNotifTx=jnxMbgSgwSuspNotifTx, jnxMbgSgwPPGtpV2ICsColNWReqRx=jnxMbgSgwPPGtpV2ICsColNWReqRx, jnxMbgSgwIfGtpV2ICsCtxNotFndTx=jnxMbgSgwIfGtpV2ICsCtxNotFndTx, jnxMbgSgwIfGtpV1ErrIndRx=jnxMbgSgwIfGtpV1ErrIndRx, jnxMbgSgwPPDelConnSetReqTx=jnxMbgSgwPPDelConnSetReqTx, jnxMbgSgwPPGtpV1EchoRespTx=jnxMbgSgwPPGtpV1EchoRespTx, jnxMbgSgwPPGtpV2ICsServDeniedTx=jnxMbgSgwPPGtpV2ICsServDeniedTx, jnxMbgSgwGtpV2ICsUnknownTx=jnxMbgSgwGtpV2ICsUnknownTx, jnxMbgSgwPPDelConnSetReqRx=jnxMbgSgwPPDelConnSetReqRx, jnxMbgSgwIfDelIndTunRespTx=jnxMbgSgwIfDelIndTunRespTx, jnxMbgSgwIfPiggybackMsgRx=jnxMbgSgwIfPiggybackMsgRx, jnxMbgSgwIfDelBrCmdRx=jnxMbgSgwIfDelBrCmdRx, jnxMbgSgwGtpV1EchoRespRx=jnxMbgSgwGtpV1EchoRespRx, jnxMbgSgwPPGtpLclAddr=jnxMbgSgwPPGtpLclAddr, jnxMbgSgwPPGtpV2ICsPkFltSynErRx=jnxMbgSgwPPGtpV2ICsPkFltSynErRx, jnxMbgSgwPPGtpV2ICsRelocFailTx=jnxMbgSgwPPGtpV2ICsRelocFailTx, jnxMbgSgwGtpV2ICsAPNAcsDenRx=jnxMbgSgwGtpV2ICsAPNAcsDenRx, jnxMbgSgwIfGtpV2ICsUnknownTx=jnxMbgSgwIfGtpV2ICsUnknownTx, jnxMbgSgwPPDelSessRspRx=jnxMbgSgwPPDelSessRspRx, jnxMbgSgwPPGtpV2ICsNewPTNPrefTx=jnxMbgSgwPPGtpV2ICsNewPTNPrefTx, jnxMbgSgwV2EchoRespTx=jnxMbgSgwV2EchoRespTx, jnxMbgSgwPPGtpV2ICsVerNotSuppTx=jnxMbgSgwPPGtpV2ICsVerNotSuppTx, jnxMbgSgwResumeNotifTx=jnxMbgSgwResumeNotifTx, jnxMbgSgwPPCrtBrRspTx=jnxMbgSgwPPCrtBrRspTx, jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx=jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx, jnxMbgSgwPPGtpV2ICsManIEIncorRx=jnxMbgSgwPPGtpV2ICsManIEIncorRx, jnxMbgSgwIfDlDataNotifRx=jnxMbgSgwIfDlDataNotifRx, jnxMbgSgwIfDelConnSetReqRx=jnxMbgSgwIfDelConnSetReqRx, jnxMbgSgwGtpV2ICsAPNResTIncRx=jnxMbgSgwGtpV2ICsAPNResTIncRx, jnxMbgSgwIfGtpV1ProtocolErrRx=jnxMbgSgwIfGtpV1ProtocolErrRx, jnxMbgSgwIfUpdBrRspTx=jnxMbgSgwIfUpdBrRspTx, jnxMbgSgwPPGtpV2ICsTFTSysErrRx=jnxMbgSgwPPGtpV2ICsTFTSysErrRx)
mibBuilder.exportSymbols("JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB", jnxMbgSgwResumeNotifRx=jnxMbgSgwResumeNotifRx, jnxMbgSgwIfV2EchoReqRx=jnxMbgSgwIfV2EchoReqRx, jnxMbgSgwSuspAckTx=jnxMbgSgwSuspAckTx, jnxMbgSgwGtpV1EndMarkerRx=jnxMbgSgwGtpV1EndMarkerRx, jnxMbgSgwIfGtpV2ICsNoMemTx=jnxMbgSgwIfGtpV2ICsNoMemTx, jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx=jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx, jnxMbgSgwPPGtpV1EndMarkerTx=jnxMbgSgwPPGtpV1EndMarkerTx, jnxMbgSgwPPGtpV2ICsReqRejRx=jnxMbgSgwPPGtpV2ICsReqRejRx, jnxMbgSgwIfSuspAckRx=jnxMbgSgwIfSuspAckRx, jnxMbgSgwIfGtpV2ICsNoResRx=jnxMbgSgwIfGtpV2ICsNoResRx, jnxMbgSgwIfGtpV2ICsInvPrTx=jnxMbgSgwIfGtpV2ICsInvPrTx, jnxMbgSgwGtpV2ICsMisUnknAPNTx=jnxMbgSgwGtpV2ICsMisUnknAPNTx, jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx=jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx, jnxMbgSgwPPGtpV2ICsEIFRNCEnRx=jnxMbgSgwPPGtpV2ICsEIFRNCEnRx, jnxMbgSgwUpdConnSetReqRx=jnxMbgSgwUpdConnSetReqRx, jnxMbgSgwGtpV2ICsAllDynAdOccTx=jnxMbgSgwGtpV2ICsAllDynAdOccTx, jnxMbgSgwIfResumeNotifRx=jnxMbgSgwIfResumeNotifRx, jnxMbgSgwGtpV2ICsRATChgTx=jnxMbgSgwGtpV2ICsRATChgTx, jnxMbgSgwGtpV1ErrIndTx=jnxMbgSgwGtpV1ErrIndTx, jnxMbgSgwIfSuspNotifTx=jnxMbgSgwIfSuspNotifTx, jnxMbgSgwIfGtpV2ICsAlDynAdOccRx=jnxMbgSgwIfGtpV2ICsAlDynAdOccRx, jnxMbgSgwIfUnknMsgRx=jnxMbgSgwIfUnknMsgRx, jnxMbgSgwPPDlDataAckRx=jnxMbgSgwPPDlDataAckRx, jnxMbgSgwIfGtpV2ICsNoResTx=jnxMbgSgwIfGtpV2ICsNoResTx, jnxMbgSgwPPGtpV2ICsTFTSMANTErTx=jnxMbgSgwPPGtpV2ICsTFTSMANTErTx, jnxMbgSgwIfGtpV2ICsTFTSMANTErTx=jnxMbgSgwIfGtpV2ICsTFTSMANTErTx, jnxMbgSgwIfV2NumBytesRx=jnxMbgSgwIfV2NumBytesRx, jnxMbgSgwPPPacketSendFail=jnxMbgSgwPPPacketSendFail, jnxMbgSgwModBrRspRx=jnxMbgSgwModBrRspRx, jnxMbgSgwPPCrIndTunReqTx=jnxMbgSgwPPCrIndTunReqTx, jnxMbgSgwRelAcsBrReqRx=jnxMbgSgwRelAcsBrReqRx, jnxMbgSgwPPGtpV2ICsCondIEMsRx=jnxMbgSgwPPGtpV2ICsCondIEMsRx, jnxMbgSgwIfDelBrFlrIndRx=jnxMbgSgwIfDelBrFlrIndRx, jnxMbgSgwV2NumBytesRx=jnxMbgSgwV2NumBytesRx, jnxMbgSgwPPGtpV2ICsUENotRespRx=jnxMbgSgwPPGtpV2ICsUENotRespRx, jnxMbgSgwPPGtpV2ICsDtForNtSupTx=jnxMbgSgwPPGtpV2ICsDtForNtSupTx, jnxMbgSgwGtpNotificationVars=jnxMbgSgwGtpNotificationVars, jnxMbgSgwPPV2EchoRespRx=jnxMbgSgwPPV2EchoRespRx, jnxMbgSgwPPGtpV2ICsTFTSysErrTx=jnxMbgSgwPPGtpV2ICsTFTSysErrTx, jnxMbgSgwGtpV2ICsVerNotSuppTx=jnxMbgSgwGtpV2ICsVerNotSuppTx, jnxMbgSgwIfGtpV1EchoReqRx=jnxMbgSgwIfGtpV1EchoReqRx, jnxMbgSgwIfCreateSessRspTx=jnxMbgSgwIfCreateSessRspTx, jnxMbgSgwGtpPerPeerStatsEntry=jnxMbgSgwGtpPerPeerStatsEntry, jnxMbgSgwPPGtpV2ICsUnknownTx=jnxMbgSgwPPGtpV2ICsUnknownTx, jnxMbgSgwIfGtpV2ICsPTMSISigMMRx=jnxMbgSgwIfGtpV2ICsPTMSISigMMRx, jnxMbgSgwGtpGwIndex=jnxMbgSgwGtpGwIndex, jnxMbgSgwModBrCmdRx=jnxMbgSgwModBrCmdRx, jnxMbgSgwPPDelSessRspTx=jnxMbgSgwPPDelSessRspTx, jnxMbgSgwIfV2NumMsgRx=jnxMbgSgwIfV2NumMsgRx, jnxMbgSgwIfBrResCmdRx=jnxMbgSgwIfBrResCmdRx, jnxMbgSgwPPGtpV2ICsAllDynAdOcTx=jnxMbgSgwPPGtpV2ICsAllDynAdOcTx, jnxMbgSgwIfV2VerNotSupRx=jnxMbgSgwIfV2VerNotSupRx, jnxMbgSgwPPGtpV2ICsPageTx=jnxMbgSgwPPGtpV2ICsPageTx, jnxMbgSgwPPGtpV2ICsSemErTADTx=jnxMbgSgwPPGtpV2ICsSemErTADTx, jnxMbgSgwPPResumeAckRx=jnxMbgSgwPPResumeAckRx, jnxMbgSgwGtpV2ICsPTNotSuppTx=jnxMbgSgwGtpV2ICsPTNotSuppTx, jnxMbgSgwGtpV2ICsSysFailRx=jnxMbgSgwGtpV2ICsSysFailRx, jnxMbgSgwPPUnknMsgRx=jnxMbgSgwPPUnknMsgRx, jnxMbgSgwGtpV2ICsNOTFTUECTXTx=jnxMbgSgwGtpV2ICsNOTFTUECTXTx, jnxMbgSgwPPDelBrReqRx=jnxMbgSgwPPDelBrReqRx, jnxMbgSgwGtpV2ICsManIEMissRx=jnxMbgSgwGtpV2ICsManIEMissRx, jnxMbgSgwDelIndTunReqRx=jnxMbgSgwDelIndTunReqRx, jnxMbgSgwGtpV2ICsReqAcceptRx=jnxMbgSgwGtpV2ICsReqAcceptRx, jnxMbgSgwPPUpdBrRspRx=jnxMbgSgwPPUpdBrRspRx, jnxMbgSgwIfGtpV2ICsMisUnknAPNTx=jnxMbgSgwIfGtpV2ICsMisUnknAPNTx, jnxMbgSgwPPGtpV1ErrIndRx=jnxMbgSgwPPGtpV1ErrIndRx, jnxMbgSgwGtpPeerName=jnxMbgSgwGtpPeerName, jnxMbgSgwDelBrReqTx=jnxMbgSgwDelBrReqTx, jnxMbgSgwIfGtpV2ICsManIEIncorTx=jnxMbgSgwIfGtpV2ICsManIEIncorTx, jnxMbgSgwIfGtpV2ICsSemErTADRx=jnxMbgSgwIfGtpV2ICsSemErTADRx, jnxMbgSgwIfGtpV2ICsDenINRatRx=jnxMbgSgwIfGtpV2ICsDenINRatRx, jnxMbgSgwIfUpdBrRspRx=jnxMbgSgwIfUpdBrRspRx, jnxMbgSgwPPCrtBrReqRx=jnxMbgSgwPPCrtBrReqRx, jnxMbgSgwGtpV2ICsTFTSysErrTx=jnxMbgSgwGtpV2ICsTFTSysErrTx, jnxMbgSgwIfPcktLenErrRx=jnxMbgSgwIfPcktLenErrRx, jnxMbgSgwIfGtpV2ICsRelocFailTx=jnxMbgSgwIfGtpV2ICsRelocFailTx, jnxMbgSgwIfGtpV2ICsReqAcceptTx=jnxMbgSgwIfGtpV2ICsReqAcceptTx, jnxMbgSgwPPPiggybackMsgRx=jnxMbgSgwPPPiggybackMsgRx, jnxMbgSgwDelSessRspTx=jnxMbgSgwDelSessRspTx, jnxMbgSgwPPDelBrReqTx=jnxMbgSgwPPDelBrReqTx, jnxMbgSgwGtpV2ICsTFTSMANTErRx=jnxMbgSgwGtpV2ICsTFTSMANTErRx, jnxMbgSgwPPGtpV2ICsUERefusesTx=jnxMbgSgwPPGtpV2ICsUERefusesTx, jnxMbgSgwGtpV2ICsNoResRx=jnxMbgSgwGtpV2ICsNoResRx, jnxMbgSgwIfDelBrReqRx=jnxMbgSgwIfDelBrReqRx, jnxMbgSgwGtpV2ICsRMValRcvRx=jnxMbgSgwGtpV2ICsRMValRcvRx, jnxMbgSgwGtpV2ICsUnabPageUERx=jnxMbgSgwGtpV2ICsUnabPageUERx, jnxMbgSgwIfGtpV2ICsNewPTNPrefTx=jnxMbgSgwIfGtpV2ICsNewPTNPrefTx, jnxMbgSgwPPBrResCmdTx=jnxMbgSgwPPBrResCmdTx, jnxMbgSgwIfDlDataNotifTx=jnxMbgSgwIfDlDataNotifTx, jnxMbgSgwPacketAllocFail=jnxMbgSgwPacketAllocFail, jnxMbgSgwPPGtpV2ICsSemErTADRx=jnxMbgSgwPPGtpV2ICsSemErTADRx, jnxMbgSgwPPDlDataNotiFlrIndTx=jnxMbgSgwPPDlDataNotiFlrIndTx, jnxMbgSgwIfUpdConnSetRspTx=jnxMbgSgwIfUpdConnSetRspTx, jnxMbgSgwGtpV2ICsIMSINotKnTx=jnxMbgSgwGtpV2ICsIMSINotKnTx, jnxMbgSgwGtpV2ICsSemErTADRx=jnxMbgSgwGtpV2ICsSemErTADRx, jnxMbgSgwPPGtpV2ICsLclDetRx=jnxMbgSgwPPGtpV2ICsLclDetRx, jnxMbgSgwIfUpdConnSetReqTx=jnxMbgSgwIfUpdConnSetReqTx, jnxMbgSgwIfPacketSendFail=jnxMbgSgwIfPacketSendFail, jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx=jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx, jnxMbgSgwIfGtpV2ICsAcceptPartTx=jnxMbgSgwIfGtpV2ICsAcceptPartTx, jnxMbgSgwPPUpdConnSetRspRx=jnxMbgSgwPPUpdConnSetRspRx, jnxMbgSgwDelIndTunRespRx=jnxMbgSgwDelIndTunRespRx, jnxMbgSgwPPSuspNotifTx=jnxMbgSgwPPSuspNotifTx, jnxMbgSgwIfUpdConnSetRspRx=jnxMbgSgwIfUpdConnSetRspRx, jnxMbgSgwGtpV2ICsInvMsgFmtRx=jnxMbgSgwGtpV2ICsInvMsgFmtRx, jnxMbgSgwIfGtpV2ICsAPNAcsDenTx=jnxMbgSgwIfGtpV2ICsAPNAcsDenTx, jnxMbgSgwDelBrFlrIndTx=jnxMbgSgwDelBrFlrIndTx, jnxMbgSgwIfIndex=jnxMbgSgwIfIndex, jnxMbgSgwGtpV1T3RespTmrExpRx=jnxMbgSgwGtpV1T3RespTmrExpRx, jnxMbgSgwPPCreateSessRspTx=jnxMbgSgwPPCreateSessRspTx, jnxMbgSgwPPDelBrCmdTx=jnxMbgSgwPPDelBrCmdTx, jnxMbgSgwIfStopPagingIndTx=jnxMbgSgwIfStopPagingIndTx, jnxMbgSgwPPGtpV2ICsRelocFailRx=jnxMbgSgwPPGtpV2ICsRelocFailRx, jnxMbgSgwPPGtpV2ICsInvMsgFmtTx=jnxMbgSgwPPGtpV2ICsInvMsgFmtTx, jnxMbgSgwIfGtpV2ICsDenINRatTx=jnxMbgSgwIfGtpV2ICsDenINRatTx, jnxMbgSgwPPGtpV2ICsISRDeactRx=jnxMbgSgwPPGtpV2ICsISRDeactRx, jnxMbgSgwPPBrResCmdRx=jnxMbgSgwPPBrResCmdRx, jnxMbgSgwPPGtpV2ICsNoResTx=jnxMbgSgwPPGtpV2ICsNoResTx, jnxMbgSgwPPGtpV2ICsAllDynAdOcRx=jnxMbgSgwPPGtpV2ICsAllDynAdOcRx, jnxMbgSgwIfGtpV2ICsDtForNtSupTx=jnxMbgSgwIfGtpV2ICsDtForNtSupTx, jnxMbgSgwIfV2NumMsgTx=jnxMbgSgwIfV2NumMsgTx, jnxMbgSgwIfGtpV2ICsInvLenTx=jnxMbgSgwIfGtpV2ICsInvLenTx, jnxMbgSgwDlDataNotiFlrIndTx=jnxMbgSgwDlDataNotiFlrIndTx, jnxMbgSgwIfGtpV2ICsRPrNtRspTx=jnxMbgSgwIfGtpV2ICsRPrNtRspTx, jnxMbgSgwGtpV2ICsDeniedINRatTx=jnxMbgSgwGtpV2ICsDeniedINRatTx, jnxMbgSgwGtpV2ICsProtoNtSupRx=jnxMbgSgwGtpV2ICsProtoNtSupRx, jnxMbgSgwPPModBrFlrIndRx=jnxMbgSgwPPModBrFlrIndRx, jnxMbgSgwV2VerNotSupRx=jnxMbgSgwV2VerNotSupRx, jnxMbgSgwPPGtpV1EndMarkerRx=jnxMbgSgwPPGtpV1EndMarkerRx, jnxMbgSgwGtpV2ICsISRDeactTx=jnxMbgSgwGtpV2ICsISRDeactTx, jnxMbgSgwGtpV2ICsServDeniedRx=jnxMbgSgwGtpV2ICsServDeniedRx, jnxMbgSgwIfDlDataNotiFlrIndTx=jnxMbgSgwIfDlDataNotiFlrIndTx, jnxMbgSgwCrIndTunReqTx=jnxMbgSgwCrIndTunReqTx, jnxMbgSgwGtpV2ICsUserAUTHFlTx=jnxMbgSgwGtpV2ICsUserAUTHFlTx, jnxMbgSgwPPV2NumBytesRx=jnxMbgSgwPPV2NumBytesRx, jnxMbgSgwS4PiggybackMsgRx=jnxMbgSgwS4PiggybackMsgRx, jnxMbgSgwIfDlDataAckTx=jnxMbgSgwIfDlDataAckTx, jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx=jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx, jnxMbgSgwGtpV2ICsISRDeactRx=jnxMbgSgwGtpV2ICsISRDeactRx, jnxMbgSgwIfDelSessReqTx=jnxMbgSgwIfDelSessReqTx, jnxMbgSgwIfRelAcsBrReqTx=jnxMbgSgwIfRelAcsBrReqTx, jnxMbgSgwDelSessRspRx=jnxMbgSgwDelSessRspRx, jnxMbgSgwPPModBrRspTx=jnxMbgSgwPPModBrRspTx, jnxMbgSgwIfV2EchoRespRx=jnxMbgSgwIfV2EchoRespRx, jnxMbgSgwBrResCmdRx=jnxMbgSgwBrResCmdRx, jnxMbgSgwPPGtpV2ICsAPNResTIncTx=jnxMbgSgwPPGtpV2ICsAPNResTIncTx, jnxMbgSgwPPGtpV2ICsInvTotLenRx=jnxMbgSgwPPGtpV2ICsInvTotLenRx, jnxMbgSgwGtpV2ICsUnPgUESusRx=jnxMbgSgwGtpV2ICsUnPgUESusRx, jnxMbgSgwIfGtpV2ICsOptIEIncorTx=jnxMbgSgwIfGtpV2ICsOptIEIncorTx, jnxMbgSgwGtpV2ICsCmpDetTx=jnxMbgSgwGtpV2ICsCmpDetTx, jnxMbgSgwModBrFlrIndRx=jnxMbgSgwModBrFlrIndRx, jnxMbgSgwIfGtpV2ICsRMValRcvTx=jnxMbgSgwIfGtpV2ICsRMValRcvTx, jnxMbgSgwGtpCPerPeerStatsTable=jnxMbgSgwGtpCPerPeerStatsTable, jnxMbgSgwGtpInterfaceType=jnxMbgSgwGtpInterfaceType, jnxMbgSgwPPGtpV2ICsServNotSupTx=jnxMbgSgwPPGtpV2ICsServNotSupTx, jnxMbgSgwPPBrResFlrIndRx=jnxMbgSgwPPBrResFlrIndRx, jnxMbgSgwIfGtpV2ICsCondIEMsRx=jnxMbgSgwIfGtpV2ICsCondIEMsRx, jnxMbgSgwIfGtpV2ICsAPNResTIncTx=jnxMbgSgwIfGtpV2ICsAPNResTIncTx, jnxMbgSgwIfGtpV2ICsISRDeactTx=jnxMbgSgwIfGtpV2ICsISRDeactTx, jnxMbgSgwUpdBrReqRx=jnxMbgSgwUpdBrReqRx, jnxMbgSgwV2EchoRespRx=jnxMbgSgwV2EchoRespRx, jnxMbgSgwIfGtpV2ICsUnabPageUETx=jnxMbgSgwIfGtpV2ICsUnabPageUETx, jnxMbgSgwV2NumBytesTx=jnxMbgSgwV2NumBytesTx, jnxMbgSgwIfBrResFlrIndTx=jnxMbgSgwIfBrResFlrIndTx, jnxMbgSgwPPCreateSessRspRx=jnxMbgSgwPPCreateSessRspRx, jnxMbgSgwPPGtpV2ICsReqAcceptTx=jnxMbgSgwPPGtpV2ICsReqAcceptTx, jnxMbgSgwIfGtpV2ICsVerNotSuppRx=jnxMbgSgwIfGtpV2ICsVerNotSuppRx, jnxMbgSgwPPGtpV2ICsReqRejTx=jnxMbgSgwPPGtpV2ICsReqRejTx, jnxMbgSgwIfT3RespTmrExpRx=jnxMbgSgwIfT3RespTmrExpRx, jnxMbgSgwPPUpdConnSetRspTx=jnxMbgSgwPPUpdConnSetRspTx, jnxMbgSgwPPGtpRmtAddr=jnxMbgSgwPPGtpRmtAddr, jnxMbgSgwGtpGlbStatsEntry=jnxMbgSgwGtpGlbStatsEntry, jnxMbgSgwGtpV2ICsEIFRNCEnRx=jnxMbgSgwGtpV2ICsEIFRNCEnRx, jnxMbgSgwIfCrIndTunRespRx=jnxMbgSgwIfCrIndTunRespRx, jnxMbgSgwGtpV2ICsRPrNtRspRx=jnxMbgSgwGtpV2ICsRPrNtRspRx, jnxMbgSgwPPGtpRtgInst=jnxMbgSgwPPGtpRtgInst)
| (integer, octet_string, object_identifier) = mibBuilder.importSymbols('ASN1', 'Integer', 'OctetString', 'ObjectIdentifier')
(named_values,) = mibBuilder.importSymbols('ASN1-ENUMERATION', 'NamedValues')
(constraints_intersection, value_size_constraint, single_value_constraint, value_range_constraint, constraints_union) = mibBuilder.importSymbols('ASN1-REFINEMENT', 'ConstraintsIntersection', 'ValueSizeConstraint', 'SingleValueConstraint', 'ValueRangeConstraint', 'ConstraintsUnion')
(inet_address_prefix_length, inet_port_number, inet_address, inet_address_type) = mibBuilder.importSymbols('INET-ADDRESS-MIB', 'InetAddressPrefixLength', 'InetPortNumber', 'InetAddress', 'InetAddressType')
(ipv6_address_if_identifier, ipv6_address_prefix, ipv6_address) = mibBuilder.importSymbols('IPV6-TC', 'Ipv6AddressIfIdentifier', 'Ipv6AddressPrefix', 'Ipv6Address')
(jnx_mobile_gateway_sgw,) = mibBuilder.importSymbols('JUNIPER-MBG-SMI', 'jnxMobileGatewaySgw')
(enabled_status,) = mibBuilder.importSymbols('JUNIPER-MIMSTP-MIB', 'EnabledStatus')
(jnx_mbg_gw_name, jnx_mbg_gw_index) = mibBuilder.importSymbols('JUNIPER-MOBILE-GATEWAYS', 'jnxMbgGwName', 'jnxMbgGwIndex')
(module_compliance, notification_group) = mibBuilder.importSymbols('SNMPv2-CONF', 'ModuleCompliance', 'NotificationGroup')
(module_identity, mib_scalar, mib_table, mib_table_row, mib_table_column, counter32, counter64, bits, time_ticks, integer32, iso, object_identity, mib_identifier, unsigned32, gauge32, ip_address, notification_type) = mibBuilder.importSymbols('SNMPv2-SMI', 'ModuleIdentity', 'MibScalar', 'MibTable', 'MibTableRow', 'MibTableColumn', 'Counter32', 'Counter64', 'Bits', 'TimeTicks', 'Integer32', 'iso', 'ObjectIdentity', 'MibIdentifier', 'Unsigned32', 'Gauge32', 'IpAddress', 'NotificationType')
(textual_convention, row_status, truth_value, display_string) = mibBuilder.importSymbols('SNMPv2-TC', 'TextualConvention', 'RowStatus', 'TruthValue', 'DisplayString')
jnx_mbg_sgw_gtp_mib = module_identity((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2))
jnxMbgSgwGtpMib.setRevisions(('2011-09-21 12:00',))
if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0):
if mibBuilder.loadTexts:
jnxMbgSgwGtpMib.setRevisionsDescriptions(('Initial version',))
if mibBuilder.loadTexts:
jnxMbgSgwGtpMib.setLastUpdated('201109211200Z')
if mibBuilder.loadTexts:
jnxMbgSgwGtpMib.setOrganization('Juniper Networks, Inc.')
if mibBuilder.loadTexts:
jnxMbgSgwGtpMib.setContactInfo('Juniper Technical Assistance Center Juniper Networks, Inc. 1194 N. Mathilda Avenue Sunnyvale, CA 94089 E-mail: [email protected]')
if mibBuilder.loadTexts:
jnxMbgSgwGtpMib.setDescription('This module defines some sample objects pertaining to GTP protocol.')
jnx_mbg_sgw_gtp_notifications = mib_identifier((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0))
jnx_mbg_sgw_gtp_objects = mib_identifier((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1))
jnx_mbg_sgw_gtp_c_glb_stats_table = mib_table((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2))
if mibBuilder.loadTexts:
jnxMbgSgwGtpCGlbStatsTable.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpCGlbStatsTable.setDescription('Each entry corresponds to a gateway level GTP Control statistic.')
jnx_mbg_sgw_gtp_glb_stats_entry = mib_table_row((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1)).setIndexNames((0, 'JUNIPER-MOBILE-GATEWAYS', 'jnxMbgGwIndex'))
if mibBuilder.loadTexts:
jnxMbgSgwGtpGlbStatsEntry.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpGlbStatsEntry.setDescription('A specification of the GTP gateway level control Statistics.')
jnx_mbg_sgw_rx_packets_dropped = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 1), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwRxPacketsDropped.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwRxPacketsDropped.setDescription('Number of Received Packets Dropped.')
jnx_mbg_sgw_packet_alloc_fail = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 2), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPacketAllocFail.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPacketAllocFail.setDescription('Number of Packet allocation failures.')
jnx_mbg_sgw_packet_send_fail = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 3), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPacketSendFail.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPacketSendFail.setDescription('Number of Packet Send failures.')
jnx_mbg_sgw_ip_ver_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 4), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIPVerErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIPVerErrRx.setDescription('Number of IP Version Error Packets Received.')
jnx_mbg_sgw_ip_proto_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 5), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIPProtoErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIPProtoErrRx.setDescription('Number of IP protocol Error packets Received.')
jnx_mbg_sgw_gtp_port_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 6), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGTPPortErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGTPPortErrRx.setDescription('Number of Port Error Packets Received.')
jnx_mbg_sgw_gtp_unkn_ver_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 7), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGTPUnknVerRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGTPUnknVerRx.setDescription('Number of Unknown Version Packets Received.')
jnx_mbg_sgw_pckt_len_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 8), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPcktLenErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPcktLenErrRx.setDescription('Number of Packet Length Error Packets Received.')
jnx_mbg_sgw_unkn_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 9), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUnknMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUnknMsgRx.setDescription('Number of Unknown Messages Received.')
jnx_mbg_sgw_protocol_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 10), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwProtocolErrRx.setDescription('Number of GTPv2 Protocol Errors Received.')
jnx_mbg_sgw_un_supported_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 11), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUnSupportedMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUnSupportedMsgRx.setDescription('Number of GTPv2 Unsupported Messages received.')
jnx_mbg_sgw_t3_resp_tmr_exp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 12), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwT3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwT3RespTmrExpRx.setDescription('Number of GTP V2 T3 timer expiries Received.')
jnx_mbg_sgw_v2_num_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 13), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumMsgRx.setDescription('Number of GTPv2 messages received.')
jnx_mbg_sgw_v2_num_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 14), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumMsgTx.setDescription('Number of V2 messages sent.')
jnx_mbg_sgw_v2_num_bytes_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 15), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumBytesRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumBytesRx.setDescription('Number of GTPv2 bytes received.')
jnx_mbg_sgw_v2_num_bytes_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 16), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumBytesTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2NumBytesTx.setDescription('Number of V2 bytes sent.')
jnx_mbg_sgw_v2_echo_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 19), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoReqRx.setDescription('Number of GTP V2 Echo Request received.')
jnx_mbg_sgw_v2_echo_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 20), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoReqTx.setDescription('Number of GTP V2 Echo Request Sent.')
jnx_mbg_sgw_v2_echo_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 21), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoRespRx.setDescription('Number of GTP V2 Echo Response received.')
jnx_mbg_sgw_v2_echo_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 22), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2EchoRespTx.setDescription('Number of GTP V2 Echo Response Sent.')
jnx_mbg_sgw_v2_ver_not_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 23), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2VerNotSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2VerNotSupRx.setDescription('Number of GTP V2 Version Not supported messages received')
jnx_mbg_sgw_v2_ver_not_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 24), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwV2VerNotSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwV2VerNotSupTx.setDescription('Number of GTP V2 version not supported messages sent.')
jnx_mbg_sgw_create_sess_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 25), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessReqRx.setDescription('Number of GTP V2 Create Session Requests received.')
jnx_mbg_sgw_create_sess_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 26), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessReqTx.setDescription('Number of GTP V2 Create Session Requests Sent.')
jnx_mbg_sgw_create_sess_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 27), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessRspRx.setDescription('Number of GTP V2 Create Session Responses received.')
jnx_mbg_sgw_create_sess_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 28), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCreateSessRspTx.setDescription('Number of GTP V2 Create Session Responses Sent.')
jnx_mbg_sgw_mod_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 29), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrReqRx.setDescription('Number of GTP V2 Modify Bearer Requests received.')
jnx_mbg_sgw_mod_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 30), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrReqTx.setDescription('Number of GTP V2 Modify Bearer Requests Sent.')
jnx_mbg_sgw_mod_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 31), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrRspRx.setDescription('Number of GTP V2 Modify Bearer Responses received.')
jnx_mbg_sgw_mod_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 32), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrRspTx.setDescription('Number of GTP V2 Modify Bearer Responses Sent.')
jnx_mbg_sgw_del_sess_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 33), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessReqRx.setDescription('Number of GTP V2 Delete Session Requests received.')
jnx_mbg_sgw_del_sess_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 34), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessReqTx.setDescription('Number of GTP V2 Delete Session Requests Sent.')
jnx_mbg_sgw_del_sess_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 35), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessRspRx.setDescription('Number of GTP V2 Delete Session Responses received.')
jnx_mbg_sgw_del_sess_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 36), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelSessRspTx.setDescription('Number of GTP V2 Delete Session Responses Sent.')
jnx_mbg_sgw_crt_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 37), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrReqRx.setDescription('Number of GTP V2 Create Bearer Requests received.')
jnx_mbg_sgw_crt_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 38), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrReqTx.setDescription('Number of GTP V2 Create Bearer Requests Sent.')
jnx_mbg_sgw_crt_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 39), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrRspRx.setDescription('Number of GTP V2 Create Bearer Response received.')
jnx_mbg_sgw_crt_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 40), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrtBrRspTx.setDescription('Number of GTP V2 Create Bearer Response Sent.')
jnx_mbg_sgw_upd_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 41), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrReqRx.setDescription('Number of GTP V2 Update Bearer Request received.')
jnx_mbg_sgw_upd_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 42), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrReqTx.setDescription('Number of GTP V2 Update Bearer Request Sent.')
jnx_mbg_sgw_upd_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 43), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrRspRx.setDescription('Number of GTP V2 Update Bearer Response received.')
jnx_mbg_sgw_upd_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 44), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdBrRspTx.setDescription('Number of GTP V2 Update Bearer Response Sent.')
jnx_mbg_sgw_del_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 45), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrReqRx.setDescription('Number of GTP V2 Delete Bearer Request received.')
jnx_mbg_sgw_del_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 46), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrReqTx.setDescription('Number of GTP V2 Delete Bearer Request Sent.')
jnx_mbg_sgw_del_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 47), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrRspRx.setDescription('Number of GTP V2 Delete Bearer Response received.')
jnx_mbg_sgw_del_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 48), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrRspTx.setDescription('Number of GTP V2 Delete Bearer Response Sent.')
jnx_mbg_sgw_del_conn_set_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 49), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetReqRx.setDescription('Number of GTP V2 Delete PDN connection set Request received.')
jnx_mbg_sgw_del_conn_set_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 50), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetReqTx.setDescription('Number of GTP V2 Delete PDN connection set Request Sent.')
jnx_mbg_sgw_del_conn_set_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 51), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetRspRx.setDescription('Number of GTP V2 Delete PDN connection set Response received.')
jnx_mbg_sgw_del_conn_set_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 52), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelConnSetRspTx.setDescription('Number of GTP V2 Delete PDN connection set Response Sent.')
jnx_mbg_sgw_upd_conn_set_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 53), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetReqRx.setDescription('Number of GTP V2 Update Connection set Request received.')
jnx_mbg_sgw_upd_conn_set_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 54), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetReqTx.setDescription('Number of GTP V2 Update Connection set Request Sent.')
jnx_mbg_sgw_upd_conn_set_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 55), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetRspRx.setDescription('Number of GTP V2 Update Connection set Response received.')
jnx_mbg_sgw_upd_conn_set_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 56), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwUpdConnSetRspTx.setDescription('Number of GTP V2 Update Connection set Response Sent.')
jnx_mbg_sgw_mod_br_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 57), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrCmdRx.setDescription('Number of GTP V2 Modify Bearer Command received.')
jnx_mbg_sgw_mod_br_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 58), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrCmdTx.setDescription('Number of GTP V2 Modify Bearer Command Sent.')
jnx_mbg_sgw_mod_br_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 59), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrFlrIndRx.setDescription('Number of GTP V2 Modify Bearer Failure received.')
jnx_mbg_sgw_mod_br_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 60), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwModBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwModBrFlrIndTx.setDescription('Number of GTP V2 Modify Bearer Failure Sent.')
jnx_mbg_sgw_del_br_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 61), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrCmdRx.setDescription('Number of GTP V2 Delete Bearer Command received.')
jnx_mbg_sgw_del_br_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 62), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrCmdTx.setDescription('Number of GTP V2 Delete Bearer Command Sent.')
jnx_mbg_sgw_del_br_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 63), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrFlrIndRx.setDescription('Number of GTP V2 Delete Bearer Failure received.')
jnx_mbg_sgw_del_br_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 64), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelBrFlrIndTx.setDescription('Number of GTP V2 Delete Bearer Failure Sent.')
jnx_mbg_sgw_br_res_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 65), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwBrResCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwBrResCmdRx.setDescription('Number of GTP V2 Bearer Response Command received.')
jnx_mbg_sgw_br_res_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 66), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwBrResCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwBrResCmdTx.setDescription('Number of GTP V2 Bearer Response Command Sent.')
jnx_mbg_sgw_br_res_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 67), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwBrResFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwBrResFlrIndRx.setDescription('Number of GTP V2 Bearer Resource Failure received.')
jnx_mbg_sgw_br_res_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 68), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwBrResFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwBrResFlrIndTx.setDescription('Number of GTP V2 Bearer Resource Failure Sent.')
jnx_mbg_sgw_rel_acs_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 69), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrReqRx.setDescription('Number of GTP V2 Release Access Bearer Requests received.')
jnx_mbg_sgw_rel_acs_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 70), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrReqTx.setDescription('Number of GTP V2 Release Access Bearer Requests sent.')
jnx_mbg_sgw_rel_acs_br_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 71), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrRespRx.setDescription('Number of GTP V2 Release Access Bearer Response received.')
jnx_mbg_sgw_rel_acs_br_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 72), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwRelAcsBrRespTx.setDescription('Number of GTP V2 Release Access Bearer Response sent.')
jnx_mbg_sgw_cr_ind_tun_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 73), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunReqRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request Received')
jnx_mbg_sgw_cr_ind_tun_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 74), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunReqTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request sent')
jnx_mbg_sgw_cr_ind_tun_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 75), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunRespRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response Received')
jnx_mbg_sgw_cr_ind_tun_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 76), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwCrIndTunRespTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response sent')
jnx_mbg_sgw_del_ind_tun_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 77), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunReqRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request Received')
jnx_mbg_sgw_del_ind_tun_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 78), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunReqTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request sent.')
jnx_mbg_sgw_del_ind_tun_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 79), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunRespRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response Received')
jnx_mbg_sgw_del_ind_tun_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 80), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDelIndTunRespTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response sent.')
jnx_mbg_sgw_dl_data_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 81), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotifRx.setDescription('Number of GTP V2 Downlink Data Notify received.')
jnx_mbg_sgw_dl_data_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 82), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotifTx.setDescription('Number of GTP V2 Downlink Data Notify Sent.')
jnx_mbg_sgw_dl_data_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 83), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataAckRx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement received.')
jnx_mbg_sgw_dl_data_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 84), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataAckTx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement Sent.')
jnx_mbg_sgw_dl_data_noti_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 85), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotiFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotiFlrIndRx.setDescription('Number of GTP V2 Downlink Data Notification fail received.')
jnx_mbg_sgw_dl_data_noti_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 86), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotiFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwDlDataNotiFlrIndTx.setDescription('Number of GTP V2 Downlink Data Notification fail Sent.')
jnx_mbg_sgw_stop_paging_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 87), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwStopPagingIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwStopPagingIndRx.setDescription('Number of GTP V2 Number of Stop Paging Indication Messages Received.')
jnx_mbg_sgw_stop_paging_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 88), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwStopPagingIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwStopPagingIndTx.setDescription('Number of GTP V2 Number of Stop Paging Indicaton messages sent')
jnx_mbg_sgw_gtp_v2_i_cs_page_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 89), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPageRx.setStatus('obsolete')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPageRx.setDescription('Number of GTPV2 packets received with cause Page.')
jnx_mbg_sgw_gtp_v2_i_cs_page_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 90), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPageTx.setStatus('obsolete')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPageTx.setDescription('Number of GTP packets sent with cause Page.')
jnx_mbg_sgw_gtp_v2_i_cs_req_accept_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 91), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqAcceptRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqAcceptRx.setDescription('Number of GTPV2 packets received with cause Request Accept.')
jnx_mbg_sgw_gtp_v2_i_cs_req_accept_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 92), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqAcceptTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqAcceptTx.setDescription('Number of GTP packets sent with cause Request Accept.')
jnx_mbg_sgw_gtp_v2_i_cs_accept_part_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 93), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAcceptPartRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAcceptPartRx.setDescription('Number of GTPV2 packets received with cause Accept Partial.')
jnx_mbg_sgw_gtp_v2_i_cs_accept_part_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 94), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAcceptPartTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAcceptPartTx.setDescription('Number of GTP packets sent with cause Accept Partial.')
jnx_mbg_sgw_gtp_v2_i_cs_new_ptn_pref_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 95), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTNPrefRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTNPrefRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Network Preference.')
jnx_mbg_sgw_gtp_v2_i_cs_new_ptn_pref_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 96), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTNPrefTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTNPrefTx.setDescription('Number of GTP packets sent with cause New PDN type due to Network Preference')
jnx_mbg_sgw_gtp_v2_i_cs_new_ptsi_adbr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 97), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTSIAdbrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTSIAdbrRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Single Address Bearer.')
jnx_mbg_sgw_gtp_v2_i_cs_new_ptsi_adbr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 98), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTSIAdbrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNewPTSIAdbrTx.setDescription('Number of GTP packets sent with cause New PDN type due to Single Address Bearer.')
jnx_mbg_sgw_gtp_v2_i_cs_ctx_not_fnd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 99), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCtxNotFndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCtxNotFndRx.setDescription('Number of GTPV2 packets received with cause Context not found.')
jnx_mbg_sgw_gtp_v2_i_cs_ctx_not_fnd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 100), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCtxNotFndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCtxNotFndTx.setDescription('Number of GTP packets sent with cause Context not found.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_msg_fmt_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 101), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvMsgFmtRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvMsgFmtRx.setDescription('Number of GTPV2 packets received with cause Invalid Message Format.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_msg_fmt_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 102), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvMsgFmtTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvMsgFmtTx.setDescription('Number of GTP packets sent with cause Invalid Message Format.')
jnx_mbg_sgw_gtp_v2_i_cs_ver_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 103), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsVerNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsVerNotSuppRx.setDescription('Number of GTPV2 packets received with cause Version not Supported.')
jnx_mbg_sgw_gtp_v2_i_cs_ver_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 104), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsVerNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsVerNotSuppTx.setDescription('Number of GTP packets sent with cause Version not Supported.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_len_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 105), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvLenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvLenRx.setDescription('Number of GTPV2 packets received with cause Invalid Length.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_len_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 106), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvLenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvLenTx.setDescription('Number of GTP packets sent with cause Invalid Length.')
jnx_mbg_sgw_gtp_v2_i_cs_serv_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 107), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServNotSuppRx.setDescription('Number of GTPV2 packets received with cause Service Not supported.')
jnx_mbg_sgw_gtp_v2_i_cs_serv_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 108), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServNotSuppTx.setDescription('Number of GTP packets sent with cause Service Not supported.')
jnx_mbg_sgw_gtp_v2_i_cs_man_ie_incorr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 109), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEIncorrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEIncorrRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE incorrect.')
jnx_mbg_sgw_gtp_v2_i_cs_man_ie_incorr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 110), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEIncorrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEIncorrTx.setDescription('Number of GTP packets sent with cause Mandatory IE incorrect.')
jnx_mbg_sgw_gtp_v2_i_cs_man_ie_miss_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 111), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEMissRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEMissRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE Missing.')
jnx_mbg_sgw_gtp_v2_i_cs_man_ie_miss_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 112), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEMissTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsManIEMissTx.setDescription('Number of GTP packets sent with cause Mandatory IE Missing.')
jnx_mbg_sgw_gtp_v2_i_cs_opt_ie_incorr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 113), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsOptIEIncorrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsOptIEIncorrRx.setDescription('Number of GTPV2 packets received with cause Optional IE Incorrect.')
jnx_mbg_sgw_gtp_v2_i_cs_opt_ie_incorr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 114), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsOptIEIncorrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsOptIEIncorrTx.setDescription('Number of GTP packets sent with cause Optional IE Incorrect.')
jnx_mbg_sgw_gtp_v2_i_cs_sys_fail_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 115), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSysFailRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSysFailRx.setDescription('Number of GTPV2 packets received with cause System Failure.')
jnx_mbg_sgw_gtp_v2_i_cs_sys_fail_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 116), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSysFailTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSysFailTx.setDescription('Number of GTP packets sent with cause System Failure.')
jnx_mbg_sgw_gtp_v2_i_cs_no_res_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 117), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoResRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoResRx.setDescription('Number of GTPV2 packets received with cause No Resource.')
jnx_mbg_sgw_gtp_v2_i_cs_no_res_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 118), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoResTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoResTx.setDescription('Number of GTP packets sent with cause No Resource.')
jnx_mbg_sgw_gtp_v2_i_cs_tftsmant_er_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 119), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSMANTErRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSMANTErRx.setDescription('Number of GTPV2 packets received with cause TFT Symantic Error.')
jnx_mbg_sgw_gtp_v2_i_cs_tftsmant_er_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 120), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSMANTErTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSMANTErTx.setDescription('Number of GTP packets sent with cause TFT Symantic Error.')
jnx_mbg_sgw_gtp_v2_i_cs_tft_sys_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 121), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSysErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSysErrRx.setDescription('Number of GTPV2 packets received with cause TFT System Error.')
jnx_mbg_sgw_gtp_v2_i_cs_tft_sys_err_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 122), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSysErrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsTFTSysErrTx.setDescription('Number of GTP packets sent with cause TFT System Error.')
jnx_mbg_sgw_gtp_v2_i_cs_pk_flt_man_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 123), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltManErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltManErrRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Symantic Error.')
jnx_mbg_sgw_gtp_v2_i_cs_pk_flt_man_err_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 124), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltManErrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltManErrTx.setDescription('Number of GTP packets sent with cause Packet Filter Symantic Error.')
jnx_mbg_sgw_gtp_v2_i_cs_pk_flt_syn_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 125), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltSynErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltSynErrRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Syntax Error.')
jnx_mbg_sgw_gtp_v2_i_cs_pk_flt_syn_err_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 126), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltSynErrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPkFltSynErrTx.setDescription('Number of GTP packets sent with cause Packet Filter Syntax Error.')
jnx_mbg_sgw_gtp_v2_i_cs_mis_unkn_apn_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 127), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsMisUnknAPNRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsMisUnknAPNRx.setDescription('Number of GTPV2 packets received with cause Unknown APN.')
jnx_mbg_sgw_gtp_v2_i_cs_mis_unkn_apn_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 128), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsMisUnknAPNTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsMisUnknAPNTx.setDescription('Number of GTP packets sent with cause Unknown APN.')
jnx_mbg_sgw_gtp_v2_i_cs_unexp_rpt_ie_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 129), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnexpRptIERx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnexpRptIERx.setDescription('Number of GTPV2 packets received with cause Unexpected Repeated IE.')
jnx_mbg_sgw_gtp_v2_i_cs_unexp_rpt_ie_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 130), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnexpRptIETx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnexpRptIETx.setDescription('Number of GTP packets sent with cause Unexpected Repeated IE.')
jnx_mbg_sgw_gtp_v2_i_cs_gre_key_nt_fd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 131), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsGREKeyNtFdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsGREKeyNtFdRx.setDescription('Number of GTPV2 packets received with cause GRE Key Not Found.')
jnx_mbg_sgw_gtp_v2_i_cs_gre_key_nt_fd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 132), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsGREKeyNtFdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsGREKeyNtFdTx.setDescription('Number of GTP packets sent with cause GRE Key Not Found.')
jnx_mbg_sgw_gtp_v2_i_cs_reloc_fail_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 133), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRelocFailRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRelocFailRx.setDescription('Number of GTPV2 packets received with cause Relocation Failed.')
jnx_mbg_sgw_gtp_v2_i_cs_reloc_fail_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 134), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRelocFailTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRelocFailTx.setDescription('Number of GTP packets sent with cause Relocation Failed.')
jnx_mbg_sgw_gtp_v2_i_cs_denied_in_rat_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 135), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDeniedINRatRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDeniedINRatRx.setDescription('Number of GTPV2 packets received with cause Denied in RAT.')
jnx_mbg_sgw_gtp_v2_i_cs_denied_in_rat_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 136), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDeniedINRatTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDeniedINRatTx.setDescription('Number of GTP packets sent with cause Denied in RAT.')
jnx_mbg_sgw_gtp_v2_i_cs_pt_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 137), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTNotSuppRx.setDescription('Number of GTPV2 packets received with cause PDN Type Not Supported.')
jnx_mbg_sgw_gtp_v2_i_cs_pt_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 138), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTNotSuppTx.setDescription('Number of GTP packets sent with cause PDN Type Not Supported.')
jnx_mbg_sgw_gtp_v2_i_cs_all_dyn_ad_occ_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 139), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAllDynAdOccRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAllDynAdOccRx.setDescription('Number of GTPV2 packets received with cause Allocated Dynamic Address Occupied.')
jnx_mbg_sgw_gtp_v2_i_cs_all_dyn_ad_occ_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 140), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAllDynAdOccTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAllDynAdOccTx.setDescription('Number of GTP packets sent with cause Allocated Dynamic Address Occupied.')
jnx_mbg_sgw_gtp_v2_i_cs_notftuectx_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 141), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNOTFTUECTXRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNOTFTUECTXRx.setDescription('Number of GTPV2 packets received with cause UE Context Without TFT Exists.')
jnx_mbg_sgw_gtp_v2_i_cs_notftuectx_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 142), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNOTFTUECTXTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNOTFTUECTXTx.setDescription('Number of GTP packets sent with cause UE Context Without TFT Exists.')
jnx_mbg_sgw_gtp_v2_i_cs_proto_nt_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 143), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsProtoNtSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsProtoNtSupRx.setDescription('Number of GTPV2 packets received with cause Protocol Not Supported.')
jnx_mbg_sgw_gtp_v2_i_cs_proto_nt_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 144), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsProtoNtSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsProtoNtSupTx.setDescription('Number of GTP packets sent with cause Protocol Not Supported.')
jnx_mbg_sgw_gtp_v2_i_cs_ue_not_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 145), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUENotRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUENotRespRx.setDescription('Number of GTPV2 packets received with cause UE Not Responding.')
jnx_mbg_sgw_gtp_v2_i_cs_ue_not_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 146), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUENotRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUENotRespTx.setDescription('Number of GTP packets sent with cause UE Not Responding.')
jnx_mbg_sgw_gtp_v2_i_cs_ue_refuses_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 147), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUERefusesRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUERefusesRx.setDescription('Number of GTPV2 packets received with cause UE Refuses.')
jnx_mbg_sgw_gtp_v2_i_cs_ue_refuses_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 148), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUERefusesTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUERefusesTx.setDescription('Number of GTP packets sent with cause UE Refuses.')
jnx_mbg_sgw_gtp_v2_i_cs_serv_denied_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 149), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServDeniedRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServDeniedRx.setDescription('Number of GTPV2 packets received with cause Service Denied.')
jnx_mbg_sgw_gtp_v2_i_cs_serv_denied_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 150), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServDeniedTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsServDeniedTx.setDescription('Number of GTP packets sent with cause Service Denied.')
jnx_mbg_sgw_gtp_v2_i_cs_unab_page_ue_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 151), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnabPageUERx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnabPageUERx.setDescription('Number of GTPV2 packets received with cause Unable to Page UE.')
jnx_mbg_sgw_gtp_v2_i_cs_unab_page_ue_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 152), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnabPageUETx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnabPageUETx.setDescription('Number of GTP packets sent with cause Unable to Page UE.')
jnx_mbg_sgw_gtp_v2_i_cs_no_mem_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 153), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoMemRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoMemRx.setDescription('Number of GTPV2 packets received with cause No Memory.')
jnx_mbg_sgw_gtp_v2_i_cs_no_mem_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 154), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoMemTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsNoMemTx.setDescription('Number of GTP packets sent with cause No Memory.')
jnx_mbg_sgw_gtp_v2_i_cs_user_auth_fl_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 155), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUserAUTHFlRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUserAUTHFlRx.setDescription('Number of GTPV2 packets received with cause User AUTH Failed.')
jnx_mbg_sgw_gtp_v2_i_cs_user_auth_fl_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 156), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUserAUTHFlTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUserAUTHFlTx.setDescription('Number of GTP packets sent with cause User AUTH Failed.')
jnx_mbg_sgw_gtp_v2_i_cs_apn_acs_den_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 157), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNAcsDenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNAcsDenRx.setDescription('Number of GTPV2 packets received with cause APN Access Denied.')
jnx_mbg_sgw_gtp_v2_i_cs_apn_acs_den_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 158), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNAcsDenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNAcsDenTx.setDescription('Number of GTP packets sent with cause APN Access Denied.')
jnx_mbg_sgw_gtp_v2_i_cs_req_rej_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 159), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqRejRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqRejRx.setDescription('Number of GTPV2 packets received with cause Request Rejected.')
jnx_mbg_sgw_gtp_v2_i_cs_req_rej_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 160), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqRejTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsReqRejTx.setDescription('Number of GTP packets sent with cause Request Rejected.')
jnx_mbg_sgw_gtp_v2_i_cs_ptmsi_sig_mm_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 161), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTMSISigMMRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTMSISigMMRx.setDescription('Number of GTPV2 packets received with cause P-TMSI Signature Mismatch.')
jnx_mbg_sgw_gtp_v2_i_cs_ptmsi_sig_mm_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 162), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTMSISigMMTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsPTMSISigMMTx.setDescription('Number of GTP packets sent with cause P-TMSI Signature Mismatch')
jnx_mbg_sgw_gtp_v2_i_cs_imsi_not_kn_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 163), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsIMSINotKnRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsIMSINotKnRx.setDescription('Number of GTPV2 packets received with cause IMSI Not Known.')
jnx_mbg_sgw_gtp_v2_i_cs_imsi_not_kn_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 164), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsIMSINotKnTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsIMSINotKnTx.setDescription('Number of GTP packets sent with cause IMSI Not Known.')
jnx_mbg_sgw_gtp_v2_i_cs_cond_ie_ms_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 165), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCondIEMsRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCondIEMsRx.setDescription('Number of GTPV2 packets received with cause Conditional IE Missing.')
jnx_mbg_sgw_gtp_v2_i_cs_cond_ie_ms_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 166), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCondIEMsTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCondIEMsTx.setDescription('Number of GTP packets sent with cause Conditional IE Missing.')
jnx_mbg_sgw_gtp_v2_i_cs_apn_res_t_inc_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 167), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNResTIncRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNResTIncRx.setDescription('Number of GTPV2 packets received with cause APN Restriction Type Incompatible.')
jnx_mbg_sgw_gtp_v2_i_cs_apn_res_t_inc_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 168), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNResTIncTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsAPNResTIncTx.setDescription('Number of GTP packets sent with cause APN Restriction Type Incompatible.')
jnx_mbg_sgw_gtp_v2_i_cs_unknown_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 169), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnknownRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnknownRx.setDescription('Number of GTPV2 packets received with cause Unknown.')
jnx_mbg_sgw_gtp_v2_i_cs_unknown_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 170), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnknownTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnknownTx.setDescription('Number of GTP packets sent with cause Unknown.')
jnx_mbg_sgw_gtp_v2_i_cs_lcl_det_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 171), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsLclDetRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsLclDetRx.setDescription('Number of GTP packets received with cause Local Detach.')
jnx_mbg_sgw_gtp_v2_i_cs_lcl_det_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 172), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsLclDetTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsLclDetTx.setDescription('Number of GTP packets sent with cause Local Detach.')
jnx_mbg_sgw_gtp_v2_i_cs_cmp_det_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 173), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCmpDetRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCmpDetRx.setDescription('Number of GTP packets received with cause Complete Detach.')
jnx_mbg_sgw_gtp_v2_i_cs_cmp_det_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 174), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCmpDetTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsCmpDetTx.setDescription('Number of GTP packets sent with cause Complete Detach.')
jnx_mbg_sgw_gtp_v2_i_cs_rat_chg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 175), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRATChgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRATChgRx.setDescription('Number of GTP packets received with cause RAT changed from 3GPP to non 3GPP.')
jnx_mbg_sgw_gtp_v2_i_cs_rat_chg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 176), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRATChgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRATChgTx.setDescription('Number of GTP packets sent with cause RAT changed from 3GPP to non 3GPP.')
jnx_mbg_sgw_gtp_v2_i_cs_isr_deact_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 177), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsISRDeactRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsISRDeactRx.setDescription('Number of GTP packets received with cause ISR Deactivated.')
jnx_mbg_sgw_gtp_v2_i_cs_isr_deact_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 178), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsISRDeactTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsISRDeactTx.setDescription('Number of GTP packets sent with cause ISR Deactivated.')
jnx_mbg_sgw_gtp_v2_i_cs_eifrnc_en_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 179), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsEIFRNCEnRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsEIFRNCEnRx.setDescription('Number of GTP packets received with cause Error Indication from RNC eNodeB.')
jnx_mbg_sgw_gtp_v2_i_cs_eifrnc_en_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 180), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsEIFRNCEnTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsEIFRNCEnTx.setDescription('Number of GTP packets sent with cause Error Indication from RNC eNodeB.')
jnx_mbg_sgw_gtp_v2_i_cs_sem_er_tad_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 181), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSemErTADRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSemErTADRx.setDescription('Number of GTP packets received with cause Semantic Error in TAD Operation.')
jnx_mbg_sgw_gtp_v2_i_cs_sem_er_tad_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 182), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSemErTADTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSemErTADTx.setDescription('Number of GTP packets sent with cause Semantic Error in TAD Operation.')
jnx_mbg_sgw_gtp_v2_i_cs_syn_er_tad_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 183), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSynErTADRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSynErTADRx.setDescription('Number of GTP packets received with cause Syntactic Error in TAD Operation.')
jnx_mbg_sgw_gtp_v2_i_cs_syn_er_tad_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 184), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSynErTADTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsSynErTADTx.setDescription('Number of GTP packets sent with cause Syntactic Error in TAD Operation.')
jnx_mbg_sgw_gtp_v2_i_cs_rm_val_rcv_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 185), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRMValRcvRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRMValRcvRx.setDescription('Number of GTP packets received with cause Reserved Message Value Received.')
jnx_mbg_sgw_gtp_v2_i_cs_rm_val_rcv_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 186), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRMValRcvTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRMValRcvTx.setDescription('Number of GTP packets sent with cause Reserved Message Value Received.')
jnx_mbg_sgw_gtp_v2_i_cs_r_pr_nt_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 187), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRPrNtRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRPrNtRspRx.setDescription('Number of GTP packets received with cause Remote peer not responding.')
jnx_mbg_sgw_gtp_v2_i_cs_r_pr_nt_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 188), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRPrNtRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsRPrNtRspTx.setDescription('Number of GTP packets sent with cause Remote peer not responding.')
jnx_mbg_sgw_gtp_v2_i_cs_col_nw_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 189), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsColNWReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsColNWReqRx.setDescription('Number of GTP packets received with cause Collision with network initiated request.')
jnx_mbg_sgw_gtp_v2_i_cs_col_nw_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 190), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsColNWReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsColNWReqTx.setDescription('Number of GTP packets sent with cause Collision with network initiated request.')
jnx_mbg_sgw_gtp_v2_i_cs_un_pg_ue_sus_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 191), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnPgUESusRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnPgUESusRx.setDescription('Number of GTP packets received with cause Unable to page UE due to suspension.')
jnx_mbg_sgw_gtp_v2_i_cs_un_pg_ue_sus_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 192), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnPgUESusTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsUnPgUESusTx.setDescription('Number of GTP packets sent with cause Unable to page UE due to suspension.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_tot_len_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 193), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvTotLenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvTotLenRx.setDescription('Number of GTP packets received with cause Invalid total len.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_tot_len_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 194), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvTotLenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvTotLenTx.setDescription('Number of GTP packets sent with cause Invalid total len.')
jnx_mbg_sgw_gtp_v2_i_cs_dt_for_nt_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 195), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDtForNtSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDtForNtSupRx.setDescription('Number of GTP packets received with cause Data forwarding not supported.')
jnx_mbg_sgw_gtp_v2_i_cs_dt_for_nt_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 196), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDtForNtSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsDtForNtSupTx.setDescription('Number of GTP packets sent with cause Data forwarding not supported.')
jnx_mbg_sgw_gtp_v2_i_cs_in_re_f_re_pr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 197), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInReFRePrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInReFRePrRx.setDescription('Number of GTP packets received with cause Invalid Reply from Remote peer.')
jnx_mbg_sgw_gtp_v2_i_cs_in_re_f_re_pr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 198), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInReFRePrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInReFRePrTx.setDescription('Number of GTP packets sent with cause Invalid Reply from Remote peer.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_pr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 199), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvPrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvPrRx.setDescription('Number of GTP packets received with cause Invalid peer.')
jnx_mbg_sgw_gtp_v2_i_cs_inv_pr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 200), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvPrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV2ICsInvPrTx.setDescription('Number of GTP packets sent with cause Invalid peer.')
jnx_mbg_sgw_gtp_v1_protocol_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 201), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1ProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1ProtocolErrRx.setDescription('Number of GTPv1 Protocol Errors Received.')
jnx_mbg_sgw_gtp_v1_un_sup_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 202), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1UnSupMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1UnSupMsgRx.setDescription('Number of GTPv1 Unsupported Messages received.')
jnx_mbg_sgw_gtp_v1_t3_resp_tmr_exp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 203), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1T3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1T3RespTmrExpRx.setDescription('Number of GTP V1 T3 timer expiries Received.')
jnx_mbg_sgw_gtp_v1_end_marker_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 204), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EndMarkerRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EndMarkerRx.setDescription('Number of GTP V1 end marker packets received.')
jnx_mbg_sgw_gtp_v1_end_marker_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 205), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EndMarkerTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EndMarkerTx.setDescription('Number of GTP V1 end marker packets sent.')
jnx_mbg_sgw_gtp_v1_echo_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 206), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoReqRx.setDescription('Number of GTP V1 echo request packets received.')
jnx_mbg_sgw_gtp_v1_echo_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 207), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoReqTx.setDescription('Number of GTP V1 echo request packets sent.')
jnx_mbg_sgw_gtp_v1_echo_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 208), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoRespRx.setDescription('Number of GTP V1 echo response packets received.')
jnx_mbg_sgw_gtp_v1_echo_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 209), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1EchoRespTx.setDescription('Number of GTP V1 echo response packets sent.')
jnx_mbg_sgw_gtp_v1_err_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 210), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1ErrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1ErrIndRx.setDescription('Number of GTP V1 Error Indication packets received.')
jnx_mbg_sgw_gtp_v1_err_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 211), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1ErrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpV1ErrIndTx.setDescription('Number of GTP V1 Error Indication packets sent.')
jnx_mbg_sgw_susp_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 212), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwSuspNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwSuspNotifRx.setDescription('Number of GTPv2 Suspend Notification messages received.')
jnx_mbg_sgw_susp_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 213), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwSuspNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwSuspNotifTx.setDescription('Number of GTPv2 Suspend Notification messages sent.')
jnx_mbg_sgw_susp_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 214), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwSuspAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwSuspAckRx.setDescription('Number of GTPv2 Suspend Acknowledgement messages received.')
jnx_mbg_sgw_susp_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 215), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwSuspAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwSuspAckTx.setDescription('Number of GTPv2 Suspend Acknowledgement messages sent.')
jnx_mbg_sgw_resume_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 216), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwResumeNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwResumeNotifRx.setDescription('Number of GTPv2 Resume Notification messages received.')
jnx_mbg_sgw_resume_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 217), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwResumeNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwResumeNotifTx.setDescription('Number of GTPv2 Resume Notification messages sent.')
jnx_mbg_sgw_resume_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 218), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwResumeAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwResumeAckRx.setDescription('Number of GTPv2 Resume Acknowledgement messages received.')
jnx_mbg_sgw_resume_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 219), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwResumeAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwResumeAckTx.setDescription('Number of GTPv2 Resume Acknowledgement messages sent.')
jnx_mbg_sgw_s11_piggyback_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 220), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwS11PiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwS11PiggybackMsgRx.setDescription('Number of GTPv2 S11 Piggyback messages received.')
jnx_mbg_sgw_s11_piggyback_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 221), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwS11PiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwS11PiggybackMsgTx.setDescription('Number of GTPv2 S11 Piggyback messages sent.')
jnx_mbg_sgw_s4_piggyback_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 222), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwS4PiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwS4PiggybackMsgRx.setDescription('Number of GTPv2 S4 Piggyback messages received.')
jnx_mbg_sgw_s4_piggyback_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 223), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwS4PiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwS4PiggybackMsgTx.setDescription('Number of GTPv2 S4 Piggyback messages sent.')
jnx_mbg_sgw_s5_piggyback_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 224), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwS5PiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwS5PiggybackMsgRx.setDescription('Number of GTPv2 S5 Piggyback messages received.')
jnx_mbg_sgw_s5_piggyback_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 2, 1, 225), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwS5PiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwS5PiggybackMsgTx.setDescription('Number of GTPv2 S5 Piggyback messages sent.')
jnx_mbg_sgw_gtp_c_per_peer_stats_table = mib_table((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1))
if mibBuilder.loadTexts:
jnxMbgSgwGtpCPerPeerStatsTable.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpCPerPeerStatsTable.setDescription('Each entry corresponds to a GTP per peer level control statistic.')
jnx_mbg_sgw_gtp_per_peer_stats_entry = mib_table_row((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1)).setIndexNames((0, 'JUNIPER-MOBILE-GATEWAYS', 'jnxMbgGwIndex'), (0, 'JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwPPGtpRmtAddr'), (0, 'JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwPPGtpLclAddr'), (0, 'JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwPPGtpRtgInst'))
if mibBuilder.loadTexts:
jnxMbgSgwGtpPerPeerStatsEntry.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpPerPeerStatsEntry.setDescription('A specification of the GTPC peer level Statistics.')
jnx_mbg_sgw_pp_gtp_rmt_addr = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 1), ip_address())
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpRmtAddr.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpRmtAddr.setDescription('The Remote IP address of this GTP peer entry.')
jnx_mbg_sgw_pp_gtp_lcl_addr = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 2), ip_address())
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpLclAddr.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpLclAddr.setDescription('The Local IP address of this GTP peer entry.')
jnx_mbg_sgw_pp_gtp_rtg_inst = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 3), unsigned32())
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpRtgInst.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpRtgInst.setDescription('The Routing Instance for this Peer.')
jnx_mbg_sgw_pp_rx_packets_dropped = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 4), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPRxPacketsDropped.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPRxPacketsDropped.setDescription('Number of Received Packets Dropped.')
jnx_mbg_sgw_pp_packet_alloc_fail = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 5), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPPacketAllocFail.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPPacketAllocFail.setDescription('Number of Packet allocation failures.')
jnx_mbg_sgw_pp_packet_send_fail = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 6), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPPacketSendFail.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPPacketSendFail.setDescription('Number of Packet Send failures.')
jnx_mbg_sgw_ppip_ver_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 7), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPIPVerErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPIPVerErrRx.setDescription('Number of IP Version Error Packets Received.')
jnx_mbg_sgw_ppip_proto_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 8), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPIPProtoErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPIPProtoErrRx.setDescription('Number of IP Protocol Error packets Received.')
jnx_mbg_sgw_ppgtp_port_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 9), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGTPPortErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGTPPortErrRx.setDescription('Number of Port Error Packets Received.')
jnx_mbg_sgw_ppgtp_unkn_ver_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 10), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGTPUnknVerRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGTPUnknVerRx.setDescription('Number of Unknown Version Packets Received.')
jnx_mbg_sgw_pp_pckt_len_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 11), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPPcktLenErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPPcktLenErrRx.setDescription('Number of Packet Length Error Packets Received.')
jnx_mbg_sgw_pp_unkn_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 12), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUnknMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUnknMsgRx.setDescription('Number of Unknown Messages Received.')
jnx_mbg_sgw_pp_protocol_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 13), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPProtocolErrRx.setDescription('Number of GTPv2 Protocol Errors Received.')
jnx_mbg_sgw_pp_un_supported_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 14), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUnSupportedMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUnSupportedMsgRx.setDescription('Number of GTPv2 Unsupported Messages received.')
jnx_mbg_sgw_ppt3_resp_tmr_exp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 15), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPT3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPT3RespTmrExpRx.setDescription('Number of GTP V2 T3 timer expiries Received.')
jnx_mbg_sgw_ppv2_num_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 16), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumMsgRx.setDescription('Number of GTPv2 messages received.')
jnx_mbg_sgw_ppv2_num_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 17), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumMsgTx.setDescription('Number of GTPV2 messages sent.')
jnx_mbg_sgw_ppv2_num_bytes_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 18), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumBytesRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumBytesRx.setDescription('Number of GTPv2 bytes received.')
jnx_mbg_sgw_ppv2_num_bytes_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 19), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumBytesTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2NumBytesTx.setDescription('Number of GTPV2 bytes sent.')
jnx_mbg_sgw_ppv2_echo_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 20), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoReqRx.setDescription('Number of GTP V2 Echo Request received.')
jnx_mbg_sgw_ppv2_echo_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 21), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoReqTx.setDescription('Number of GTP V2 Echo Request Sent.')
jnx_mbg_sgw_ppv2_echo_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 22), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoRespRx.setDescription('Number of GTP V2 Echo Response received.')
jnx_mbg_sgw_ppv2_echo_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 23), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2EchoRespTx.setDescription('Number of GTP V2 Echo Response Sent.')
jnx_mbg_sgw_ppv2_ver_not_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 24), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2VerNotSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2VerNotSupRx.setDescription('Number of GTP V2 Version Not supported messages received')
jnx_mbg_sgw_ppv2_ver_not_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 25), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2VerNotSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPV2VerNotSupTx.setDescription('Number of GTP V2 Number of version not supported messages sent.')
jnx_mbg_sgw_pp_create_sess_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 26), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessReqRx.setDescription('Number of GTP V2 Create Session Requests received.')
jnx_mbg_sgw_pp_create_sess_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 27), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessReqTx.setDescription('Number of GTP V2 Create Session Requests Sent.')
jnx_mbg_sgw_pp_create_sess_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 28), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessRspRx.setDescription('Number of GTP V2 Create Session Responses received.')
jnx_mbg_sgw_pp_create_sess_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 29), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCreateSessRspTx.setDescription('Number of GTP V2 Create Session Responses Sent.')
jnx_mbg_sgw_pp_mod_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 30), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrReqRx.setDescription('Number of GTP V2 Modify Bearer Requests received.')
jnx_mbg_sgw_pp_mod_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 31), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrReqTx.setDescription('Number of GTP V2 Modify Bearer Requests Sent.')
jnx_mbg_sgw_pp_mod_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 32), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrRspRx.setDescription('Number of GTP V2 Modify Bearer Responses received.')
jnx_mbg_sgw_pp_mod_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 33), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrRspTx.setDescription('Number of GTP V2 Modify Bearer Responses Sent.')
jnx_mbg_sgw_pp_del_sess_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 34), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessReqRx.setDescription('Number of GTP V2 Delete Session Requests received.')
jnx_mbg_sgw_pp_del_sess_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 35), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessReqTx.setDescription('Number of GTP V2 Delete Session Requests Sent.')
jnx_mbg_sgw_pp_del_sess_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 36), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessRspRx.setDescription('Number of GTP V2 Delete Session Responses received.')
jnx_mbg_sgw_pp_del_sess_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 37), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelSessRspTx.setDescription('Number of GTP V2 Delete Session Responses Sent.')
jnx_mbg_sgw_pp_crt_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 38), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrReqRx.setDescription('Number of GTP V2 Create Bearer Requests received.')
jnx_mbg_sgw_pp_crt_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 39), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrReqTx.setDescription('Number of GTP V2 Create Bearer Requests Sent.')
jnx_mbg_sgw_pp_crt_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 40), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrRspRx.setDescription('Number of GTP V2 Create Bearer Response received.')
jnx_mbg_sgw_pp_crt_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 41), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrtBrRspTx.setDescription('Number of GTP V2 Create Bearer Response Sent.')
jnx_mbg_sgw_pp_upd_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 42), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrReqRx.setDescription('Number of GTP V2 Update Bearer Request received.')
jnx_mbg_sgw_pp_upd_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 43), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrReqTx.setDescription('Number of GTP V2 Update Bearer Request Sent.')
jnx_mbg_sgw_pp_upd_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 44), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrRspRx.setDescription('Number of GTP V2 Update Bearer Response received.')
jnx_mbg_sgw_pp_upd_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 45), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdBrRspTx.setDescription('Number of GTP V2 Update Bearer Response Sent.')
jnx_mbg_sgw_pp_del_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 46), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrReqRx.setDescription('Number of GTP V2 Delete Bearer Request received.')
jnx_mbg_sgw_pp_del_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 47), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrReqTx.setDescription('Number of GTP V2 Delete Bearer Request Sent.')
jnx_mbg_sgw_pp_del_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 48), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrRspRx.setDescription('Number of GTP V2 Delete Bearer Response received.')
jnx_mbg_sgw_pp_del_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 49), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrRspTx.setDescription('Number of GTP V2 Delete Bearer Response Sent.')
jnx_mbg_sgw_pp_del_conn_set_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 50), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetReqRx.setDescription('Number of GTP V2 Delete PDN connection set Request received.')
jnx_mbg_sgw_pp_del_conn_set_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 51), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetReqTx.setDescription('Number of GTP V2 Delete PDN connection set Request Sent.')
jnx_mbg_sgw_pp_del_conn_set_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 52), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetRspRx.setDescription('Number of GTP V2 Delete PDN connection set Response received.')
jnx_mbg_sgw_pp_del_conn_set_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 53), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelConnSetRspTx.setDescription('Number of GTP V2 Delete PDN connection set Response Sent.')
jnx_mbg_sgw_pp_upd_conn_set_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 54), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetReqRx.setDescription('Number of GTP V2 Update Connection set Request received.')
jnx_mbg_sgw_pp_upd_conn_set_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 55), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetReqTx.setDescription('Number of GTP V2 Update Connection set Request Sent.')
jnx_mbg_sgw_pp_upd_conn_set_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 56), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetRspRx.setDescription('Number of GTP V2 Update Connection set Response received.')
jnx_mbg_sgw_pp_upd_conn_set_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 57), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPUpdConnSetRspTx.setDescription('Number of GTP V2 Update Connection set Response Sent.')
jnx_mbg_sgw_pp_mod_br_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 58), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrCmdRx.setDescription('Number of GTP V2 Modify Bearer Command received.')
jnx_mbg_sgw_pp_mod_br_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 59), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrCmdTx.setDescription('Number of GTP V2 Modify Bearer Command Sent.')
jnx_mbg_sgw_pp_mod_br_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 60), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrFlrIndRx.setDescription('Number of GTP V2 Modify Bearer Failure received.')
jnx_mbg_sgw_pp_mod_br_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 61), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPModBrFlrIndTx.setDescription('Number of GTP V2 Modify Bearer Failure Sent.')
jnx_mbg_sgw_pp_del_br_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 62), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrCmdRx.setDescription('Number of GTP V2 Delete Bearer Command received.')
jnx_mbg_sgw_pp_del_br_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 63), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrCmdTx.setDescription('Number of GTP V2 Delete Bearer Command Sent.')
jnx_mbg_sgw_pp_del_br_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 64), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrFlrIndRx.setDescription('Number of GTP V2 Delete Bearer Failure received.')
jnx_mbg_sgw_pp_del_br_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 65), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelBrFlrIndTx.setDescription('Number of GTP V2 Delete Bearer Failure Sent.')
jnx_mbg_sgw_pp_br_res_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 66), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResCmdRx.setDescription('Number of GTP V2 Bearer Response Command received.')
jnx_mbg_sgw_pp_br_res_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 67), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResCmdTx.setDescription('Number of GTP V2 Bearer Response Command Sent.')
jnx_mbg_sgw_pp_br_res_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 68), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResFlrIndRx.setDescription('Number of GTP V2 Bearer Resource Failure received.')
jnx_mbg_sgw_pp_br_res_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 69), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPBrResFlrIndTx.setDescription('Number of GTP V2 Bearer Resource Failure Sent.')
jnx_mbg_sgw_pp_rel_acs_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 70), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrReqRx.setDescription('Number of GTP V2 Release Access Bearer Requests received.')
jnx_mbg_sgw_pp_rel_acs_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 71), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrReqTx.setDescription('Number of GTP V2 Release Access Bearer Requests sent.')
jnx_mbg_sgw_pp_rel_acs_br_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 72), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrRespRx.setDescription('Number of GTP V2 Release Access Bearer Response received.')
jnx_mbg_sgw_pp_rel_acs_br_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 73), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPRelAcsBrRespTx.setDescription('Number of GTP V2 Release Access Bearer Response sent.')
jnx_mbg_sgw_pp_cr_ind_tun_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 74), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunReqRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request Received')
jnx_mbg_sgw_pp_cr_ind_tun_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 75), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunReqTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request sent')
jnx_mbg_sgw_pp_cr_ind_tun_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 76), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunRespRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response Received')
jnx_mbg_sgw_pp_cr_ind_tun_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 77), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPCrIndTunRespTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response sent')
jnx_mbg_sgw_pp_del_ind_tun_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 78), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunReqRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request Received')
jnx_mbg_sgw_pp_del_ind_tun_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 79), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunReqTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request sent.')
jnx_mbg_sgw_pp_del_ind_tun_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 80), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunRespRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response Received')
jnx_mbg_sgw_pp_del_ind_tun_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 81), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDelIndTunRespTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response sent.')
jnx_mbg_sgw_pp_dl_data_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 82), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotifRx.setDescription('Number of GTP V2 Downlink Data Notify received.')
jnx_mbg_sgw_pp_dl_data_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 83), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotifTx.setDescription('Number of GTP V2 Downlink Data Notify Sent.')
jnx_mbg_sgw_pp_dl_data_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 84), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataAckRx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement received.')
jnx_mbg_sgw_pp_dl_data_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 85), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataAckTx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement Sent.')
jnx_mbg_sgw_pp_dl_data_noti_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 86), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotiFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotiFlrIndRx.setDescription('Number of GTP V2 Downlink Data Notification fail received.')
jnx_mbg_sgw_pp_dl_data_noti_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 87), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotiFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPDlDataNotiFlrIndTx.setDescription('Number of GTP V2 Downlink Data Notification fail Sent.')
jnx_mbg_sgw_pp_stop_paging_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 88), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPStopPagingIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPStopPagingIndRx.setDescription('Number of GTP V2 Number of Stop Paging Indication Messages Received.')
jnx_mbg_sgw_pp_stop_paging_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 89), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPStopPagingIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPStopPagingIndTx.setDescription('Number of GTP V2 Number of Stop Paging Indicaton messages sent')
jnx_mbg_sgw_pp_gtp_v2_i_cs_page_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 90), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPageRx.setStatus('obsolete')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPageRx.setDescription('Number of GTPV2 packets received with cause Page.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_page_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 91), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPageTx.setStatus('obsolete')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPageTx.setDescription('Number of GTP packets sent with cause Page.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_req_accept_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 92), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqAcceptRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqAcceptRx.setDescription('Number of GTPV2 packets received with cause Request Accept.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_req_accept_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 93), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqAcceptTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqAcceptTx.setDescription('Number of GTP packets sent with cause Request Accept.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_accept_part_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 94), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAcceptPartRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAcceptPartRx.setDescription('Number of GTPV2 packets received with cause Accept Partial.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_accept_part_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 95), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAcceptPartTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAcceptPartTx.setDescription('Number of GTP packets sent with cause Accept Partial.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_new_ptn_pref_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 96), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNewPTNPrefRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNewPTNPrefRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Network Preference.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_new_ptn_pref_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 97), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNewPTNPrefTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNewPTNPrefTx.setDescription('Number of GTP packets sent with cause New PDN type due to Network Preference.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_nptsi_adbr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 98), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Single Address Bearer.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_nptsi_adbr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 99), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx.setDescription('Number of GTP packets sent with cause New PDN type due to Single Address Bearer.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ctx_not_fnd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 100), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCtxNotFndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCtxNotFndRx.setDescription('Number of GTPV2 packets received with cause Context not found.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ctx_not_fnd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 101), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCtxNotFndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCtxNotFndTx.setDescription('Number of GTP packets sent with cause Context not found.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_msg_fmt_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 102), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvMsgFmtRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvMsgFmtRx.setDescription('Number of GTPV2 packets received with cause Invalid Message Format.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_msg_fmt_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 103), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvMsgFmtTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvMsgFmtTx.setDescription('Number of GTP packets sent with cause Invalid Message Format.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ver_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 104), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsVerNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsVerNotSuppRx.setDescription('Number of GTPV2 packets received with cause Version not Supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ver_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 105), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsVerNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsVerNotSuppTx.setDescription('Number of GTP packets sent with cause Version not Supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_len_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 106), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvLenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvLenRx.setDescription('Number of GTPV2 packets received with cause Invalid Length.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_len_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 107), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvLenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvLenTx.setDescription('Number of GTP packets sent with cause Invalid Length.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_serv_not_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 108), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServNotSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServNotSupRx.setDescription('Number of GTPV2 packets received with cause Service Not supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_serv_not_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 109), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServNotSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServNotSupTx.setDescription('Number of GTP packets sent with cause Service Not supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_man_ie_incor_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 110), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEIncorRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEIncorRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE incorrect.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_man_ie_incor_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 111), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEIncorTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEIncorTx.setDescription('Number of GTP packets sent with cause Mandatory IE incorrect.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_man_ie_miss_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 112), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEMissRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEMissRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE Missing.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_man_ie_miss_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 113), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEMissTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsManIEMissTx.setDescription('Number of GTP packets sent with cause Mandatory IE Missing.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_opt_ie_incor_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 114), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsOptIEIncorRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsOptIEIncorRx.setDescription('Number of GTPV2 packets received with cause Optional IE Incorrect.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_opt_ie_incor_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 115), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsOptIEIncorTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsOptIEIncorTx.setDescription('Number of GTP packets sent with cause Optional IE Incorrect.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_sys_fail_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 116), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSysFailRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSysFailRx.setDescription('Number of GTPV2 packets received with cause System Failure.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_sys_fail_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 117), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSysFailTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSysFailTx.setDescription('Number of GTP packets sent with cause System Failure.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_no_res_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 118), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoResRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoResRx.setDescription('Number of GTPV2 packets received with cause No Resource.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_no_res_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 119), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoResTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoResTx.setDescription('Number of GTP packets sent with cause No Resource.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_tftsmant_er_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 120), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSMANTErRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSMANTErRx.setDescription('Number of GTPV2 packets received with cause TFT Symantic Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_tftsmant_er_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 121), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSMANTErTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSMANTErTx.setDescription('Number of GTP packets sent with cause TFT Symantic Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_tft_sys_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 122), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSysErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSysErrRx.setDescription('Number of GTPV2 packets received with cause TFT System Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_tft_sys_err_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 123), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSysErrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsTFTSysErrTx.setDescription('Number of GTP packets sent with cause TFT System Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_pk_flt_man_er_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 124), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltManErRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltManErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Symantic Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_pk_flt_man_er_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 125), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltManErTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltManErTx.setDescription('Number of GTP packets sent with cause Packet Filter Symantic Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_pk_flt_syn_er_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 126), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltSynErRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltSynErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Syntax Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_pk_flt_syn_er_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 127), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltSynErTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPkFltSynErTx.setDescription('Number of GTP packets sent with cause Packet Filter Syntax Error.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_mis_unkn_apn_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 128), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsMisUnknAPNRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsMisUnknAPNRx.setDescription('Number of GTPV2 packets received with cause Unknown APN.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_mis_unkn_apn_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 129), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsMisUnknAPNTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsMisUnknAPNTx.setDescription('Number of GTP packets sent with cause Unknown APN.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_unexp_rpt_ie_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 130), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnexpRptIERx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnexpRptIERx.setDescription('Number of GTPV2 packets received with cause Unexpected Repeated IE.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_unexp_rpt_ie_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 131), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnexpRptIETx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnexpRptIETx.setDescription('Number of GTP packets sent with cause Unexpected Repeated IE.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_gre_key_nt_fd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 132), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx.setDescription('Number of GTPV2 packets received with cause GRE Key Not Found.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_gre_key_nt_fd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 133), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx.setDescription('Number of GTP packets sent with cause GRE Key Not Found.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_reloc_fail_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 134), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRelocFailRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRelocFailRx.setDescription('Number of GTPV2 packets received with cause Relocation Failed.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_reloc_fail_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 135), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRelocFailTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRelocFailTx.setDescription('Number of GTP packets sent with cause Relocation Failed.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_den_in_rat_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 136), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDenINRatRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDenINRatRx.setDescription('Number of GTPV2 packets received with cause Denied in RAT.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_den_in_rat_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 137), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDenINRatTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDenINRatTx.setDescription('Number of GTP packets sent with cause Denied in RAT.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_pt_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 138), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTNotSuppRx.setDescription('Number of GTPV2 packets received with cause PDN Type Not Supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_pt_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 139), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTNotSuppTx.setDescription('Number of GTP packets sent with cause PDN Type Not Supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_all_dyn_ad_oc_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 140), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAllDynAdOcRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAllDynAdOcRx.setDescription('Number of GTPV2 packets received with cause Allocated Dynamic Address Occupied.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_all_dyn_ad_oc_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 141), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAllDynAdOcTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAllDynAdOcTx.setDescription('Number of GTP packets sent with cause Allocated Dynamic Address Occupied.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_notftuectx_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 142), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx.setDescription('Number of GTPV2 packets received with cause UE Context Without TFT Exists.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_notftuectx_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 143), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx.setDescription('Number of GTP packets sent with cause UE Context Without TFT Exists.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_proto_nt_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 144), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsProtoNtSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsProtoNtSupRx.setDescription('Number of GTPV2 packets received with cause Protocol Not Supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_proto_nt_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 145), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsProtoNtSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsProtoNtSupTx.setDescription('Number of GTP packets sent with cause Protocol Not Supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ue_not_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 146), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUENotRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUENotRespRx.setDescription('Number of GTPV2 packets received with cause UE Not Responding.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ue_not_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 147), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUENotRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUENotRespTx.setDescription('Number of GTP packets sent with cause UE Not Responding.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ue_refuses_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 148), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUERefusesRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUERefusesRx.setDescription('Number of GTPV2 packets received with cause UE Refuses.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ue_refuses_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 149), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUERefusesTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUERefusesTx.setDescription('Number of GTP packets sent with cause UE Refuses.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_serv_denied_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 150), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServDeniedRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServDeniedRx.setDescription('Number of GTPV2 packets received with cause Service Denied.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_serv_denied_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 151), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServDeniedTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsServDeniedTx.setDescription('Number of GTP packets sent with cause Service Denied.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_unab_page_ue_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 152), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnabPageUERx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnabPageUERx.setDescription('Number of GTPV2 packets received with cause Unable to Page UE.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_unab_page_ue_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 153), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnabPageUETx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnabPageUETx.setDescription('Number of GTP packets sent with cause Unable to Page UE.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_no_mem_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 154), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoMemRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoMemRx.setDescription('Number of GTPV2 packets received with cause No Memory.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_no_mem_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 155), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoMemTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsNoMemTx.setDescription('Number of GTP packets sent with cause No Memory.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_user_auth_fl_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 156), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUserAUTHFlRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUserAUTHFlRx.setDescription('Number of GTPV2 packets received with cause User AUTH Failed.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_user_auth_fl_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 157), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUserAUTHFlTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUserAUTHFlTx.setDescription('Number of GTP packets sent with cause User AUTH Failed.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_apn_acs_den_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 158), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNAcsDenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNAcsDenRx.setDescription('Number of GTPV2 packets received with cause APN Access Denied.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_apn_acs_den_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 159), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNAcsDenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNAcsDenTx.setDescription('Number of GTP packets sent with cause APN Access Denied.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_req_rej_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 160), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqRejRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqRejRx.setDescription('Number of GTPV2 packets received with cause Request Rejected.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_req_rej_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 161), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqRejTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsReqRejTx.setDescription('Number of GTP packets sent with cause Request Rejected.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ptmsi_sig_mm_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 162), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTMSISigMMRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTMSISigMMRx.setDescription('Number of GTPV2 packets received with cause P-TMSI Signature Mismatch.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_ptmsi_sig_mm_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 163), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTMSISigMMTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsPTMSISigMMTx.setDescription('Number of GTP packets sent with cause P-TMSI Signature Mismatch.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_imsi_not_kn_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 164), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsIMSINotKnRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsIMSINotKnRx.setDescription('Number of GTPV2 packets received with cause IMSI Not Known.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_imsi_not_kn_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 165), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsIMSINotKnTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsIMSINotKnTx.setDescription('Number of GTP packets sent with cause IMSI Not Known.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_cond_ie_ms_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 166), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCondIEMsRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCondIEMsRx.setDescription('Number of GTPV2 packets received with cause Conditional IE Missing.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_cond_ie_ms_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 167), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCondIEMsTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCondIEMsTx.setDescription('Number of GTP packets sent with cause Conditional IE Missing.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_apn_res_t_inc_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 168), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNResTIncRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNResTIncRx.setDescription('Number of GTPV2 packets received with cause APN Restriction Type Incompatible.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_apn_res_t_inc_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 169), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNResTIncTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsAPNResTIncTx.setDescription('Number of GTP packets sent with cause APN Restriction Type Incompatible.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_unknown_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 170), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnknownRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnknownRx.setDescription('Number of GTPV2 packets received with cause Unknown.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_unknown_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 171), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnknownTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnknownTx.setDescription('Number of GTP packets sent with cause Unknown.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_lcl_det_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 172), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsLclDetRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsLclDetRx.setDescription('Number of GTP packets received with cause Local Detach.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_lcl_det_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 173), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsLclDetTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsLclDetTx.setDescription('Number of GTP packets sent with cause Local Detach.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_cmp_det_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 174), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCmpDetRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCmpDetRx.setDescription('Number of GTP packets received with cause Complete Detach.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_cmp_det_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 175), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCmpDetTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsCmpDetTx.setDescription('Number of GTP packets sent with cause Complete Detach.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_rat_chg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 176), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRATChgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRATChgRx.setDescription('Number of GTP packets received with cause RAT changed from 3GPP to non 3GPP.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_rat_chg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 177), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRATChgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRATChgTx.setDescription('Number of GTP packets sent with cause RAT changed from 3GPP to non 3GPP.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_isr_deact_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 178), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsISRDeactRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsISRDeactRx.setDescription('Number of GTP packets received with cause ISR Deactivated.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_isr_deact_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 179), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsISRDeactTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsISRDeactTx.setDescription('Number of GTP packets sent with cause ISR Deactivated.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_eifrnc_en_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 180), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsEIFRNCEnRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsEIFRNCEnRx.setDescription('Number of GTP packets received with cause Error Indication from RNC eNodeB.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_eifrnc_en_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 181), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsEIFRNCEnTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsEIFRNCEnTx.setDescription('Number of GTP packets sent with cause Error Indication from RNC eNodeB.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_sem_er_tad_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 182), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSemErTADRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSemErTADRx.setDescription('Number of GTP packets received with cause Semantic Error in TAD Operation.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_sem_er_tad_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 183), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSemErTADTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSemErTADTx.setDescription('Number of GTP packets sent with cause Semantic Error in TAD Operation.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_syn_er_tad_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 184), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSynErTADRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSynErTADRx.setDescription('Number of GTP packets received with cause Syntactic Error in TAD Operation.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_syn_er_tad_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 185), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSynErTADTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsSynErTADTx.setDescription('Number of GTP packets sent with cause Syntactic Error in TAD Operation.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_rm_val_rcv_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 186), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRMValRcvRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRMValRcvRx.setDescription('Number of GTP packets received with cause Reserved Message Value Received.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_rm_val_rcv_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 187), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRMValRcvTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRMValRcvTx.setDescription('Number of GTP packets sent with cause Reserved Message Value Received.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_r_pr_nt_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 188), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRPrNtRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRPrNtRspRx.setDescription('Number of GTP packets received with cause Remote peer not responding.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_r_pr_nt_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 189), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRPrNtRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsRPrNtRspTx.setDescription('Number of GTP packets sent with cause Remote peer not responding.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_col_nw_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 190), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsColNWReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsColNWReqRx.setDescription('Number of GTP packets received with cause Collision with network initiated request.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_col_nw_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 191), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsColNWReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsColNWReqTx.setDescription('Number of GTP packets sent with cause Collision with network initiated request.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_un_pg_ue_sus_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 192), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnPgUESusRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnPgUESusRx.setDescription('Number of GTP packets received with cause Unable to page UE due to suspension.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_un_pg_ue_sus_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 193), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnPgUESusTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsUnPgUESusTx.setDescription('Number of GTP packets sent with cause Unable to page UE due to suspension.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_tot_len_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 194), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvTotLenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvTotLenRx.setDescription('Number of GTP packets received with cause Invalid total len.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_tot_len_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 195), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvTotLenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvTotLenTx.setDescription('Number of GTP packets sent with cause Invalid total len.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_dt_for_nt_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 196), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDtForNtSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDtForNtSupRx.setDescription('Number of GTP packets received with cause Data forwarding not supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_dt_for_nt_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 197), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDtForNtSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsDtForNtSupTx.setDescription('Number of GTP packets sent with cause Data forwarding not supported.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_in_re_f_re_pr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 198), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInReFRePrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInReFRePrRx.setDescription('Number of GTP packets received with cause Invalid Reply from Remote peer.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_in_re_f_re_pr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 199), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInReFRePrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInReFRePrTx.setDescription('Number of GTP packets sent with cause Invalid Reply from Remote peer.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_pr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 200), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvPrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvPrRx.setDescription('Number of GTP packets received with cause Invalid peer.')
jnx_mbg_sgw_pp_gtp_v2_i_cs_inv_pr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 201), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvPrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV2ICsInvPrTx.setDescription('Number of GTP packets sent with cause Invalid peer.')
jnx_mbg_sgw_pp_gtp_v1_protocol_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 202), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1ProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1ProtocolErrRx.setDescription('Number of GTPv1 Protocol Errors Received.')
jnx_mbg_sgw_pp_gtp_v1_un_sup_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 203), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1UnSupMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1UnSupMsgRx.setDescription('Number of GTPv1 Unsupported Messages received.')
jnx_mbg_sgw_pp_gtp_v1_t3_resp_tmr_exp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 204), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1T3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1T3RespTmrExpRx.setDescription('Number of GTP V1 T3 timer expiries Received.')
jnx_mbg_sgw_pp_gtp_v1_end_marker_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 205), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EndMarkerRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EndMarkerRx.setDescription('Number of GTP V1 end marker packets received.')
jnx_mbg_sgw_pp_gtp_v1_end_marker_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 206), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EndMarkerTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EndMarkerTx.setDescription('Number of GTP V1 end marker packets sent.')
jnx_mbg_sgw_pp_gtp_v1_echo_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 207), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoReqRx.setDescription('Number of GTP V1 echo request packets received.')
jnx_mbg_sgw_pp_gtp_v1_echo_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 208), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoReqTx.setDescription('Number of GTP iV1 echo request packets sent.')
jnx_mbg_sgw_pp_gtp_v1_echo_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 209), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoRespRx.setDescription('Number of GTP V1 echo response packets received.')
jnx_mbg_sgw_pp_gtp_v1_echo_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 210), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1EchoRespTx.setDescription('Number of GTP V1 echo response packets sent.')
jnx_mbg_sgw_pp_gtp_v1_err_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 211), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1ErrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1ErrIndRx.setDescription('Number of GTP V1 Error Indication packets received.')
jnx_mbg_sgw_pp_gtp_v1_err_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 212), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1ErrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPGtpV1ErrIndTx.setDescription('Number of GTP V1 Error Indication packets sent.')
jnx_mbg_sgw_pp_susp_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 213), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspNotifRx.setDescription('Number of GTPv2 Suspend Notification messages received.')
jnx_mbg_sgw_pp_susp_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 214), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspNotifTx.setDescription('Number of GTPv2 Suspend Notification messages sent.')
jnx_mbg_sgw_pp_susp_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 215), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspAckRx.setDescription('Number of GTPv2 Suspend Acknowledgement messages received.')
jnx_mbg_sgw_pp_susp_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 216), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPSuspAckTx.setDescription('Number of GTPv2 Suspend Acknowledgement messages sent.')
jnx_mbg_sgw_pp_resume_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 217), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeNotifRx.setDescription('Number of GTPv2 Resume Notification messages received.')
jnx_mbg_sgw_pp_resume_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 218), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeNotifTx.setDescription('Number of GTPv2 Resume Notification messages sent.')
jnx_mbg_sgw_pp_resume_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 219), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeAckRx.setDescription('Number of GTPv2 Resume Acknowledgement messages received.')
jnx_mbg_sgw_pp_resume_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 220), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPResumeAckTx.setDescription('Number of GTPv2 Resume Acknowledgement messages sent.')
jnx_mbg_sgw_pp_piggyback_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 221), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPPiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPPiggybackMsgRx.setDescription('Number of GTPv2 Piggyback messages received.')
jnx_mbg_sgw_pp_piggyback_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 1, 1, 222), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwPPPiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwPPPiggybackMsgTx.setDescription('Number of GTPv2 S11 Piggyback messages sent.')
jnx_mbg_sgw_gtp_if_stats_table = mib_table((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4))
if mibBuilder.loadTexts:
jnxMbgSgwGtpIfStatsTable.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpIfStatsTable.setDescription('Each entry corresponds to an interface level GTP statistic.')
jnx_mbg_sgw_gtp_if_stats_entry = mib_table_row((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1)).setIndexNames((0, 'JUNIPER-MOBILE-GATEWAYS', 'jnxMbgGwIndex'), (0, 'JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwIfIndex'))
if mibBuilder.loadTexts:
jnxMbgSgwGtpIfStatsEntry.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpIfStatsEntry.setDescription('A specification of the GTP interface level control Statistics.')
jnx_mbg_sgw_if_index = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 1), unsigned32())
if mibBuilder.loadTexts:
jnxMbgSgwIfIndex.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfIndex.setDescription('GTP Interface Index')
jnx_mbg_sgw_if_type = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 2), display_string()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfType.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfType.setDescription('Interface Name.')
jnx_mbg_sgw_if_rx_packets_dropped = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 3), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfRxPacketsDropped.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfRxPacketsDropped.setDescription('Number of Received GTP Packets Dropped by the Gateway.')
jnx_mbg_sgw_if_packet_alloc_fail = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 4), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfPacketAllocFail.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfPacketAllocFail.setDescription('Number of Packet allocation failures in the Gateway.')
jnx_mbg_sgw_if_packet_send_fail = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 5), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfPacketSendFail.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfPacketSendFail.setDescription('Number of GTP Packet Send failures in the Gateway.')
jnx_mbg_sgw_if_ip_ver_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 6), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfIPVerErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfIPVerErrRx.setDescription('Number of IP Version Error Packets Received.')
jnx_mbg_sgw_if_ip_proto_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 7), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfIPProtoErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfIPProtoErrRx.setDescription('Number of IP Protocol Error packets Received.')
jnx_mbg_sgw_if_gtp_port_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 8), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGTPPortErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGTPPortErrRx.setDescription('Number of Port Error Packets Received.')
jnx_mbg_sgw_if_gtp_unkn_ver_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 9), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGTPUnknVerRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGTPUnknVerRx.setDescription('Number of Unknown Version Packets Received.')
jnx_mbg_sgw_if_pckt_len_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 10), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfPcktLenErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfPcktLenErrRx.setDescription('Number of Packet Length Error Packets Received.')
jnx_mbg_sgw_if_unkn_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 11), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUnknMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUnknMsgRx.setDescription('Number of Unknown Messages Received.')
jnx_mbg_sgw_if_protocol_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 12), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfProtocolErrRx.setDescription('Number of GTPv2 Protocol Errors Received.')
jnx_mbg_sgw_if_un_supported_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 13), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUnSupportedMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUnSupportedMsgRx.setDescription('Number of GTPv2 Unsupported Messages received.')
jnx_mbg_sgw_if_t3_resp_tmr_exp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 14), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfT3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfT3RespTmrExpRx.setDescription('Number of GTP V2 T3 timer expiries Received.')
jnx_mbg_sgw_if_v2_num_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 15), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumMsgRx.setDescription('Number of GTPv2 messages received.')
jnx_mbg_sgw_if_v2_num_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 16), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumMsgTx.setDescription('Number of V2 messages sent.')
jnx_mbg_sgw_if_v2_num_bytes_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 17), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumBytesRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumBytesRx.setDescription('Number of GTPv2 bytes received.')
jnx_mbg_sgw_if_v2_num_bytes_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 18), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumBytesTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2NumBytesTx.setDescription('Number of V2 bytes sent.')
jnx_mbg_sgw_if_v2_echo_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 19), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoReqRx.setDescription('Number of GTP V2 Echo Request received.')
jnx_mbg_sgw_if_v2_echo_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 20), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoReqTx.setDescription('Number of GTP V2 Echo Request Sent.')
jnx_mbg_sgw_if_v2_echo_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 21), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoRespRx.setDescription('Number of GTP V2 Echo Response received.')
jnx_mbg_sgw_if_v2_echo_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 22), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2EchoRespTx.setDescription('Number of GTP V2 Echo Response Sent.')
jnx_mbg_sgw_if_v2_ver_not_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 23), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2VerNotSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2VerNotSupRx.setDescription('Number of GTP V2 Version Not supported messages received')
jnx_mbg_sgw_if_v2_ver_not_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 24), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2VerNotSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfV2VerNotSupTx.setDescription('Number of GTP V2 version not supported messages sent.')
jnx_mbg_sgw_if_create_sess_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 25), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessReqRx.setDescription('Number of GTP V2 Create Session Requests received.')
jnx_mbg_sgw_if_create_sess_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 26), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessReqTx.setDescription('Number of GTP V2 Create Session Requests Sent.')
jnx_mbg_sgw_if_create_sess_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 27), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessRspRx.setDescription('Number of GTP V2 Create Session Responses received.')
jnx_mbg_sgw_if_create_sess_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 28), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCreateSessRspTx.setDescription('Number of GTP V2 Create Session Responses Sent.')
jnx_mbg_sgw_if_mod_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 29), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrReqRx.setDescription('Number of GTP V2 Modify Bearer Requests received.')
jnx_mbg_sgw_if_mod_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 30), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrReqTx.setDescription('Number of GTP V2 Modify Bearer Requests Sent.')
jnx_mbg_sgw_if_mod_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 31), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrRspRx.setDescription('Number of GTP V2 Modify Bearer Responses received.')
jnx_mbg_sgw_if_mod_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 32), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrRspTx.setDescription('Number of GTP V2 Modify Bearer Responses Sent.')
jnx_mbg_sgw_if_del_sess_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 33), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessReqRx.setDescription('Number of GTP V2 Delete Session Requests received.')
jnx_mbg_sgw_if_del_sess_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 34), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessReqTx.setDescription('Number of GTP V2 Delete Session Requests Sent.')
jnx_mbg_sgw_if_del_sess_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 35), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessRspRx.setDescription('Number of GTP V2 Delete Session Responses received.')
jnx_mbg_sgw_if_del_sess_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 36), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelSessRspTx.setDescription('Number of GTP V2 Delete Session Responses Sent.')
jnx_mbg_sgw_if_crt_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 37), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrReqRx.setDescription('Number of GTP V2 Create Bearer Requests received.')
jnx_mbg_sgw_if_crt_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 38), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrReqTx.setDescription('Number of GTP V2 Create Bearer Requests Sent.')
jnx_mbg_sgw_if_crt_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 39), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrRspRx.setDescription('Number of GTP V2 Create Bearer Response received.')
jnx_mbg_sgw_if_crt_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 40), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrtBrRspTx.setDescription('Number of GTP V2 Create Bearer Response Sent.')
jnx_mbg_sgw_if_upd_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 41), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrReqRx.setDescription('Number of GTP V2 Update Bearer Request received.')
jnx_mbg_sgw_if_upd_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 42), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrReqTx.setDescription('Number of GTP V2 Update Bearer Request Sent.')
jnx_mbg_sgw_if_upd_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 43), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrRspRx.setDescription('Number of GTP V2 Update Bearer Response received.')
jnx_mbg_sgw_if_upd_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 44), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdBrRspTx.setDescription('Number of GTP V2 Update Bearer Response Sent.')
jnx_mbg_sgw_if_del_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 45), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrReqRx.setDescription('Number of GTP V2 Delete Bearer Request received.')
jnx_mbg_sgw_if_del_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 46), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrReqTx.setDescription('Number of GTP V2 Delete Bearer Request Sent.')
jnx_mbg_sgw_if_del_br_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 47), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrRspRx.setDescription('Number of GTP V2 Delete Bearer Response received.')
jnx_mbg_sgw_if_del_br_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 48), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrRspTx.setDescription('Number of GTP V2 Delete Bearer Response Sent.')
jnx_mbg_sgw_if_del_conn_set_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 49), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetReqRx.setDescription('Number of GTP V2 Delete PDN connection set Request received.')
jnx_mbg_sgw_if_del_conn_set_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 50), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetReqTx.setDescription('Number of GTP V2 Delete PDN connection set Request Sent.')
jnx_mbg_sgw_if_del_conn_set_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 51), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetRspRx.setDescription('Number of GTP V2 Delete PDN connection set Response received.')
jnx_mbg_sgw_if_del_conn_set_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 52), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelConnSetRspTx.setDescription('Number of GTP V2 Delete PDN connection set Response Sent.')
jnx_mbg_sgw_if_upd_conn_set_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 53), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetReqRx.setDescription('Number of GTP V2 Update Connection set Request received.')
jnx_mbg_sgw_if_upd_conn_set_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 54), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetReqTx.setDescription('Number of GTP V2 Update Connection set Request Sent.')
jnx_mbg_sgw_if_upd_conn_set_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 55), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetRspRx.setDescription('Number of GTP V2 Update Connection set Response received.')
jnx_mbg_sgw_if_upd_conn_set_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 56), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfUpdConnSetRspTx.setDescription('Number of GTP V2 Update Connection set Response Sent.')
jnx_mbg_sgw_if_mod_br_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 57), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrCmdRx.setDescription('Number of GTP V2 Modify Bearer Command received.')
jnx_mbg_sgw_if_mod_br_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 58), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrCmdTx.setDescription('Number of GTP V2 Modify Bearer Command Sent.')
jnx_mbg_sgw_if_mod_br_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 59), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrFlrIndRx.setDescription('Number of GTP V2 Modify Bearer Failure received.')
jnx_mbg_sgw_if_mod_br_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 60), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfModBrFlrIndTx.setDescription('Number of GTP V2 Modify Bearer Failure Sent.')
jnx_mbg_sgw_if_del_br_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 61), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrCmdRx.setDescription('Number of GTP V2 Delete Bearer Command received.')
jnx_mbg_sgw_if_del_br_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 62), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrCmdTx.setDescription('Number of GTP V2 Delete Bearer Command Sent.')
jnx_mbg_sgw_if_del_br_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 63), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrFlrIndRx.setDescription('Number of GTP V2 Delete Bearer Failure received.')
jnx_mbg_sgw_if_del_br_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 64), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelBrFlrIndTx.setDescription('Number of GTP V2 Delete Bearer Failure Sent.')
jnx_mbg_sgw_if_br_res_cmd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 65), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResCmdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResCmdRx.setDescription('Number of GTP V2 Bearer Response Command received.')
jnx_mbg_sgw_if_br_res_cmd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 66), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResCmdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResCmdTx.setDescription('Number of GTP V2 Bearer Response Command Sent.')
jnx_mbg_sgw_if_br_res_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 67), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResFlrIndRx.setDescription('Number of GTP V2 Bearer Resource Failure received.')
jnx_mbg_sgw_if_br_res_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 68), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfBrResFlrIndTx.setDescription('Number of GTP V2 Bearer Resource Failure Sent.')
jnx_mbg_sgw_if_rel_acs_br_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 69), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrReqRx.setDescription('Number of GTP V2 Release Access Bearer Requests received.')
jnx_mbg_sgw_if_rel_acs_br_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 70), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrReqTx.setDescription('Number of GTP V2 Release Access Bearer Requests sent.')
jnx_mbg_sgw_if_rel_acs_br_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 71), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrRespRx.setDescription('Number of GTP V2 Release Access Bearer Response received.')
jnx_mbg_sgw_if_rel_acs_br_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 72), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfRelAcsBrRespTx.setDescription('Number of GTP V2 Release Access Bearer Response sent.')
jnx_mbg_sgw_if_cr_ind_tun_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 73), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunReqRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request Received')
jnx_mbg_sgw_if_cr_ind_tun_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 74), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunReqTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Request sent')
jnx_mbg_sgw_if_cr_ind_tun_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 75), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunRespRx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response Received')
jnx_mbg_sgw_if_cr_ind_tun_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 76), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfCrIndTunRespTx.setDescription('Number of GTP V2 Create Indirect Tunnel Forward Response sent')
jnx_mbg_sgw_if_del_ind_tun_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 77), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunReqRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request Received')
jnx_mbg_sgw_if_del_ind_tun_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 78), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunReqTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Request sent.')
jnx_mbg_sgw_if_del_ind_tun_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 79), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunRespRx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response Received')
jnx_mbg_sgw_if_del_ind_tun_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 80), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDelIndTunRespTx.setDescription('Number of GTP V2 Delete Indirect Tunnel Forward Response sent.')
jnx_mbg_sgw_if_dl_data_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 81), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotifRx.setDescription('Number of GTP V2 Downlink Data Notify received.')
jnx_mbg_sgw_if_dl_data_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 82), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotifTx.setDescription('Number of GTP V2 Downlink Data Notify Sent.')
jnx_mbg_sgw_if_dl_data_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 83), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataAckRx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement received.')
jnx_mbg_sgw_if_dl_data_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 84), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataAckTx.setDescription('Number of GTP V2 Downlink Data Notify Acknowledgement Sent.')
jnx_mbg_sgw_if_dl_data_noti_flr_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 85), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotiFlrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotiFlrIndRx.setDescription('Number of GTP V2 Downlink Data Notification fail received.')
jnx_mbg_sgw_if_dl_data_noti_flr_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 86), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotiFlrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfDlDataNotiFlrIndTx.setDescription('Number of GTP V2 Downlink Data Notification fail Sent.')
jnx_mbg_sgw_if_stop_paging_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 87), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfStopPagingIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfStopPagingIndRx.setDescription('Number of GTP V2 Number of Stop Paging Indication Messages Received.')
jnx_mbg_sgw_if_stop_paging_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 88), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfStopPagingIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfStopPagingIndTx.setDescription('Number of GTP V2 Number of Stop Paging Indicaton messages sent')
jnx_mbg_sgw_if_gtp_v2_i_cs_req_accept_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 89), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqAcceptRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqAcceptRx.setDescription('Number of GTPV2 packets received with cause Request Accept.')
jnx_mbg_sgw_if_gtp_v2_i_cs_req_accept_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 90), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqAcceptTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqAcceptTx.setDescription('Number of GTP packets sent with cause Request Accept.')
jnx_mbg_sgw_if_gtp_v2_i_cs_accept_part_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 91), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAcceptPartRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAcceptPartRx.setDescription('Number of GTPV2 packets received with cause Accept Partial.')
jnx_mbg_sgw_if_gtp_v2_i_cs_accept_part_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 92), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAcceptPartTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAcceptPartTx.setDescription('Number of GTP packets sent with cause Accept Partial.')
jnx_mbg_sgw_if_gtp_v2_i_cs_new_ptn_pref_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 93), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNewPTNPrefRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNewPTNPrefRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Network Preference.')
jnx_mbg_sgw_if_gtp_v2_i_cs_new_ptn_pref_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 94), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNewPTNPrefTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNewPTNPrefTx.setDescription('Number of GTP packets sent with cause New PDN type due to Network Preference')
jnx_mbg_sgw_if_gtp_v2_i_cs_nptsi_adbr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 95), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx.setDescription('Number of GTPV2 packets received with cause New PDN type due to Single Address Bearer.')
jnx_mbg_sgw_if_gtp_v2_i_cs_nptsi_adbr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 96), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx.setDescription('Number of GTP packets sent with cause New PDN type due to Single Address Bearer.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ctx_not_fnd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 97), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCtxNotFndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCtxNotFndRx.setDescription('Number of GTPV2 packets received with cause Context not found.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ctx_not_fnd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 98), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCtxNotFndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCtxNotFndTx.setDescription('Number of GTP packets sent with cause Context not found.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_msg_fmt_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 99), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvMsgFmtRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvMsgFmtRx.setDescription('Number of GTPV2 packets received with cause Invalid Message Format.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_msg_fmt_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 100), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvMsgFmtTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvMsgFmtTx.setDescription('Number of GTP packets sent with cause Invalid Message Format.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ver_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 101), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsVerNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsVerNotSuppRx.setDescription('Number of GTPV2 packets received with cause Version not Supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ver_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 102), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsVerNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsVerNotSuppTx.setDescription('Number of GTP packets sent with cause Version not Supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_len_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 103), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvLenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvLenRx.setDescription('Number of GTPV2 packets received with cause Invalid Length.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_len_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 104), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvLenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvLenTx.setDescription('Number of GTP packets sent with cause Invalid Length.')
jnx_mbg_sgw_if_gtp_v2_i_cs_srv_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 105), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSrvNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSrvNotSuppRx.setDescription('Number of GTPV2 packets received with cause Service Not supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_srv_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 106), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSrvNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSrvNotSuppTx.setDescription('Number of GTP packets sent with cause Service Not supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_man_ie_incor_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 107), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEIncorRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEIncorRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE incorrect.')
jnx_mbg_sgw_if_gtp_v2_i_cs_man_ie_incor_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 108), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEIncorTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEIncorTx.setDescription('Number of GTP packets sent with cause Mandatory IE incorrect.')
jnx_mbg_sgw_if_gtp_v2_i_cs_man_ie_miss_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 109), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEMissRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEMissRx.setDescription('Number of GTPV2 packets received with cause Mandatory IE Missing.')
jnx_mbg_sgw_if_gtp_v2_i_cs_man_ie_miss_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 110), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEMissTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsManIEMissTx.setDescription('Number of GTP packets sent with cause Mandatory IE Missing.')
jnx_mbg_sgw_if_gtp_v2_i_cs_opt_ie_incor_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 111), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsOptIEIncorRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsOptIEIncorRx.setDescription('Number of GTPV2 packets received with cause Optional IE Incorrect.')
jnx_mbg_sgw_if_gtp_v2_i_cs_opt_ie_incor_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 112), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsOptIEIncorTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsOptIEIncorTx.setDescription('Number of GTP packets sent with cause Optional IE Incorrect.')
jnx_mbg_sgw_if_gtp_v2_i_cs_sys_fail_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 113), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSysFailRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSysFailRx.setDescription('Number of GTPV2 packets received with cause System Failure.')
jnx_mbg_sgw_if_gtp_v2_i_cs_sys_fail_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 114), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSysFailTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSysFailTx.setDescription('Number of GTP packets sent with cause System Failure.')
jnx_mbg_sgw_if_gtp_v2_i_cs_no_res_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 115), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoResRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoResRx.setDescription('Number of GTPV2 packets received with cause No Resource.')
jnx_mbg_sgw_if_gtp_v2_i_cs_no_res_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 116), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoResTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoResTx.setDescription('Number of GTP packets sent with cause No Resource.')
jnx_mbg_sgw_if_gtp_v2_i_cs_tftsmant_er_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 117), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSMANTErRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSMANTErRx.setDescription('Number of GTPV2 packets received with cause TFT Symantic Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_tftsmant_er_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 118), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSMANTErTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSMANTErTx.setDescription('Number of GTP packets sent with cause TFT Symantic Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_tft_sys_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 119), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSysErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSysErrRx.setDescription('Number of GTPV2 packets received with cause TFT System Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_tft_sys_err_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 120), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSysErrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsTFTSysErrTx.setDescription('Number of GTP packets sent with cause TFT System Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_pk_flt_man_er_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 121), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltManErRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltManErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Symantic Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_pk_flt_man_er_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 122), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltManErTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltManErTx.setDescription('Number of GTP packets sent with cause Packet Filter Symantic Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_pk_flt_syn_er_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 123), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltSynErRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltSynErRx.setDescription('Number of GTPV2 packets received with cause Packet Filter Syntax Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_pk_flt_syn_er_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 124), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltSynErTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPkFltSynErTx.setDescription('Number of GTP packets sent with cause Packet Filter Syntax Error.')
jnx_mbg_sgw_if_gtp_v2_i_cs_mis_unkn_apn_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 125), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsMisUnknAPNRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsMisUnknAPNRx.setDescription('Number of GTPV2 packets received with cause Unknown APN.')
jnx_mbg_sgw_if_gtp_v2_i_cs_mis_unkn_apn_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 126), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsMisUnknAPNTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsMisUnknAPNTx.setDescription('Number of GTP packets sent with cause Unknown APN.')
jnx_mbg_sgw_if_gtp_v2_i_cs_unexp_rpt_ie_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 127), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnexpRptIERx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnexpRptIERx.setDescription('Number of GTPV2 packets received with cause Unexpected Repeated IE.')
jnx_mbg_sgw_if_gtp_v2_i_cs_unexp_rpt_ie_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 128), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnexpRptIETx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnexpRptIETx.setDescription('Number of GTP packets sent with cause Unexpected Repeated IE.')
jnx_mbg_sgw_if_gtp_v2_i_cs_gre_key_nt_fd_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 129), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx.setDescription('Number of GTPV2 packets received with cause GRE Key Not Found.')
jnx_mbg_sgw_if_gtp_v2_i_cs_gre_key_nt_fd_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 130), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx.setDescription('Number of GTP packets sent with cause GRE Key Not Found.')
jnx_mbg_sgw_if_gtp_v2_i_cs_reloc_fail_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 131), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRelocFailRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRelocFailRx.setDescription('Number of GTPV2 packets received with cause Relocation Failed.')
jnx_mbg_sgw_if_gtp_v2_i_cs_reloc_fail_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 132), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRelocFailTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRelocFailTx.setDescription('Number of GTP packets sent with cause Relocation Failed.')
jnx_mbg_sgw_if_gtp_v2_i_cs_den_in_rat_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 133), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDenINRatRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDenINRatRx.setDescription('Number of GTPV2 packets received with cause Denied in RAT.')
jnx_mbg_sgw_if_gtp_v2_i_cs_den_in_rat_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 134), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDenINRatTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDenINRatTx.setDescription('Number of GTP packets sent with cause Denied in RAT.')
jnx_mbg_sgw_if_gtp_v2_i_cs_pt_not_supp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 135), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTNotSuppRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTNotSuppRx.setDescription('Number of GTPV2 packets received with cause PDN Type Not Supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_pt_not_supp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 136), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTNotSuppTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTNotSuppTx.setDescription('Number of GTP packets sent with cause PDN Type Not Supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_al_dyn_ad_occ_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 137), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAlDynAdOccRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAlDynAdOccRx.setDescription('Number of GTPV2 packets received with cause Allocated Dynamic Address Occupied.')
jnx_mbg_sgw_if_gtp_v2_i_cs_al_dyn_ad_occ_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 138), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAlDynAdOccTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAlDynAdOccTx.setDescription('Number of GTP packets sent with cause Allocated Dynamic Address Occupied.')
jnx_mbg_sgw_if_gtp_v2_i_cs_notftuectx_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 139), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx.setDescription('Number of GTPV2 packets received with cause UE Context Without TFT Exists.')
jnx_mbg_sgw_if_gtp_v2_i_cs_notftuectx_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 140), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx.setDescription('Number of GTP packets sent with cause UE Context Without TFT Exists.')
jnx_mbg_sgw_if_gtp_v2_i_cs_proto_nt_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 141), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsProtoNtSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsProtoNtSupRx.setDescription('Number of GTPV2 packets received with cause Protocol Not Supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_proto_nt_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 142), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsProtoNtSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsProtoNtSupTx.setDescription('Number of GTP packets sent with cause Protocol Not Supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ue_not_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 143), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUENotRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUENotRespRx.setDescription('Number of GTPV2 packets received with cause UE Not Responding.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ue_not_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 144), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUENotRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUENotRespTx.setDescription('Number of GTP packets sent with cause UE Not Responding.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ue_refuses_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 145), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUERefusesRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUERefusesRx.setDescription('Number of GTPV2 packets received with cause UE Refuses.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ue_refuses_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 146), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUERefusesTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUERefusesTx.setDescription('Number of GTP packets sent with cause UE Refuses.')
jnx_mbg_sgw_if_gtp_v2_i_cs_serv_denied_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 147), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsServDeniedRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsServDeniedRx.setDescription('Number of GTPV2 packets received with cause Service Denied.')
jnx_mbg_sgw_if_gtp_v2_i_cs_serv_denied_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 148), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsServDeniedTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsServDeniedTx.setDescription('Number of GTP packets sent with cause Service Denied.')
jnx_mbg_sgw_if_gtp_v2_i_cs_unab_page_ue_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 149), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnabPageUERx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnabPageUERx.setDescription('Number of GTPV2 packets received with cause Unable to Page UE.')
jnx_mbg_sgw_if_gtp_v2_i_cs_unab_page_ue_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 150), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnabPageUETx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnabPageUETx.setDescription('Number of GTP packets sent with cause Unable to Page UE.')
jnx_mbg_sgw_if_gtp_v2_i_cs_no_mem_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 151), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoMemRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoMemRx.setDescription('Number of GTPV2 packets received with cause No Memory.')
jnx_mbg_sgw_if_gtp_v2_i_cs_no_mem_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 152), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoMemTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsNoMemTx.setDescription('Number of GTP packets sent with cause No Memory.')
jnx_mbg_sgw_if_gtp_v2_i_cs_user_auth_fl_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 153), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUserAUTHFlRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUserAUTHFlRx.setDescription('Number of GTPV2 packets received with cause User AUTH Failed.')
jnx_mbg_sgw_if_gtp_v2_i_cs_user_auth_fl_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 154), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUserAUTHFlTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUserAUTHFlTx.setDescription('Number of GTP packets sent with cause User AUTH Failed.')
jnx_mbg_sgw_if_gtp_v2_i_cs_apn_acs_den_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 155), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNAcsDenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNAcsDenRx.setDescription('Number of GTPV2 packets received with cause APN Access Denied.')
jnx_mbg_sgw_if_gtp_v2_i_cs_apn_acs_den_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 156), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNAcsDenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNAcsDenTx.setDescription('Number of GTP packets sent with cause APN Access Denied.')
jnx_mbg_sgw_if_gtp_v2_i_cs_req_rej_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 157), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqRejRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqRejRx.setDescription('Number of GTPV2 packets received with cause Request Rejected.')
jnx_mbg_sgw_if_gtp_v2_i_cs_req_rej_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 158), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqRejTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsReqRejTx.setDescription('Number of GTP packets sent with cause Request Rejected.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ptmsi_sig_mm_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 159), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTMSISigMMRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTMSISigMMRx.setDescription('Number of GTPV2 packets received with cause P-TMSI Signature Mismatch.')
jnx_mbg_sgw_if_gtp_v2_i_cs_ptmsi_sig_mm_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 160), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTMSISigMMTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsPTMSISigMMTx.setDescription('Number of GTP packets sent with cause P-TMSI Signature Mismatch')
jnx_mbg_sgw_if_gtp_v2_i_cs_imsi_not_kn_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 161), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsIMSINotKnRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsIMSINotKnRx.setDescription('Number of GTPV2 packets received with cause IMSI Not Known.')
jnx_mbg_sgw_if_gtp_v2_i_cs_imsi_not_kn_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 162), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsIMSINotKnTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsIMSINotKnTx.setDescription('Number of GTP packets sent with cause IMSI Not Known.')
jnx_mbg_sgw_if_gtp_v2_i_cs_cond_ie_ms_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 163), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCondIEMsRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCondIEMsRx.setDescription('Number of GTPV2 packets received with cause Conditional IE Missing.')
jnx_mbg_sgw_if_gtp_v2_i_cs_cond_ie_ms_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 164), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCondIEMsTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCondIEMsTx.setDescription('Number of GTP packets sent with cause Conditional IE Missing.')
jnx_mbg_sgw_if_gtp_v2_i_cs_apn_res_t_inc_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 165), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNResTIncRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNResTIncRx.setDescription('Number of GTPV2 packets received with cause APN Restriction Type Incompatible.')
jnx_mbg_sgw_if_gtp_v2_i_cs_apn_res_t_inc_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 166), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNResTIncTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsAPNResTIncTx.setDescription('Number of GTP packets sent with cause APN Restriction Type Incompatible.')
jnx_mbg_sgw_if_gtp_v2_i_cs_unknown_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 167), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnknownRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnknownRx.setDescription('Number of GTPV2 packets received with cause Unknown.')
jnx_mbg_sgw_if_gtp_v2_i_cs_unknown_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 168), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnknownTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnknownTx.setDescription('Number of GTP packets sent with cause Unknown.')
jnx_mbg_sgw_if_gtp_v2_i_cs_lcl_det_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 169), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsLclDetRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsLclDetRx.setDescription('Number of GTP packets received with cause Local Detach.')
jnx_mbg_sgw_if_gtp_v2_i_cs_lcl_det_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 170), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsLclDetTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsLclDetTx.setDescription('Number of GTP packets sent with cause Local Detach.')
jnx_mbg_sgw_if_gtp_v2_i_cs_cmp_det_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 171), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCmpDetRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCmpDetRx.setDescription('Number of GTP packets received with cause Complete Detach.')
jnx_mbg_sgw_if_gtp_v2_i_cs_cmp_det_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 172), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCmpDetTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsCmpDetTx.setDescription('Number of GTP packets sent with cause Complete Detach.')
jnx_mbg_sgw_if_gtp_v2_i_cs_rat_chg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 173), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRATChgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRATChgRx.setDescription('Number of GTP packets received with cause RAT changed from 3GPP to non 3GPP.')
jnx_mbg_sgw_if_gtp_v2_i_cs_rat_chg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 174), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRATChgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRATChgTx.setDescription('Number of GTP packets sent with cause RAT changed from 3GPP to non 3GPP.')
jnx_mbg_sgw_if_gtp_v2_i_cs_isr_deact_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 175), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsISRDeactRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsISRDeactRx.setDescription('Number of GTP packets received with cause ISR Deactivated.')
jnx_mbg_sgw_if_gtp_v2_i_cs_isr_deact_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 176), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsISRDeactTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsISRDeactTx.setDescription('Number of GTP packets sent with cause ISR Deactivated.')
jnx_mbg_sgw_if_gtp_v2_i_cs_eifrnc_en_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 177), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsEIFRNCEnRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsEIFRNCEnRx.setDescription('Number of GTP packets received with cause Error Indication from RNC eNodeB.')
jnx_mbg_sgw_if_gtp_v2_i_cs_eifrnc_en_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 178), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsEIFRNCEnTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsEIFRNCEnTx.setDescription('Number of GTP packets sent with cause Error Indication from RNC eNodeB.')
jnx_mbg_sgw_if_gtp_v2_i_cs_sem_er_tad_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 179), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSemErTADRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSemErTADRx.setDescription('Number of GTP packets received with cause Semantic Error in TAD Operation.')
jnx_mbg_sgw_if_gtp_v2_i_cs_sem_er_tad_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 180), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSemErTADTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSemErTADTx.setDescription('Number of GTP packets sent with cause Semantic Error in TAD Operation.')
jnx_mbg_sgw_if_gtp_v2_i_cs_syn_er_tad_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 181), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSynErTADRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSynErTADRx.setDescription('Number of GTP packets received with cause Syntactic Error in TAD Operation.')
jnx_mbg_sgw_if_gtp_v2_i_cs_syn_er_tad_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 182), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSynErTADTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsSynErTADTx.setDescription('Number of GTP packets sent with cause Syntactic Error in TAD Operation.')
jnx_mbg_sgw_if_gtp_v2_i_cs_rm_val_rcv_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 183), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRMValRcvRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRMValRcvRx.setDescription('Number of GTP packets received with cause Reserved Message Value Received.')
jnx_mbg_sgw_if_gtp_v2_i_cs_rm_val_rcv_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 184), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRMValRcvTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRMValRcvTx.setDescription('Number of GTP packets sent with cause Reserved Message Value Received.')
jnx_mbg_sgw_if_gtp_v2_i_cs_r_pr_nt_rsp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 185), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRPrNtRspRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRPrNtRspRx.setDescription('Number of GTP packets received with cause Remote peer not responding.')
jnx_mbg_sgw_if_gtp_v2_i_cs_r_pr_nt_rsp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 186), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRPrNtRspTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsRPrNtRspTx.setDescription('Number of GTP packets sent with cause Remote peer not responding.')
jnx_mbg_sgw_if_gtp_v2_i_cs_col_nw_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 187), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsColNWReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsColNWReqRx.setDescription('Number of GTP packets received with cause Collision with network initiated request.')
jnx_mbg_sgw_if_gtp_v2_i_cs_col_nw_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 188), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsColNWReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsColNWReqTx.setDescription('Number of GTP packets sent with cause Collision with network initiated request.')
jnx_mbg_sgw_if_gtp_v2_i_cs_un_pg_ue_sus_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 189), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnPgUESusRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnPgUESusRx.setDescription('Number of GTP packets received with cause Unable to page UE due to suspension.')
jnx_mbg_sgw_if_gtp_v2_i_cs_un_pg_ue_sus_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 190), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnPgUESusTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsUnPgUESusTx.setDescription('Number of GTP packets sent with cause Unable to page UE due to suspension.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_tot_len_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 191), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvTotLenRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvTotLenRx.setDescription('Number of GTP packets received with cause Invalid total len.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_tot_len_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 192), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvTotLenTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvTotLenTx.setDescription('Number of GTP packets sent with cause Invalid total len.')
jnx_mbg_sgw_if_gtp_v2_i_cs_dt_for_nt_sup_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 193), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDtForNtSupRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDtForNtSupRx.setDescription('Number of GTP packets received with cause Data forwarding not supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_dt_for_nt_sup_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 194), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDtForNtSupTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsDtForNtSupTx.setDescription('Number of GTP packets sent with cause Data forwarding not supported.')
jnx_mbg_sgw_if_gtp_v2_i_cs_in_re_f_re_pr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 195), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInReFRePrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInReFRePrRx.setDescription('Number of GTP packets received with cause Invalid Reply from Remote peer.')
jnx_mbg_sgw_if_gtp_v2_i_cs_in_re_f_re_pr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 196), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInReFRePrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInReFRePrTx.setDescription('Number of GTP packets sent with cause Invalid Reply from Remote peer.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_pr_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 197), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvPrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvPrRx.setDescription('Number of GTP packets received with cause Invalid peer.')
jnx_mbg_sgw_if_gtp_v2_i_cs_inv_pr_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 198), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvPrTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV2ICsInvPrTx.setDescription('Number of GTP packets sent with cause Invalid peer.')
jnx_mbg_sgw_if_gtp_v1_protocol_err_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 199), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1ProtocolErrRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1ProtocolErrRx.setDescription('Number of GTPv1 Protocol Errors Received.')
jnx_mbg_sgw_if_gtp_v1_un_sup_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 200), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1UnSupMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1UnSupMsgRx.setDescription('Number of GTPv1 Unsupported Messages received.')
jnx_mbg_sgw_if_gtp_v1_t3_resp_tmr_exp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 201), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1T3RespTmrExpRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1T3RespTmrExpRx.setDescription('Number of GTP V1 T3 timer expiries Received.')
jnx_mbg_sgw_if_gtp_v1_end_marker_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 202), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EndMarkerRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EndMarkerRx.setDescription('Number of GTP V1 end marker packets received.')
jnx_mbg_sgw_if_gtp_v1_end_marker_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 203), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EndMarkerTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EndMarkerTx.setDescription('Number of GTP V1 end marker packets sent.')
jnx_mbg_sgw_if_gtp_v1_echo_req_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 204), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoReqRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoReqRx.setDescription('Number of GTP V1 echo request packets received.')
jnx_mbg_sgw_if_gtp_v1_echo_req_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 205), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoReqTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoReqTx.setDescription('Number of GTP V1 echo request packets sent.')
jnx_mbg_sgw_if_gtp_v1_echo_resp_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 206), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoRespRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoRespRx.setDescription('Number of GTP V1 echo response packets received.')
jnx_mbg_sgw_if_gtp_v1_echo_resp_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 207), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoRespTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1EchoRespTx.setDescription('Number of GTP V1 echo response packets sent.')
jnx_mbg_sgw_if_gtp_v1_err_ind_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 208), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1ErrIndRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1ErrIndRx.setDescription('Number of GTP packets V1 Error Indication packets received.')
jnx_mbg_sgw_if_gtp_v1_err_ind_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 209), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1ErrIndTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfGtpV1ErrIndTx.setDescription('Number of GTP packets V1 Error Indication packets sent.')
jnx_mbg_sgw_if_susp_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 210), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspNotifRx.setDescription('Number of GTPv2 Suspend Notification messages received.')
jnx_mbg_sgw_if_susp_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 211), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspNotifTx.setDescription('Number of GTPv2 Suspend Notification messages sent.')
jnx_mbg_sgw_if_susp_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 212), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspAckRx.setDescription('Number of GTPv2 Suspend Acknowledgement messages received.')
jnx_mbg_sgw_if_susp_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 213), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfSuspAckTx.setDescription('Number of GTPv2 Suspend Acknowledgement messages sent.')
jnx_mbg_sgw_if_resume_notif_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 214), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeNotifRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeNotifRx.setDescription('Number of GTPv2 Resume Notification messages received.')
jnx_mbg_sgw_if_resume_notif_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 215), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeNotifTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeNotifTx.setDescription('Number of GTPv2 Resume Notification messages sent.')
jnx_mbg_sgw_if_resume_ack_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 216), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeAckRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeAckRx.setDescription('Number of GTPv2 Resume Acknowledgement messages received.')
jnx_mbg_sgw_if_resume_ack_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 217), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeAckTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfResumeAckTx.setDescription('Number of GTPv2 Resume Acknowledgement messages sent.')
jnx_mbg_sgw_if_piggyback_msg_rx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 218), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfPiggybackMsgRx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfPiggybackMsgRx.setDescription('Number of GTPv2 Piggyback messages received.')
jnx_mbg_sgw_if_piggyback_msg_tx = mib_table_column((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 4, 1, 219), counter64()).setMaxAccess('readonly')
if mibBuilder.loadTexts:
jnxMbgSgwIfPiggybackMsgTx.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwIfPiggybackMsgTx.setDescription('Number of GTPv2 S11 Piggyback messages sent.')
jnx_mbg_sgw_gtp_notification_vars = mib_identifier((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3))
jnx_mbg_sgw_gtp_peer_name = mib_scalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 1), display_string()).setMaxAccess('accessiblefornotify')
if mibBuilder.loadTexts:
jnxMbgSgwGtpPeerName.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpPeerName.setDescription('GTP Peer Name/IP')
jnx_mbg_sgw_gtp_alarm_stat_counter = mib_scalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 2), unsigned32()).setMaxAccess('accessiblefornotify')
if mibBuilder.loadTexts:
jnxMbgSgwGtpAlarmStatCounter.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpAlarmStatCounter.setDescription('Current Value of (Alarm) Statistics Counter eg: in jnxMbgSgwGtpPrDNTPerPrAlrmActv it spefies the number of times peer is down with in the monitoring interval')
jnx_mbg_sgw_gtp_interface_type = mib_scalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 3), display_string()).setMaxAccess('accessiblefornotify')
if mibBuilder.loadTexts:
jnxMbgSgwGtpInterfaceType.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpInterfaceType.setDescription('GTP Interface Type which can be one of S5/S8/S11/S1U/S12/S4')
jnx_mbg_sgw_gtp_gw_name = mib_scalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 4), display_string()).setMaxAccess('accessiblefornotify')
if mibBuilder.loadTexts:
jnxMbgSgwGtpGwName.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpGwName.setDescription('A string that indicates the gateway name')
jnx_mbg_sgw_gtp_gw_index = mib_scalar((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 1, 3, 5), unsigned32()).setMaxAccess('accessiblefornotify')
if mibBuilder.loadTexts:
jnxMbgSgwGtpGwIndex.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpGwIndex.setDescription('Current Gateway ID value')
jnx_mbg_sgw_gtp_peer_gw_up_notif = notification_type((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 1)).setObjects(('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwIndex'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwName'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpInterfaceType'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpPeerName'))
if mibBuilder.loadTexts:
jnxMbgSgwGtpPeerGwUpNotif.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpPeerGwUpNotif.setDescription('GTPC Peer UP Notification. This trap is sent when a new peer is added or an existing peer goes down and comes back up.')
jnx_mbg_sgw_gtp_peer_gw_dn_notif = notification_type((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 2)).setObjects(('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwIndex'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwName'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpInterfaceType'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpPeerName'))
if mibBuilder.loadTexts:
jnxMbgSgwGtpPeerGwDnNotif.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpPeerGwDnNotif.setDescription('GTPC Peer Down Notification. This trap is sent when a peer connection goes down.')
jnx_mbg_sgw_gtp_pr_dn_t_per_pr_alrm_actv = notification_type((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 3)).setObjects(('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwIndex'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwName'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpInterfaceType'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpPeerName'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpAlarmStatCounter'))
if mibBuilder.loadTexts:
jnxMbgSgwGtpPrDnTPerPrAlrmActv.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpPrDnTPerPrAlrmActv.setDescription('Peer down Threshold trap Active. This is sent when a peer connection flaps for more than a higher threshold number of times with in a monitor interval.')
jnx_mbg_sgw_gtp_pr_dn_t_per_pr_alrm_clr = notification_type((1, 3, 6, 1, 4, 1, 2636, 3, 66, 2, 2, 0, 4)).setObjects(('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwIndex'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpGwName'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpInterfaceType'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpPeerName'), ('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', 'jnxMbgSgwGtpAlarmStatCounter'))
if mibBuilder.loadTexts:
jnxMbgSgwGtpPrDnTPerPrAlrmClr.setStatus('current')
if mibBuilder.loadTexts:
jnxMbgSgwGtpPrDnTPerPrAlrmClr.setDescription('Peer down Threshold trap Cleared. This is sent when the number of times a peer connection flaps in a monitor interval come down below the lower threshold.')
mibBuilder.exportSymbols('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', jnxMbgSgwIfGtpV2ICsPkFltManErRx=jnxMbgSgwIfGtpV2ICsPkFltManErRx, jnxMbgSgwGtpV2ICsGREKeyNtFdTx=jnxMbgSgwGtpV2ICsGREKeyNtFdTx, jnxMbgSgwPPIPProtoErrRx=jnxMbgSgwPPIPProtoErrRx, jnxMbgSgwCrtBrReqRx=jnxMbgSgwCrtBrReqRx, jnxMbgSgwPPV2NumMsgRx=jnxMbgSgwPPV2NumMsgRx, jnxMbgSgwPPGtpV2ICsTFTSMANTErRx=jnxMbgSgwPPGtpV2ICsTFTSMANTErRx, jnxMbgSgwIPProtoErrRx=jnxMbgSgwIPProtoErrRx, jnxMbgSgwPPModBrCmdRx=jnxMbgSgwPPModBrCmdRx, jnxMbgSgwGtpPeerGwUpNotif=jnxMbgSgwGtpPeerGwUpNotif, jnxMbgSgwPPGtpV2ICsCtxNotFndTx=jnxMbgSgwPPGtpV2ICsCtxNotFndTx, jnxMbgSgwGtpMib=jnxMbgSgwGtpMib, jnxMbgSgwIfUnSupportedMsgRx=jnxMbgSgwIfUnSupportedMsgRx, jnxMbgSgwPPGtpV2ICsOptIEIncorTx=jnxMbgSgwPPGtpV2ICsOptIEIncorTx, jnxMbgSgwIfGtpV1ErrIndTx=jnxMbgSgwIfGtpV1ErrIndTx, jnxMbgSgwGtpV2ICsUERefusesRx=jnxMbgSgwGtpV2ICsUERefusesRx, jnxMbgSgwPPCreateSessReqRx=jnxMbgSgwPPCreateSessReqRx, jnxMbgSgwPcktLenErrRx=jnxMbgSgwPcktLenErrRx, jnxMbgSgwGtpV2ICsOptIEIncorrTx=jnxMbgSgwGtpV2ICsOptIEIncorrTx, jnxMbgSgwPPGtpV2ICsSysFailTx=jnxMbgSgwPPGtpV2ICsSysFailTx, jnxMbgSgwGtpV2ICsUENotRespTx=jnxMbgSgwGtpV2ICsUENotRespTx, jnxMbgSgwIfGtpV2ICsManIEMissTx=jnxMbgSgwIfGtpV2ICsManIEMissTx, jnxMbgSgwPPGtpV2ICsAPNAcsDenTx=jnxMbgSgwPPGtpV2ICsAPNAcsDenTx, jnxMbgSgwPPGtpV2ICsEIFRNCEnTx=jnxMbgSgwPPGtpV2ICsEIFRNCEnTx, jnxMbgSgwPPGtpV2ICsNoResRx=jnxMbgSgwPPGtpV2ICsNoResRx, jnxMbgSgwGtpV2ICsOptIEIncorrRx=jnxMbgSgwGtpV2ICsOptIEIncorrRx, jnxMbgSgwPPUpdConnSetReqTx=jnxMbgSgwPPUpdConnSetReqTx, jnxMbgSgwUnSupportedMsgRx=jnxMbgSgwUnSupportedMsgRx, jnxMbgSgwRelAcsBrReqTx=jnxMbgSgwRelAcsBrReqTx, jnxMbgSgwPPDelBrCmdRx=jnxMbgSgwPPDelBrCmdRx, jnxMbgSgwIfCrIndTunRespTx=jnxMbgSgwIfCrIndTunRespTx, jnxMbgSgwPPCrIndTunRespRx=jnxMbgSgwPPCrIndTunRespRx, jnxMbgSgwIfGtpV2ICsTFTSMANTErRx=jnxMbgSgwIfGtpV2ICsTFTSMANTErRx, jnxMbgSgwPPModBrCmdTx=jnxMbgSgwPPModBrCmdTx, jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx=jnxMbgSgwPPGtpV2ICsNOTFTUECTXRx, jnxMbgSgwIfGtpV2ICsAcceptPartRx=jnxMbgSgwIfGtpV2ICsAcceptPartRx, jnxMbgSgwPPGtpV2ICsInvPrRx=jnxMbgSgwPPGtpV2ICsInvPrRx, PYSNMP_MODULE_ID=jnxMbgSgwGtpMib, jnxMbgSgwGtpV2ICsAPNAcsDenTx=jnxMbgSgwGtpV2ICsAPNAcsDenTx, jnxMbgSgwPPGTPUnknVerRx=jnxMbgSgwPPGTPUnknVerRx, jnxMbgSgwPPGtpV2ICsRATChgRx=jnxMbgSgwPPGtpV2ICsRATChgRx, jnxMbgSgwPPGtpV2ICsAcceptPartTx=jnxMbgSgwPPGtpV2ICsAcceptPartTx, jnxMbgSgwPPGtpV2ICsRATChgTx=jnxMbgSgwPPGtpV2ICsRATChgTx, jnxMbgSgwGtpV2ICsServDeniedTx=jnxMbgSgwGtpV2ICsServDeniedTx, jnxMbgSgwIfGtpV2ICsInvPrRx=jnxMbgSgwIfGtpV2ICsInvPrRx, jnxMbgSgwIfCrIndTunReqTx=jnxMbgSgwIfCrIndTunReqTx, jnxMbgSgwRelAcsBrRespRx=jnxMbgSgwRelAcsBrRespRx, jnxMbgSgwCreateSessRspTx=jnxMbgSgwCreateSessRspTx, jnxMbgSgwUpdBrRspTx=jnxMbgSgwUpdBrRspTx, jnxMbgSgwPPRxPacketsDropped=jnxMbgSgwPPRxPacketsDropped, jnxMbgSgwDelBrCmdRx=jnxMbgSgwDelBrCmdRx, jnxMbgSgwGtpV2ICsLclDetRx=jnxMbgSgwGtpV2ICsLclDetRx, jnxMbgSgwPPStopPagingIndTx=jnxMbgSgwPPStopPagingIndTx, jnxMbgSgwGtpPrDnTPerPrAlrmClr=jnxMbgSgwGtpPrDnTPerPrAlrmClr, jnxMbgSgwPPModBrRspRx=jnxMbgSgwPPModBrRspRx, jnxMbgSgwPPUpdBrReqRx=jnxMbgSgwPPUpdBrReqRx, jnxMbgSgwGtpV2ICsPTMSISigMMTx=jnxMbgSgwGtpV2ICsPTMSISigMMTx, jnxMbgSgwPPGtpV2ICsMisUnknAPNTx=jnxMbgSgwPPGtpV2ICsMisUnknAPNTx, jnxMbgSgwGtpV2ICsReqRejTx=jnxMbgSgwGtpV2ICsReqRejTx, jnxMbgSgwGtpV2ICsCtxNotFndRx=jnxMbgSgwGtpV2ICsCtxNotFndRx, jnxMbgSgwIfCrtBrReqTx=jnxMbgSgwIfCrtBrReqTx, jnxMbgSgwIfResumeAckTx=jnxMbgSgwIfResumeAckTx, jnxMbgSgwV2NumMsgTx=jnxMbgSgwV2NumMsgTx, jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx=jnxMbgSgwPPGtpV2ICsGREKeyNtFdTx, jnxMbgSgwPPGtpV2ICsInvMsgFmtRx=jnxMbgSgwPPGtpV2ICsInvMsgFmtRx, jnxMbgSgwIfGtpV2ICsInvTotLenTx=jnxMbgSgwIfGtpV2ICsInvTotLenTx, jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx=jnxMbgSgwIfGtpV2ICsGREKeyNtFdTx, jnxMbgSgwPPGtpV2ICsIMSINotKnTx=jnxMbgSgwPPGtpV2ICsIMSINotKnTx, jnxMbgSgwGtpV2ICsUnknownRx=jnxMbgSgwGtpV2ICsUnknownRx, jnxMbgSgwUpdConnSetRspTx=jnxMbgSgwUpdConnSetRspTx, jnxMbgSgwCreateSessReqRx=jnxMbgSgwCreateSessReqRx, jnxMbgSgwGtpV2ICsInvTotLenRx=jnxMbgSgwGtpV2ICsInvTotLenRx, jnxMbgSgwDelBrReqRx=jnxMbgSgwDelBrReqRx, jnxMbgSgwIfV2EchoRespTx=jnxMbgSgwIfV2EchoRespTx, jnxMbgSgwIfGtpV2ICsVerNotSuppTx=jnxMbgSgwIfGtpV2ICsVerNotSuppTx, jnxMbgSgwIfGtpV2ICsRPrNtRspRx=jnxMbgSgwIfGtpV2ICsRPrNtRspRx, jnxMbgSgwIfGtpV2ICsUnexpRptIETx=jnxMbgSgwIfGtpV2ICsUnexpRptIETx, jnxMbgSgwGtpV2ICsRelocFailTx=jnxMbgSgwGtpV2ICsRelocFailTx, jnxMbgSgwGtpV2ICsAllDynAdOccRx=jnxMbgSgwGtpV2ICsAllDynAdOccRx, jnxMbgSgwPPDelSessReqTx=jnxMbgSgwPPDelSessReqTx, jnxMbgSgwDelSessReqRx=jnxMbgSgwDelSessReqRx, jnxMbgSgwPPResumeAckTx=jnxMbgSgwPPResumeAckTx, jnxMbgSgwPPGtpV2ICsSynErTADTx=jnxMbgSgwPPGtpV2ICsSynErTADTx, jnxMbgSgwGtpV2ICsUserAUTHFlRx=jnxMbgSgwGtpV2ICsUserAUTHFlRx, jnxMbgSgwIfGtpV2ICsCmpDetTx=jnxMbgSgwIfGtpV2ICsCmpDetTx, jnxMbgSgwGtpV2ICsDtForNtSupRx=jnxMbgSgwGtpV2ICsDtForNtSupRx, jnxMbgSgwIfGtpV2ICsUnabPageUERx=jnxMbgSgwIfGtpV2ICsUnabPageUERx, jnxMbgSgwPPGtpV2ICsProtoNtSupRx=jnxMbgSgwPPGtpV2ICsProtoNtSupRx, jnxMbgSgwV2VerNotSupTx=jnxMbgSgwV2VerNotSupTx, jnxMbgSgwGtpV2ICsInReFRePrRx=jnxMbgSgwGtpV2ICsInReFRePrRx, jnxMbgSgwIfGtpV2ICsSysFailRx=jnxMbgSgwIfGtpV2ICsSysFailRx, jnxMbgSgwIfGtpV2ICsInReFRePrTx=jnxMbgSgwIfGtpV2ICsInReFRePrTx, jnxMbgSgwPPDlDataNotifTx=jnxMbgSgwPPDlDataNotifTx, jnxMbgSgwIfGtpV2ICsRelocFailRx=jnxMbgSgwIfGtpV2ICsRelocFailRx, jnxMbgSgwDelConnSetRspTx=jnxMbgSgwDelConnSetRspTx, jnxMbgSgwT3RespTmrExpRx=jnxMbgSgwT3RespTmrExpRx, jnxMbgSgwStopPagingIndRx=jnxMbgSgwStopPagingIndRx, jnxMbgSgwDelSessReqTx=jnxMbgSgwDelSessReqTx, jnxMbgSgwGtpV2ICsTFTSysErrRx=jnxMbgSgwGtpV2ICsTFTSysErrRx, jnxMbgSgwPPRelAcsBrRespRx=jnxMbgSgwPPRelAcsBrRespRx, jnxMbgSgwIfDelSessReqRx=jnxMbgSgwIfDelSessReqRx, jnxMbgSgwGtpV2ICsReqAcceptTx=jnxMbgSgwGtpV2ICsReqAcceptTx, jnxMbgSgwPPRelAcsBrRespTx=jnxMbgSgwPPRelAcsBrRespTx, jnxMbgSgwIfGtpV1EchoRespTx=jnxMbgSgwIfGtpV1EchoRespTx, jnxMbgSgwGtpV2ICsAcceptPartTx=jnxMbgSgwGtpV2ICsAcceptPartTx, jnxMbgSgwIfModBrReqRx=jnxMbgSgwIfModBrReqRx, jnxMbgSgwGtpCGlbStatsTable=jnxMbgSgwGtpCGlbStatsTable, jnxMbgSgwGtpV2ICsPkFltSynErrTx=jnxMbgSgwGtpV2ICsPkFltSynErrTx, jnxMbgSgwIfDelBrRspTx=jnxMbgSgwIfDelBrRspTx, jnxMbgSgwV2EchoReqRx=jnxMbgSgwV2EchoReqRx, jnxMbgSgwPPGtpV1EchoReqTx=jnxMbgSgwPPGtpV1EchoReqTx, jnxMbgSgwPPGtpV2ICsUERefusesRx=jnxMbgSgwPPGtpV2ICsUERefusesRx, jnxMbgSgwGtpV2ICsInReFRePrTx=jnxMbgSgwGtpV2ICsInReFRePrTx, jnxMbgSgwIfGtpV2ICsSrvNotSuppRx=jnxMbgSgwIfGtpV2ICsSrvNotSuppRx, jnxMbgSgwPPDelBrRspTx=jnxMbgSgwPPDelBrRspTx, jnxMbgSgwResumeAckRx=jnxMbgSgwResumeAckRx, jnxMbgSgwPPPacketAllocFail=jnxMbgSgwPPPacketAllocFail, jnxMbgSgwPPGtpV2ICsDenINRatTx=jnxMbgSgwPPGtpV2ICsDenINRatTx, jnxMbgSgwUnknMsgRx=jnxMbgSgwUnknMsgRx, jnxMbgSgwPPDelIndTunRespTx=jnxMbgSgwPPDelIndTunRespTx, jnxMbgSgwIfGtpV2ICsUnexpRptIERx=jnxMbgSgwIfGtpV2ICsUnexpRptIERx, jnxMbgSgwIfCrtBrRspTx=jnxMbgSgwIfCrtBrRspTx, jnxMbgSgwGtpV2ICsNewPTNPrefTx=jnxMbgSgwGtpV2ICsNewPTNPrefTx, jnxMbgSgwIfGtpV2ICsUnknownRx=jnxMbgSgwIfGtpV2ICsUnknownRx, jnxMbgSgwGtpPrDnTPerPrAlrmActv=jnxMbgSgwGtpPrDnTPerPrAlrmActv, jnxMbgSgwPPGtpV2ICsPkFltManErRx=jnxMbgSgwPPGtpV2ICsPkFltManErRx, jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx=jnxMbgSgwPPGtpV2ICsNPTSIAdbrTx, jnxMbgSgwIfDelBrFlrIndTx=jnxMbgSgwIfDelBrFlrIndTx, jnxMbgSgwIfGtpV2ICsPkFltManErTx=jnxMbgSgwIfGtpV2ICsPkFltManErTx, jnxMbgSgwStopPagingIndTx=jnxMbgSgwStopPagingIndTx, jnxMbgSgwGtpV2ICsProtoNtSupTx=jnxMbgSgwGtpV2ICsProtoNtSupTx, jnxMbgSgwIfRelAcsBrReqRx=jnxMbgSgwIfRelAcsBrReqRx, jnxMbgSgwGtpV2ICsCmpDetRx=jnxMbgSgwGtpV2ICsCmpDetRx, jnxMbgSgwIfDelBrRspRx=jnxMbgSgwIfDelBrRspRx, jnxMbgSgwPPDelIndTunRespRx=jnxMbgSgwPPDelIndTunRespRx, jnxMbgSgwPPGtpV1UnSupMsgRx=jnxMbgSgwPPGtpV1UnSupMsgRx, jnxMbgSgwPPGtpV1EchoReqRx=jnxMbgSgwPPGtpV1EchoReqRx, jnxMbgSgwIfGtpV2ICsPkFltSynErTx=jnxMbgSgwIfGtpV2ICsPkFltSynErTx, jnxMbgSgwIfCrIndTunReqRx=jnxMbgSgwIfCrIndTunReqRx, jnxMbgSgwGtpV2ICsManIEIncorrTx=jnxMbgSgwGtpV2ICsManIEIncorrTx, jnxMbgSgwIfGtpV2ICsManIEMissRx=jnxMbgSgwIfGtpV2ICsManIEMissRx, jnxMbgSgwPPCreateSessReqTx=jnxMbgSgwPPCreateSessReqTx, jnxMbgSgwIfDelConnSetReqTx=jnxMbgSgwIfDelConnSetReqTx, jnxMbgSgwPPGtpV2ICsPTNotSuppTx=jnxMbgSgwPPGtpV2ICsPTNotSuppTx, jnxMbgSgwPPDlDataAckTx=jnxMbgSgwPPDlDataAckTx, jnxMbgSgwIfDelConnSetRspTx=jnxMbgSgwIfDelConnSetRspTx, jnxMbgSgwPPModBrReqRx=jnxMbgSgwPPModBrReqRx, jnxMbgSgwRxPacketsDropped=jnxMbgSgwRxPacketsDropped, jnxMbgSgwIfGtpV2ICsColNWReqTx=jnxMbgSgwIfGtpV2ICsColNWReqTx, jnxMbgSgwPPGtpV2ICsUnPgUESusRx=jnxMbgSgwPPGtpV2ICsUnPgUESusRx, jnxMbgSgwDelConnSetReqTx=jnxMbgSgwDelConnSetReqTx, jnxMbgSgwGtpV1EchoReqTx=jnxMbgSgwGtpV1EchoReqTx, jnxMbgSgwPPCrtBrRspRx=jnxMbgSgwPPCrtBrRspRx, jnxMbgSgwIfStopPagingIndRx=jnxMbgSgwIfStopPagingIndRx, jnxMbgSgwIfGtpV2ICsLclDetRx=jnxMbgSgwIfGtpV2ICsLclDetRx, jnxMbgSgwIfModBrRspRx=jnxMbgSgwIfModBrRspRx, jnxMbgSgwS11PiggybackMsgTx=jnxMbgSgwS11PiggybackMsgTx, jnxMbgSgwGtpV2ICsSynErTADRx=jnxMbgSgwGtpV2ICsSynErTADRx, jnxMbgSgwPPGtpV2ICsISRDeactTx=jnxMbgSgwPPGtpV2ICsISRDeactTx, jnxMbgSgwIfGtpV2ICsUnPgUESusTx=jnxMbgSgwIfGtpV2ICsUnPgUESusTx, jnxMbgSgwGtpV2ICsUnexpRptIERx=jnxMbgSgwGtpV2ICsUnexpRptIERx, jnxMbgSgwGtpV2ICsUnabPageUETx=jnxMbgSgwGtpV2ICsUnabPageUETx, jnxMbgSgwGtpV2ICsRATChgRx=jnxMbgSgwGtpV2ICsRATChgRx, jnxMbgSgwGtpV2ICsColNWReqTx=jnxMbgSgwGtpV2ICsColNWReqTx, jnxMbgSgwPPGtpV2ICsDtForNtSupRx=jnxMbgSgwPPGtpV2ICsDtForNtSupRx, jnxMbgSgwPPDelConnSetRspRx=jnxMbgSgwPPDelConnSetRspRx, jnxMbgSgwPPResumeNotifRx=jnxMbgSgwPPResumeNotifRx, jnxMbgSgwIfCrtBrRspRx=jnxMbgSgwIfCrtBrRspRx, jnxMbgSgwIfGtpV2ICsInvLenRx=jnxMbgSgwIfGtpV2ICsInvLenRx, jnxMbgSgwPPGtpV2ICsPTNotSuppRx=jnxMbgSgwPPGtpV2ICsPTNotSuppRx, jnxMbgSgwPPGtpV2ICsRMValRcvTx=jnxMbgSgwPPGtpV2ICsRMValRcvTx, jnxMbgSgwPPGtpV2ICsMisUnknAPNRx=jnxMbgSgwPPGtpV2ICsMisUnknAPNRx, jnxMbgSgwGtpV2ICsDeniedINRatRx=jnxMbgSgwGtpV2ICsDeniedINRatRx, jnxMbgSgwGtpV2ICsManIEIncorrRx=jnxMbgSgwGtpV2ICsManIEIncorrRx, jnxMbgSgwGtpV2ICsReqRejRx=jnxMbgSgwGtpV2ICsReqRejRx, jnxMbgSgwPPPiggybackMsgTx=jnxMbgSgwPPPiggybackMsgTx, jnxMbgSgwPPGtpV2ICsInvLenRx=jnxMbgSgwPPGtpV2ICsInvLenRx, jnxMbgSgwIfGtpV2ICsEIFRNCEnRx=jnxMbgSgwIfGtpV2ICsEIFRNCEnRx, jnxMbgSgwPPBrResFlrIndTx=jnxMbgSgwPPBrResFlrIndTx, jnxMbgSgwIfModBrCmdRx=jnxMbgSgwIfModBrCmdRx, jnxMbgSgwIfDelIndTunRespRx=jnxMbgSgwIfDelIndTunRespRx, jnxMbgSgwGtpV1EchoReqRx=jnxMbgSgwGtpV1EchoReqRx, jnxMbgSgwIfDelBrReqTx=jnxMbgSgwIfDelBrReqTx, jnxMbgSgwIfGtpV2ICsUserAUTHFlTx=jnxMbgSgwIfGtpV2ICsUserAUTHFlTx, jnxMbgSgwIfGtpV2ICsCmpDetRx=jnxMbgSgwIfGtpV2ICsCmpDetRx, jnxMbgSgwIfSuspAckTx=jnxMbgSgwIfSuspAckTx, jnxMbgSgwGtpV2ICsCtxNotFndTx=jnxMbgSgwGtpV2ICsCtxNotFndTx, jnxMbgSgwPPGtpV1ErrIndTx=jnxMbgSgwPPGtpV1ErrIndTx, jnxMbgSgwGtpV2ICsUERefusesTx=jnxMbgSgwGtpV2ICsUERefusesTx, jnxMbgSgwPPCrIndTunRespTx=jnxMbgSgwPPCrIndTunRespTx, jnxMbgSgwPPIPVerErrRx=jnxMbgSgwPPIPVerErrRx, jnxMbgSgwIfUpdBrReqTx=jnxMbgSgwIfUpdBrReqTx, jnxMbgSgwIfGtpV2ICsCtxNotFndRx=jnxMbgSgwIfGtpV2ICsCtxNotFndRx, jnxMbgSgwIfGtpV2ICsTFTSysErrTx=jnxMbgSgwIfGtpV2ICsTFTSysErrTx, jnxMbgSgwGtpV2ICsLclDetTx=jnxMbgSgwGtpV2ICsLclDetTx, jnxMbgSgwPPGtpV2ICsPkFltManErTx=jnxMbgSgwPPGtpV2ICsPkFltManErTx, jnxMbgSgwPPGtpV2ICsUENotRespTx=jnxMbgSgwPPGtpV2ICsUENotRespTx, jnxMbgSgwGtpV1ErrIndRx=jnxMbgSgwGtpV1ErrIndRx, jnxMbgSgwIfModBrFlrIndTx=jnxMbgSgwIfModBrFlrIndTx, jnxMbgSgwPPGtpV2ICsPTMSISigMMTx=jnxMbgSgwPPGtpV2ICsPTMSISigMMTx, jnxMbgSgwIfGtpV2ICsSemErTADTx=jnxMbgSgwIfGtpV2ICsSemErTADTx, jnxMbgSgwPPUnSupportedMsgRx=jnxMbgSgwPPUnSupportedMsgRx, jnxMbgSgwIfDelSessRspTx=jnxMbgSgwIfDelSessRspTx, jnxMbgSgwIfGTPUnknVerRx=jnxMbgSgwIfGTPUnknVerRx, jnxMbgSgwPPGTPPortErrRx=jnxMbgSgwPPGTPPortErrRx, jnxMbgSgwIfGtpV2ICsUERefusesTx=jnxMbgSgwIfGtpV2ICsUERefusesTx, jnxMbgSgwDelBrFlrIndRx=jnxMbgSgwDelBrFlrIndRx, jnxMbgSgwS4PiggybackMsgTx=jnxMbgSgwS4PiggybackMsgTx, jnxMbgSgwIfGtpV1EndMarkerRx=jnxMbgSgwIfGtpV1EndMarkerRx, jnxMbgSgwGtpV2ICsGREKeyNtFdRx=jnxMbgSgwGtpV2ICsGREKeyNtFdRx, jnxMbgSgwGtpV2ICsTFTSMANTErTx=jnxMbgSgwGtpV2ICsTFTSMANTErTx, jnxMbgSgwIfBrResCmdTx=jnxMbgSgwIfBrResCmdTx, jnxMbgSgwPPResumeNotifTx=jnxMbgSgwPPResumeNotifTx, jnxMbgSgwIfGtpV2ICsPTNotSuppRx=jnxMbgSgwIfGtpV2ICsPTNotSuppRx, jnxMbgSgwIfGtpV2ICsSrvNotSuppTx=jnxMbgSgwIfGtpV2ICsSrvNotSuppTx, jnxMbgSgwPPGtpV2ICsInReFRePrTx=jnxMbgSgwPPGtpV2ICsInReFRePrTx, jnxMbgSgwPPDelBrFlrIndTx=jnxMbgSgwPPDelBrFlrIndTx, jnxMbgSgwIfGtpV2ICsTFTSysErrRx=jnxMbgSgwIfGtpV2ICsTFTSysErrRx, jnxMbgSgwIfGTPPortErrRx=jnxMbgSgwIfGTPPortErrRx, jnxMbgSgwPPGtpV2ICsSynErTADRx=jnxMbgSgwPPGtpV2ICsSynErTADRx, jnxMbgSgwPPGtpV2ICsPTMSISigMMRx=jnxMbgSgwPPGtpV2ICsPTMSISigMMRx, jnxMbgSgwGtpV2ICsInvMsgFmtTx=jnxMbgSgwGtpV2ICsInvMsgFmtTx, jnxMbgSgwPPGtpV2ICsInvPrTx=jnxMbgSgwPPGtpV2ICsInvPrTx, jnxMbgSgwIfV2NumBytesTx=jnxMbgSgwIfV2NumBytesTx, jnxMbgSgwIfGtpV2ICsUnPgUESusRx=jnxMbgSgwIfGtpV2ICsUnPgUESusRx, jnxMbgSgwPPGtpV1EchoRespRx=jnxMbgSgwPPGtpV1EchoRespRx, jnxMbgSgwGtpV2ICsPageTx=jnxMbgSgwGtpV2ICsPageTx, jnxMbgSgwGtpV2ICsNewPTSIAdbrRx=jnxMbgSgwGtpV2ICsNewPTSIAdbrRx, jnxMbgSgwIfGtpV2ICsAPNAcsDenRx=jnxMbgSgwIfGtpV2ICsAPNAcsDenRx, jnxMbgSgwIfModBrFlrIndRx=jnxMbgSgwIfModBrFlrIndRx, jnxMbgSgwS5PiggybackMsgRx=jnxMbgSgwS5PiggybackMsgRx, jnxMbgSgwIfGtpV2ICsInvMsgFmtRx=jnxMbgSgwIfGtpV2ICsInvMsgFmtRx, jnxMbgSgwGtpV2ICsPTMSISigMMRx=jnxMbgSgwGtpV2ICsPTMSISigMMRx, jnxMbgSgwIfGtpV2ICsRATChgTx=jnxMbgSgwIfGtpV2ICsRATChgTx, jnxMbgSgwPPGtpV2ICsUnknownRx=jnxMbgSgwPPGtpV2ICsUnknownRx, jnxMbgSgwPPDelSessReqRx=jnxMbgSgwPPDelSessReqRx, jnxMbgSgwPPT3RespTmrExpRx=jnxMbgSgwPPT3RespTmrExpRx, jnxMbgSgwIfGtpV2ICsLclDetTx=jnxMbgSgwIfGtpV2ICsLclDetTx, jnxMbgSgwGtpV2ICsServNotSuppRx=jnxMbgSgwGtpV2ICsServNotSuppRx, jnxMbgSgwPPDelConnSetRspTx=jnxMbgSgwPPDelConnSetRspTx, jnxMbgSgwPacketSendFail=jnxMbgSgwPacketSendFail, jnxMbgSgwIfModBrCmdTx=jnxMbgSgwIfModBrCmdTx, jnxMbgSgwGtpV2ICsNoMemTx=jnxMbgSgwGtpV2ICsNoMemTx, jnxMbgSgwIfGtpV2ICsIMSINotKnTx=jnxMbgSgwIfGtpV2ICsIMSINotKnTx, jnxMbgSgwPPGtpV2ICsVerNotSuppRx=jnxMbgSgwPPGtpV2ICsVerNotSuppRx, jnxMbgSgwGtpV2ICsRMValRcvTx=jnxMbgSgwGtpV2ICsRMValRcvTx, jnxMbgSgwIfGtpV2ICsDtForNtSupRx=jnxMbgSgwIfGtpV2ICsDtForNtSupRx, jnxMbgSgwIfUpdBrReqRx=jnxMbgSgwIfUpdBrReqRx, jnxMbgSgwModBrFlrIndTx=jnxMbgSgwModBrFlrIndTx, jnxMbgSgwDlDataNotifTx=jnxMbgSgwDlDataNotifTx, jnxMbgSgwGtpV2ICsPkFltSynErrRx=jnxMbgSgwGtpV2ICsPkFltSynErrRx, jnxMbgSgwPPGtpV2ICsManIEMissRx=jnxMbgSgwPPGtpV2ICsManIEMissRx, jnxMbgSgwCrIndTunRespTx=jnxMbgSgwCrIndTunRespTx, jnxMbgSgwPPCrtBrReqTx=jnxMbgSgwPPCrtBrReqTx, jnxMbgSgwPPGtpV2ICsServDeniedRx=jnxMbgSgwPPGtpV2ICsServDeniedRx)
mibBuilder.exportSymbols('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', jnxMbgSgwBrResFlrIndRx=jnxMbgSgwBrResFlrIndRx, jnxMbgSgwPPModBrReqTx=jnxMbgSgwPPModBrReqTx, jnxMbgSgwIfDlDataAckRx=jnxMbgSgwIfDlDataAckRx, jnxMbgSgwIfGtpV2ICsUENotRespTx=jnxMbgSgwIfGtpV2ICsUENotRespTx, jnxMbgSgwGtpV2ICsRelocFailRx=jnxMbgSgwGtpV2ICsRelocFailRx, jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx=jnxMbgSgwPPGtpV2ICsNOTFTUECTXTx, jnxMbgSgwDelConnSetRspRx=jnxMbgSgwDelConnSetRspRx, jnxMbgSgwGtpV1EndMarkerTx=jnxMbgSgwGtpV1EndMarkerTx, jnxMbgSgwPPSuspNotifRx=jnxMbgSgwPPSuspNotifRx, jnxMbgSgwGtpV2ICsUnexpRptIETx=jnxMbgSgwGtpV2ICsUnexpRptIETx, jnxMbgSgwIfGtpV2ICsReqRejRx=jnxMbgSgwIfGtpV2ICsReqRejRx, jnxMbgSgwModBrRspTx=jnxMbgSgwModBrRspTx, jnxMbgSgwGtpV2ICsAcceptPartRx=jnxMbgSgwGtpV2ICsAcceptPartRx, jnxMbgSgwIfSuspNotifRx=jnxMbgSgwIfSuspNotifRx, jnxMbgSgwPPV2NumMsgTx=jnxMbgSgwPPV2NumMsgTx, jnxMbgSgwPPGtpV2ICsNoMemTx=jnxMbgSgwPPGtpV2ICsNoMemTx, jnxMbgSgwIfGtpV2ICsReqAcceptRx=jnxMbgSgwIfGtpV2ICsReqAcceptRx, jnxMbgSgwPPPcktLenErrRx=jnxMbgSgwPPPcktLenErrRx, jnxMbgSgwBrResCmdTx=jnxMbgSgwBrResCmdTx, jnxMbgSgwIfGtpV2ICsCondIEMsTx=jnxMbgSgwIfGtpV2ICsCondIEMsTx, jnxMbgSgwGtpV2ICsInvLenRx=jnxMbgSgwGtpV2ICsInvLenRx, jnxMbgSgwPPGtpV1T3RespTmrExpRx=jnxMbgSgwPPGtpV1T3RespTmrExpRx, jnxMbgSgwPPGtpV2ICsRMValRcvRx=jnxMbgSgwPPGtpV2ICsRMValRcvRx, jnxMbgSgwS5PiggybackMsgTx=jnxMbgSgwS5PiggybackMsgTx, jnxMbgSgwIfDelIndTunReqTx=jnxMbgSgwIfDelIndTunReqTx, jnxMbgSgwIfDelBrCmdTx=jnxMbgSgwIfDelBrCmdTx, jnxMbgSgwIfGtpV2ICsMisUnknAPNRx=jnxMbgSgwIfGtpV2ICsMisUnknAPNRx, jnxMbgSgwPPGtpV2ICsNoMemRx=jnxMbgSgwPPGtpV2ICsNoMemRx, jnxMbgSgwPPUpdConnSetReqRx=jnxMbgSgwPPUpdConnSetReqRx, jnxMbgSgwDlDataNotiFlrIndRx=jnxMbgSgwDlDataNotiFlrIndRx, jnxMbgSgwPPDlDataNotiFlrIndRx=jnxMbgSgwPPDlDataNotiFlrIndRx, jnxMbgSgwIfV2VerNotSupTx=jnxMbgSgwIfV2VerNotSupTx, jnxMbgSgwPPGtpV2ICsIMSINotKnRx=jnxMbgSgwPPGtpV2ICsIMSINotKnRx, jnxMbgSgwPPRelAcsBrReqRx=jnxMbgSgwPPRelAcsBrReqRx, jnxMbgSgwPPGtpV2ICsInReFRePrRx=jnxMbgSgwPPGtpV2ICsInReFRePrRx, jnxMbgSgwGtpV2ICsPageRx=jnxMbgSgwGtpV2ICsPageRx, jnxMbgSgwIfResumeNotifTx=jnxMbgSgwIfResumeNotifTx, jnxMbgSgwPPGtpV2ICsUnabPageUERx=jnxMbgSgwPPGtpV2ICsUnabPageUERx, jnxMbgSgwIfRxPacketsDropped=jnxMbgSgwIfRxPacketsDropped, jnxMbgSgwGtpV1EchoRespTx=jnxMbgSgwGtpV1EchoRespTx, jnxMbgSgwPPGtpV2ICsUserAUTHFlRx=jnxMbgSgwPPGtpV2ICsUserAUTHFlRx, jnxMbgSgwIfCreateSessReqTx=jnxMbgSgwIfCreateSessReqTx, jnxMbgSgwPPDelIndTunReqTx=jnxMbgSgwPPDelIndTunReqTx, jnxMbgSgwIfDelIndTunReqRx=jnxMbgSgwIfDelIndTunReqRx, jnxMbgSgwPPGtpV2ICsAcceptPartRx=jnxMbgSgwPPGtpV2ICsAcceptPartRx, jnxMbgSgwPPV2EchoRespTx=jnxMbgSgwPPV2EchoRespTx, jnxMbgSgwPPGtpV2ICsColNWReqTx=jnxMbgSgwPPGtpV2ICsColNWReqTx, jnxMbgSgwGtpV2ICsCondIEMsRx=jnxMbgSgwGtpV2ICsCondIEMsRx, jnxMbgSgwGTPPortErrRx=jnxMbgSgwGTPPortErrRx, jnxMbgSgwIfGtpV2ICsInReFRePrRx=jnxMbgSgwIfGtpV2ICsInReFRePrRx, jnxMbgSgwPPGtpV2ICsPkFltSynErTx=jnxMbgSgwPPGtpV2ICsPkFltSynErTx, jnxMbgSgwIfGtpV2ICsUENotRespRx=jnxMbgSgwIfGtpV2ICsUENotRespRx, jnxMbgSgwDelBrRspRx=jnxMbgSgwDelBrRspRx, jnxMbgSgwIfType=jnxMbgSgwIfType, jnxMbgSgwIfGtpV2ICsServDeniedTx=jnxMbgSgwIfGtpV2ICsServDeniedTx, jnxMbgSgwSuspAckRx=jnxMbgSgwSuspAckRx, jnxMbgSgwPPGtpV2ICsManIEIncorTx=jnxMbgSgwPPGtpV2ICsManIEIncorTx, jnxMbgSgwIfGtpV2ICsISRDeactRx=jnxMbgSgwIfGtpV2ICsISRDeactRx, jnxMbgSgwGtpIfStatsEntry=jnxMbgSgwGtpIfStatsEntry, jnxMbgSgwIfGtpV2ICsServDeniedRx=jnxMbgSgwIfGtpV2ICsServDeniedRx, jnxMbgSgwGtpV2ICsNoResTx=jnxMbgSgwGtpV2ICsNoResTx, jnxMbgSgwPPGtpV2ICsReqAcceptRx=jnxMbgSgwPPGtpV2ICsReqAcceptRx, jnxMbgSgwDelBrCmdTx=jnxMbgSgwDelBrCmdTx, jnxMbgSgwGtpV2ICsNoMemRx=jnxMbgSgwGtpV2ICsNoMemRx, jnxMbgSgwGtpV2ICsUnPgUESusTx=jnxMbgSgwGtpV2ICsUnPgUESusTx, jnxMbgSgwIfDelConnSetRspRx=jnxMbgSgwIfDelConnSetRspRx, jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx=jnxMbgSgwIfGtpV2ICsNOTFTUECTXTx, jnxMbgSgwPPDelIndTunReqRx=jnxMbgSgwPPDelIndTunReqRx, jnxMbgSgwIfGtpV2ICsPTNotSuppTx=jnxMbgSgwIfGtpV2ICsPTNotSuppTx, jnxMbgSgwCrtBrRspRx=jnxMbgSgwCrtBrRspRx, jnxMbgSgwGtpV2ICsInvLenTx=jnxMbgSgwGtpV2ICsInvLenTx, jnxMbgSgwGtpV2ICsNewPTNPrefRx=jnxMbgSgwGtpV2ICsNewPTNPrefRx, jnxMbgSgwGtpV2ICsIMSINotKnRx=jnxMbgSgwGtpV2ICsIMSINotKnRx, jnxMbgSgwIfCreateSessRspRx=jnxMbgSgwIfCreateSessRspRx, jnxMbgSgwIfDelSessRspRx=jnxMbgSgwIfDelSessRspRx, jnxMbgSgwGtpV2ICsEIFRNCEnTx=jnxMbgSgwGtpV2ICsEIFRNCEnTx, jnxMbgSgwIfBrResFlrIndRx=jnxMbgSgwIfBrResFlrIndRx, jnxMbgSgwIfGtpV2ICsColNWReqRx=jnxMbgSgwIfGtpV2ICsColNWReqRx, jnxMbgSgwIfProtocolErrRx=jnxMbgSgwIfProtocolErrRx, jnxMbgSgwGtpV2ICsInvPrTx=jnxMbgSgwGtpV2ICsInvPrTx, jnxMbgSgwGtpNotifications=jnxMbgSgwGtpNotifications, jnxMbgSgwGtpV2ICsPkFltManErrTx=jnxMbgSgwGtpV2ICsPkFltManErrTx, jnxMbgSgwPPGtpV2ICsNewPTNPrefRx=jnxMbgSgwPPGtpV2ICsNewPTNPrefRx, jnxMbgSgwGtpV2ICsRPrNtRspTx=jnxMbgSgwGtpV2ICsRPrNtRspTx, jnxMbgSgwRelAcsBrRespTx=jnxMbgSgwRelAcsBrRespTx, jnxMbgSgwGtpV2ICsAPNResTIncTx=jnxMbgSgwGtpV2ICsAPNResTIncTx, jnxMbgSgwPPGtpV2ICsCondIEMsTx=jnxMbgSgwPPGtpV2ICsCondIEMsTx, jnxMbgSgwUpdConnSetReqTx=jnxMbgSgwUpdConnSetReqTx, jnxMbgSgwPPGtpV2ICsAPNResTIncRx=jnxMbgSgwPPGtpV2ICsAPNResTIncRx, jnxMbgSgwGtpV2ICsServNotSuppTx=jnxMbgSgwGtpV2ICsServNotSuppTx, jnxMbgSgwUpdBrRspRx=jnxMbgSgwUpdBrRspRx, jnxMbgSgwDelIndTunReqTx=jnxMbgSgwDelIndTunReqTx, jnxMbgSgwIfGtpV2ICsNewPTNPrefRx=jnxMbgSgwIfGtpV2ICsNewPTNPrefRx, jnxMbgSgwDelConnSetReqRx=jnxMbgSgwDelConnSetReqRx, jnxMbgSgwGtpV2ICsInvPrRx=jnxMbgSgwGtpV2ICsInvPrRx, jnxMbgSgwIfGtpV1EndMarkerTx=jnxMbgSgwIfGtpV1EndMarkerTx, jnxMbgSgwBrResFlrIndTx=jnxMbgSgwBrResFlrIndTx, jnxMbgSgwIPVerErrRx=jnxMbgSgwIPVerErrRx, jnxMbgSgwIfGtpV1T3RespTmrExpRx=jnxMbgSgwIfGtpV1T3RespTmrExpRx, jnxMbgSgwIfModBrRspTx=jnxMbgSgwIfModBrRspTx, jnxMbgSgwPPGtpV2ICsProtoNtSupTx=jnxMbgSgwPPGtpV2ICsProtoNtSupTx, jnxMbgSgwIfGtpV2ICsInvMsgFmtTx=jnxMbgSgwIfGtpV2ICsInvMsgFmtTx, jnxMbgSgwPPSuspAckTx=jnxMbgSgwPPSuspAckTx, jnxMbgSgwGtpV2ICsNOTFTUECTXRx=jnxMbgSgwGtpV2ICsNOTFTUECTXRx, jnxMbgSgwPPGtpV2ICsOptIEIncorRx=jnxMbgSgwPPGtpV2ICsOptIEIncorRx, jnxMbgSgwUpdConnSetRspRx=jnxMbgSgwUpdConnSetRspRx, jnxMbgSgwGtpV2ICsPTNotSuppRx=jnxMbgSgwGtpV2ICsPTNotSuppRx, jnxMbgSgwPPGtpV2ICsAPNAcsDenRx=jnxMbgSgwPPGtpV2ICsAPNAcsDenRx, jnxMbgSgwPPGtpV2ICsUnexpRptIERx=jnxMbgSgwPPGtpV2ICsUnexpRptIERx, jnxMbgSgwCreateSessRspRx=jnxMbgSgwCreateSessRspRx, jnxMbgSgwIfGtpV1UnSupMsgRx=jnxMbgSgwIfGtpV1UnSupMsgRx, jnxMbgSgwUpdBrReqTx=jnxMbgSgwUpdBrReqTx, jnxMbgSgwPPGtpV2ICsServNotSupRx=jnxMbgSgwPPGtpV2ICsServNotSupRx, jnxMbgSgwIfGtpV2ICsUERefusesRx=jnxMbgSgwIfGtpV2ICsUERefusesRx, jnxMbgSgwPPGtpV2ICsRPrNtRspTx=jnxMbgSgwPPGtpV2ICsRPrNtRspTx, jnxMbgSgwIfGtpV1EchoReqTx=jnxMbgSgwIfGtpV1EchoReqTx, jnxMbgSgwPPGtpV2ICsCmpDetRx=jnxMbgSgwPPGtpV2ICsCmpDetRx, jnxMbgSgwCrIndTunRespRx=jnxMbgSgwCrIndTunRespRx, jnxMbgSgwIfGtpV2ICsOptIEIncorRx=jnxMbgSgwIfGtpV2ICsOptIEIncorRx, jnxMbgSgwPPGtpV2ICsCmpDetTx=jnxMbgSgwPPGtpV2ICsCmpDetTx, jnxMbgSgwGtpAlarmStatCounter=jnxMbgSgwGtpAlarmStatCounter, jnxMbgSgwPPV2EchoReqRx=jnxMbgSgwPPV2EchoReqRx, jnxMbgSgwDlDataAckRx=jnxMbgSgwDlDataAckRx, jnxMbgSgwIfIPVerErrRx=jnxMbgSgwIfIPVerErrRx, jnxMbgSgwPPStopPagingIndRx=jnxMbgSgwPPStopPagingIndRx, jnxMbgSgwGtpV2ICsInvTotLenTx=jnxMbgSgwGtpV2ICsInvTotLenTx, jnxMbgSgwIfModBrReqTx=jnxMbgSgwIfModBrReqTx, jnxMbgSgwGtpV1ProtocolErrRx=jnxMbgSgwGtpV1ProtocolErrRx, jnxMbgSgwGtpV2ICsUENotRespRx=jnxMbgSgwGtpV2ICsUENotRespRx, jnxMbgSgwIfGtpV2ICsManIEIncorRx=jnxMbgSgwIfGtpV2ICsManIEIncorRx, jnxMbgSgwPPGtpV2ICsUnexpRptIETx=jnxMbgSgwPPGtpV2ICsUnexpRptIETx, jnxMbgSgwIfGtpV2ICsPkFltSynErRx=jnxMbgSgwIfGtpV2ICsPkFltSynErRx, jnxMbgSgwPPDlDataNotifRx=jnxMbgSgwPPDlDataNotifRx, jnxMbgSgwGtpV2ICsCondIEMsTx=jnxMbgSgwGtpV2ICsCondIEMsTx, jnxMbgSgwDelIndTunRespTx=jnxMbgSgwDelIndTunRespTx, jnxMbgSgwPPGtpV2ICsDenINRatRx=jnxMbgSgwPPGtpV2ICsDenINRatRx, jnxMbgSgwGtpPeerGwDnNotif=jnxMbgSgwGtpPeerGwDnNotif, jnxMbgSgwGtpV2ICsPkFltManErrRx=jnxMbgSgwGtpV2ICsPkFltManErrRx, jnxMbgSgwV2NumMsgRx=jnxMbgSgwV2NumMsgRx, jnxMbgSgwPPModBrFlrIndTx=jnxMbgSgwPPModBrFlrIndTx, jnxMbgSgwIfUpdConnSetReqRx=jnxMbgSgwIfUpdConnSetReqRx, jnxMbgSgwGtpObjects=jnxMbgSgwGtpObjects, jnxMbgSgwGtpV2ICsSynErTADTx=jnxMbgSgwGtpV2ICsSynErTADTx, jnxMbgSgwIfPacketAllocFail=jnxMbgSgwIfPacketAllocFail, jnxMbgSgwIfCreateSessReqRx=jnxMbgSgwIfCreateSessReqRx, jnxMbgSgwPPCrIndTunReqRx=jnxMbgSgwPPCrIndTunReqRx, jnxMbgSgwCrtBrRspTx=jnxMbgSgwCrtBrRspTx, jnxMbgSgwPPV2NumBytesTx=jnxMbgSgwPPV2NumBytesTx, jnxMbgSgwGtpIfStatsTable=jnxMbgSgwGtpIfStatsTable, jnxMbgSgwGtpV2ICsColNWReqRx=jnxMbgSgwGtpV2ICsColNWReqRx, jnxMbgSgwPPGtpV2ICsUserAUTHFlTx=jnxMbgSgwPPGtpV2ICsUserAUTHFlTx, jnxMbgSgwIfGtpV2ICsEIFRNCEnTx=jnxMbgSgwIfGtpV2ICsEIFRNCEnTx, jnxMbgSgwPPV2EchoReqTx=jnxMbgSgwPPV2EchoReqTx, jnxMbgSgwDlDataNotifRx=jnxMbgSgwDlDataNotifRx, jnxMbgSgwPPGtpV2ICsRPrNtRspRx=jnxMbgSgwPPGtpV2ICsRPrNtRspRx, jnxMbgSgwS11PiggybackMsgRx=jnxMbgSgwS11PiggybackMsgRx, jnxMbgSgwPPGtpV2ICsSysFailRx=jnxMbgSgwPPGtpV2ICsSysFailRx, jnxMbgSgwGtpV2ICsVerNotSuppRx=jnxMbgSgwGtpV2ICsVerNotSuppRx, jnxMbgSgwDlDataAckTx=jnxMbgSgwDlDataAckTx, jnxMbgSgwPPGtpV2ICsCtxNotFndRx=jnxMbgSgwPPGtpV2ICsCtxNotFndRx, jnxMbgSgwIfGtpV2ICsAlDynAdOccTx=jnxMbgSgwIfGtpV2ICsAlDynAdOccTx, jnxMbgSgwPPGtpV1ProtocolErrRx=jnxMbgSgwPPGtpV1ProtocolErrRx, jnxMbgSgwModBrCmdTx=jnxMbgSgwModBrCmdTx, jnxMbgSgwPPProtocolErrRx=jnxMbgSgwPPProtocolErrRx, jnxMbgSgwPPRelAcsBrReqTx=jnxMbgSgwPPRelAcsBrReqTx, jnxMbgSgwGtpV1UnSupMsgRx=jnxMbgSgwGtpV1UnSupMsgRx, jnxMbgSgwResumeAckTx=jnxMbgSgwResumeAckTx, jnxMbgSgwIfGtpV2ICsSysFailTx=jnxMbgSgwIfGtpV2ICsSysFailTx, jnxMbgSgwIfV2EchoReqTx=jnxMbgSgwIfV2EchoReqTx, jnxMbgSgwIfGtpV2ICsRMValRcvRx=jnxMbgSgwIfGtpV2ICsRMValRcvRx, jnxMbgSgwPPUpdBrRspTx=jnxMbgSgwPPUpdBrRspTx, jnxMbgSgwIfGtpV2ICsSynErTADRx=jnxMbgSgwIfGtpV2ICsSynErTADRx, jnxMbgSgwPPSuspAckRx=jnxMbgSgwPPSuspAckRx, jnxMbgSgwProtocolErrRx=jnxMbgSgwProtocolErrRx, jnxMbgSgwCrtBrReqTx=jnxMbgSgwCrtBrReqTx, jnxMbgSgwIfCrtBrReqRx=jnxMbgSgwIfCrtBrReqRx, jnxMbgSgwIfGtpV2ICsProtoNtSupTx=jnxMbgSgwIfGtpV2ICsProtoNtSupTx, jnxMbgSgwIfGtpV2ICsUserAUTHFlRx=jnxMbgSgwIfGtpV2ICsUserAUTHFlRx, jnxMbgSgwGtpV2ICsSemErTADTx=jnxMbgSgwGtpV2ICsSemErTADTx, jnxMbgSgwGtpV2ICsSysFailTx=jnxMbgSgwGtpV2ICsSysFailTx, jnxMbgSgwGtpV2ICsDtForNtSupTx=jnxMbgSgwGtpV2ICsDtForNtSupTx, jnxMbgSgwPPDelBrFlrIndRx=jnxMbgSgwPPDelBrFlrIndRx, jnxMbgSgwPPGtpV2ICsUnPgUESusTx=jnxMbgSgwPPGtpV2ICsUnPgUESusTx, jnxMbgSgwGtpV2ICsManIEMissTx=jnxMbgSgwGtpV2ICsManIEMissTx, jnxMbgSgwCreateSessReqTx=jnxMbgSgwCreateSessReqTx, jnxMbgSgwPPUpdBrReqTx=jnxMbgSgwPPUpdBrReqTx, jnxMbgSgwIfPiggybackMsgTx=jnxMbgSgwIfPiggybackMsgTx, jnxMbgSgwIfResumeAckRx=jnxMbgSgwIfResumeAckRx, jnxMbgSgwPPGtpV2ICsPageRx=jnxMbgSgwPPGtpV2ICsPageRx, jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx=jnxMbgSgwIfGtpV2ICsNOTFTUECTXRx, jnxMbgSgwIfGtpV2ICsInvTotLenRx=jnxMbgSgwIfGtpV2ICsInvTotLenRx, jnxMbgSgwGTPUnknVerRx=jnxMbgSgwGTPUnknVerRx, jnxMbgSgwV2EchoReqTx=jnxMbgSgwV2EchoReqTx, jnxMbgSgwPPGtpV2ICsManIEMissTx=jnxMbgSgwPPGtpV2ICsManIEMissTx, jnxMbgSgwIfGtpV2ICsAPNResTIncRx=jnxMbgSgwIfGtpV2ICsAPNResTIncRx, jnxMbgSgwIfDlDataNotiFlrIndRx=jnxMbgSgwIfDlDataNotiFlrIndRx, jnxMbgSgwPPGtpV2ICsInvTotLenTx=jnxMbgSgwPPGtpV2ICsInvTotLenTx, jnxMbgSgwGtpV2ICsMisUnknAPNRx=jnxMbgSgwGtpV2ICsMisUnknAPNRx, jnxMbgSgwModBrReqRx=jnxMbgSgwModBrReqRx, jnxMbgSgwModBrReqTx=jnxMbgSgwModBrReqTx, jnxMbgSgwIfGtpV2ICsReqRejTx=jnxMbgSgwIfGtpV2ICsReqRejTx, jnxMbgSgwIfRelAcsBrRespTx=jnxMbgSgwIfRelAcsBrRespTx, jnxMbgSgwCrIndTunReqRx=jnxMbgSgwCrIndTunReqRx, jnxMbgSgwIfGtpV2ICsProtoNtSupRx=jnxMbgSgwIfGtpV2ICsProtoNtSupRx, jnxMbgSgwPPDelBrRspRx=jnxMbgSgwPPDelBrRspRx, jnxMbgSgwPPGtpV2ICsLclDetTx=jnxMbgSgwPPGtpV2ICsLclDetTx, jnxMbgSgwIfGtpV2ICsIMSINotKnRx=jnxMbgSgwIfGtpV2ICsIMSINotKnRx, jnxMbgSgwIfRelAcsBrRespRx=jnxMbgSgwIfRelAcsBrRespRx, jnxMbgSgwPPV2VerNotSupTx=jnxMbgSgwPPV2VerNotSupTx, jnxMbgSgwIfGtpV2ICsPTMSISigMMTx=jnxMbgSgwIfGtpV2ICsPTMSISigMMTx, jnxMbgSgwIfGtpV2ICsRATChgRx=jnxMbgSgwIfGtpV2ICsRATChgRx, jnxMbgSgwGtpGwName=jnxMbgSgwGtpGwName, jnxMbgSgwPPGtpV2ICsUnabPageUETx=jnxMbgSgwPPGtpV2ICsUnabPageUETx, jnxMbgSgwGtpV2ICsNewPTSIAdbrTx=jnxMbgSgwGtpV2ICsNewPTSIAdbrTx, jnxMbgSgwSuspNotifRx=jnxMbgSgwSuspNotifRx, jnxMbgSgwPPV2VerNotSupRx=jnxMbgSgwPPV2VerNotSupRx, jnxMbgSgwIfGtpV2ICsNoMemRx=jnxMbgSgwIfGtpV2ICsNoMemRx, jnxMbgSgwDelBrRspTx=jnxMbgSgwDelBrRspTx, jnxMbgSgwIfGtpV2ICsSynErTADTx=jnxMbgSgwIfGtpV2ICsSynErTADTx, jnxMbgSgwIfIPProtoErrRx=jnxMbgSgwIfIPProtoErrRx, jnxMbgSgwIfGtpV1EchoRespRx=jnxMbgSgwIfGtpV1EchoRespRx, jnxMbgSgwPPGtpV2ICsInvLenTx=jnxMbgSgwPPGtpV2ICsInvLenTx, jnxMbgSgwSuspNotifTx=jnxMbgSgwSuspNotifTx, jnxMbgSgwPPGtpV2ICsColNWReqRx=jnxMbgSgwPPGtpV2ICsColNWReqRx, jnxMbgSgwIfGtpV2ICsCtxNotFndTx=jnxMbgSgwIfGtpV2ICsCtxNotFndTx, jnxMbgSgwIfGtpV1ErrIndRx=jnxMbgSgwIfGtpV1ErrIndRx, jnxMbgSgwPPDelConnSetReqTx=jnxMbgSgwPPDelConnSetReqTx, jnxMbgSgwPPGtpV1EchoRespTx=jnxMbgSgwPPGtpV1EchoRespTx, jnxMbgSgwPPGtpV2ICsServDeniedTx=jnxMbgSgwPPGtpV2ICsServDeniedTx, jnxMbgSgwGtpV2ICsUnknownTx=jnxMbgSgwGtpV2ICsUnknownTx, jnxMbgSgwPPDelConnSetReqRx=jnxMbgSgwPPDelConnSetReqRx, jnxMbgSgwIfDelIndTunRespTx=jnxMbgSgwIfDelIndTunRespTx, jnxMbgSgwIfPiggybackMsgRx=jnxMbgSgwIfPiggybackMsgRx, jnxMbgSgwIfDelBrCmdRx=jnxMbgSgwIfDelBrCmdRx, jnxMbgSgwGtpV1EchoRespRx=jnxMbgSgwGtpV1EchoRespRx, jnxMbgSgwPPGtpLclAddr=jnxMbgSgwPPGtpLclAddr, jnxMbgSgwPPGtpV2ICsPkFltSynErRx=jnxMbgSgwPPGtpV2ICsPkFltSynErRx, jnxMbgSgwPPGtpV2ICsRelocFailTx=jnxMbgSgwPPGtpV2ICsRelocFailTx, jnxMbgSgwGtpV2ICsAPNAcsDenRx=jnxMbgSgwGtpV2ICsAPNAcsDenRx, jnxMbgSgwIfGtpV2ICsUnknownTx=jnxMbgSgwIfGtpV2ICsUnknownTx, jnxMbgSgwPPDelSessRspRx=jnxMbgSgwPPDelSessRspRx, jnxMbgSgwPPGtpV2ICsNewPTNPrefTx=jnxMbgSgwPPGtpV2ICsNewPTNPrefTx, jnxMbgSgwV2EchoRespTx=jnxMbgSgwV2EchoRespTx, jnxMbgSgwPPGtpV2ICsVerNotSuppTx=jnxMbgSgwPPGtpV2ICsVerNotSuppTx, jnxMbgSgwResumeNotifTx=jnxMbgSgwResumeNotifTx, jnxMbgSgwPPCrtBrRspTx=jnxMbgSgwPPCrtBrRspTx, jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx=jnxMbgSgwPPGtpV2ICsGREKeyNtFdRx, jnxMbgSgwPPGtpV2ICsManIEIncorRx=jnxMbgSgwPPGtpV2ICsManIEIncorRx, jnxMbgSgwIfDlDataNotifRx=jnxMbgSgwIfDlDataNotifRx, jnxMbgSgwIfDelConnSetReqRx=jnxMbgSgwIfDelConnSetReqRx, jnxMbgSgwGtpV2ICsAPNResTIncRx=jnxMbgSgwGtpV2ICsAPNResTIncRx, jnxMbgSgwIfGtpV1ProtocolErrRx=jnxMbgSgwIfGtpV1ProtocolErrRx, jnxMbgSgwIfUpdBrRspTx=jnxMbgSgwIfUpdBrRspTx, jnxMbgSgwPPGtpV2ICsTFTSysErrRx=jnxMbgSgwPPGtpV2ICsTFTSysErrRx)
mibBuilder.exportSymbols('JUNIPER-MOBILE-GATEWAY-SGW-GTP-MIB', jnxMbgSgwResumeNotifRx=jnxMbgSgwResumeNotifRx, jnxMbgSgwIfV2EchoReqRx=jnxMbgSgwIfV2EchoReqRx, jnxMbgSgwSuspAckTx=jnxMbgSgwSuspAckTx, jnxMbgSgwGtpV1EndMarkerRx=jnxMbgSgwGtpV1EndMarkerRx, jnxMbgSgwIfGtpV2ICsNoMemTx=jnxMbgSgwIfGtpV2ICsNoMemTx, jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx=jnxMbgSgwPPGtpV2ICsNPTSIAdbrRx, jnxMbgSgwPPGtpV1EndMarkerTx=jnxMbgSgwPPGtpV1EndMarkerTx, jnxMbgSgwPPGtpV2ICsReqRejRx=jnxMbgSgwPPGtpV2ICsReqRejRx, jnxMbgSgwIfSuspAckRx=jnxMbgSgwIfSuspAckRx, jnxMbgSgwIfGtpV2ICsNoResRx=jnxMbgSgwIfGtpV2ICsNoResRx, jnxMbgSgwIfGtpV2ICsInvPrTx=jnxMbgSgwIfGtpV2ICsInvPrTx, jnxMbgSgwGtpV2ICsMisUnknAPNTx=jnxMbgSgwGtpV2ICsMisUnknAPNTx, jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx=jnxMbgSgwIfGtpV2ICsNPTSIAdbrTx, jnxMbgSgwPPGtpV2ICsEIFRNCEnRx=jnxMbgSgwPPGtpV2ICsEIFRNCEnRx, jnxMbgSgwUpdConnSetReqRx=jnxMbgSgwUpdConnSetReqRx, jnxMbgSgwGtpV2ICsAllDynAdOccTx=jnxMbgSgwGtpV2ICsAllDynAdOccTx, jnxMbgSgwIfResumeNotifRx=jnxMbgSgwIfResumeNotifRx, jnxMbgSgwGtpV2ICsRATChgTx=jnxMbgSgwGtpV2ICsRATChgTx, jnxMbgSgwGtpV1ErrIndTx=jnxMbgSgwGtpV1ErrIndTx, jnxMbgSgwIfSuspNotifTx=jnxMbgSgwIfSuspNotifTx, jnxMbgSgwIfGtpV2ICsAlDynAdOccRx=jnxMbgSgwIfGtpV2ICsAlDynAdOccRx, jnxMbgSgwIfUnknMsgRx=jnxMbgSgwIfUnknMsgRx, jnxMbgSgwPPDlDataAckRx=jnxMbgSgwPPDlDataAckRx, jnxMbgSgwIfGtpV2ICsNoResTx=jnxMbgSgwIfGtpV2ICsNoResTx, jnxMbgSgwPPGtpV2ICsTFTSMANTErTx=jnxMbgSgwPPGtpV2ICsTFTSMANTErTx, jnxMbgSgwIfGtpV2ICsTFTSMANTErTx=jnxMbgSgwIfGtpV2ICsTFTSMANTErTx, jnxMbgSgwIfV2NumBytesRx=jnxMbgSgwIfV2NumBytesRx, jnxMbgSgwPPPacketSendFail=jnxMbgSgwPPPacketSendFail, jnxMbgSgwModBrRspRx=jnxMbgSgwModBrRspRx, jnxMbgSgwPPCrIndTunReqTx=jnxMbgSgwPPCrIndTunReqTx, jnxMbgSgwRelAcsBrReqRx=jnxMbgSgwRelAcsBrReqRx, jnxMbgSgwPPGtpV2ICsCondIEMsRx=jnxMbgSgwPPGtpV2ICsCondIEMsRx, jnxMbgSgwIfDelBrFlrIndRx=jnxMbgSgwIfDelBrFlrIndRx, jnxMbgSgwV2NumBytesRx=jnxMbgSgwV2NumBytesRx, jnxMbgSgwPPGtpV2ICsUENotRespRx=jnxMbgSgwPPGtpV2ICsUENotRespRx, jnxMbgSgwPPGtpV2ICsDtForNtSupTx=jnxMbgSgwPPGtpV2ICsDtForNtSupTx, jnxMbgSgwGtpNotificationVars=jnxMbgSgwGtpNotificationVars, jnxMbgSgwPPV2EchoRespRx=jnxMbgSgwPPV2EchoRespRx, jnxMbgSgwPPGtpV2ICsTFTSysErrTx=jnxMbgSgwPPGtpV2ICsTFTSysErrTx, jnxMbgSgwGtpV2ICsVerNotSuppTx=jnxMbgSgwGtpV2ICsVerNotSuppTx, jnxMbgSgwIfGtpV1EchoReqRx=jnxMbgSgwIfGtpV1EchoReqRx, jnxMbgSgwIfCreateSessRspTx=jnxMbgSgwIfCreateSessRspTx, jnxMbgSgwGtpPerPeerStatsEntry=jnxMbgSgwGtpPerPeerStatsEntry, jnxMbgSgwPPGtpV2ICsUnknownTx=jnxMbgSgwPPGtpV2ICsUnknownTx, jnxMbgSgwIfGtpV2ICsPTMSISigMMRx=jnxMbgSgwIfGtpV2ICsPTMSISigMMRx, jnxMbgSgwGtpGwIndex=jnxMbgSgwGtpGwIndex, jnxMbgSgwModBrCmdRx=jnxMbgSgwModBrCmdRx, jnxMbgSgwPPDelSessRspTx=jnxMbgSgwPPDelSessRspTx, jnxMbgSgwIfV2NumMsgRx=jnxMbgSgwIfV2NumMsgRx, jnxMbgSgwIfBrResCmdRx=jnxMbgSgwIfBrResCmdRx, jnxMbgSgwPPGtpV2ICsAllDynAdOcTx=jnxMbgSgwPPGtpV2ICsAllDynAdOcTx, jnxMbgSgwIfV2VerNotSupRx=jnxMbgSgwIfV2VerNotSupRx, jnxMbgSgwPPGtpV2ICsPageTx=jnxMbgSgwPPGtpV2ICsPageTx, jnxMbgSgwPPGtpV2ICsSemErTADTx=jnxMbgSgwPPGtpV2ICsSemErTADTx, jnxMbgSgwPPResumeAckRx=jnxMbgSgwPPResumeAckRx, jnxMbgSgwGtpV2ICsPTNotSuppTx=jnxMbgSgwGtpV2ICsPTNotSuppTx, jnxMbgSgwGtpV2ICsSysFailRx=jnxMbgSgwGtpV2ICsSysFailRx, jnxMbgSgwPPUnknMsgRx=jnxMbgSgwPPUnknMsgRx, jnxMbgSgwGtpV2ICsNOTFTUECTXTx=jnxMbgSgwGtpV2ICsNOTFTUECTXTx, jnxMbgSgwPPDelBrReqRx=jnxMbgSgwPPDelBrReqRx, jnxMbgSgwGtpV2ICsManIEMissRx=jnxMbgSgwGtpV2ICsManIEMissRx, jnxMbgSgwDelIndTunReqRx=jnxMbgSgwDelIndTunReqRx, jnxMbgSgwGtpV2ICsReqAcceptRx=jnxMbgSgwGtpV2ICsReqAcceptRx, jnxMbgSgwPPUpdBrRspRx=jnxMbgSgwPPUpdBrRspRx, jnxMbgSgwIfGtpV2ICsMisUnknAPNTx=jnxMbgSgwIfGtpV2ICsMisUnknAPNTx, jnxMbgSgwPPGtpV1ErrIndRx=jnxMbgSgwPPGtpV1ErrIndRx, jnxMbgSgwGtpPeerName=jnxMbgSgwGtpPeerName, jnxMbgSgwDelBrReqTx=jnxMbgSgwDelBrReqTx, jnxMbgSgwIfGtpV2ICsManIEIncorTx=jnxMbgSgwIfGtpV2ICsManIEIncorTx, jnxMbgSgwIfGtpV2ICsSemErTADRx=jnxMbgSgwIfGtpV2ICsSemErTADRx, jnxMbgSgwIfGtpV2ICsDenINRatRx=jnxMbgSgwIfGtpV2ICsDenINRatRx, jnxMbgSgwIfUpdBrRspRx=jnxMbgSgwIfUpdBrRspRx, jnxMbgSgwPPCrtBrReqRx=jnxMbgSgwPPCrtBrReqRx, jnxMbgSgwGtpV2ICsTFTSysErrTx=jnxMbgSgwGtpV2ICsTFTSysErrTx, jnxMbgSgwIfPcktLenErrRx=jnxMbgSgwIfPcktLenErrRx, jnxMbgSgwIfGtpV2ICsRelocFailTx=jnxMbgSgwIfGtpV2ICsRelocFailTx, jnxMbgSgwIfGtpV2ICsReqAcceptTx=jnxMbgSgwIfGtpV2ICsReqAcceptTx, jnxMbgSgwPPPiggybackMsgRx=jnxMbgSgwPPPiggybackMsgRx, jnxMbgSgwDelSessRspTx=jnxMbgSgwDelSessRspTx, jnxMbgSgwPPDelBrReqTx=jnxMbgSgwPPDelBrReqTx, jnxMbgSgwGtpV2ICsTFTSMANTErRx=jnxMbgSgwGtpV2ICsTFTSMANTErRx, jnxMbgSgwPPGtpV2ICsUERefusesTx=jnxMbgSgwPPGtpV2ICsUERefusesTx, jnxMbgSgwGtpV2ICsNoResRx=jnxMbgSgwGtpV2ICsNoResRx, jnxMbgSgwIfDelBrReqRx=jnxMbgSgwIfDelBrReqRx, jnxMbgSgwGtpV2ICsRMValRcvRx=jnxMbgSgwGtpV2ICsRMValRcvRx, jnxMbgSgwGtpV2ICsUnabPageUERx=jnxMbgSgwGtpV2ICsUnabPageUERx, jnxMbgSgwIfGtpV2ICsNewPTNPrefTx=jnxMbgSgwIfGtpV2ICsNewPTNPrefTx, jnxMbgSgwPPBrResCmdTx=jnxMbgSgwPPBrResCmdTx, jnxMbgSgwIfDlDataNotifTx=jnxMbgSgwIfDlDataNotifTx, jnxMbgSgwPacketAllocFail=jnxMbgSgwPacketAllocFail, jnxMbgSgwPPGtpV2ICsSemErTADRx=jnxMbgSgwPPGtpV2ICsSemErTADRx, jnxMbgSgwPPDlDataNotiFlrIndTx=jnxMbgSgwPPDlDataNotiFlrIndTx, jnxMbgSgwIfUpdConnSetRspTx=jnxMbgSgwIfUpdConnSetRspTx, jnxMbgSgwGtpV2ICsIMSINotKnTx=jnxMbgSgwGtpV2ICsIMSINotKnTx, jnxMbgSgwGtpV2ICsSemErTADRx=jnxMbgSgwGtpV2ICsSemErTADRx, jnxMbgSgwPPGtpV2ICsLclDetRx=jnxMbgSgwPPGtpV2ICsLclDetRx, jnxMbgSgwIfUpdConnSetReqTx=jnxMbgSgwIfUpdConnSetReqTx, jnxMbgSgwIfPacketSendFail=jnxMbgSgwIfPacketSendFail, jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx=jnxMbgSgwIfGtpV2ICsNPTSIAdbrRx, jnxMbgSgwIfGtpV2ICsAcceptPartTx=jnxMbgSgwIfGtpV2ICsAcceptPartTx, jnxMbgSgwPPUpdConnSetRspRx=jnxMbgSgwPPUpdConnSetRspRx, jnxMbgSgwDelIndTunRespRx=jnxMbgSgwDelIndTunRespRx, jnxMbgSgwPPSuspNotifTx=jnxMbgSgwPPSuspNotifTx, jnxMbgSgwIfUpdConnSetRspRx=jnxMbgSgwIfUpdConnSetRspRx, jnxMbgSgwGtpV2ICsInvMsgFmtRx=jnxMbgSgwGtpV2ICsInvMsgFmtRx, jnxMbgSgwIfGtpV2ICsAPNAcsDenTx=jnxMbgSgwIfGtpV2ICsAPNAcsDenTx, jnxMbgSgwDelBrFlrIndTx=jnxMbgSgwDelBrFlrIndTx, jnxMbgSgwIfIndex=jnxMbgSgwIfIndex, jnxMbgSgwGtpV1T3RespTmrExpRx=jnxMbgSgwGtpV1T3RespTmrExpRx, jnxMbgSgwPPCreateSessRspTx=jnxMbgSgwPPCreateSessRspTx, jnxMbgSgwPPDelBrCmdTx=jnxMbgSgwPPDelBrCmdTx, jnxMbgSgwIfStopPagingIndTx=jnxMbgSgwIfStopPagingIndTx, jnxMbgSgwPPGtpV2ICsRelocFailRx=jnxMbgSgwPPGtpV2ICsRelocFailRx, jnxMbgSgwPPGtpV2ICsInvMsgFmtTx=jnxMbgSgwPPGtpV2ICsInvMsgFmtTx, jnxMbgSgwIfGtpV2ICsDenINRatTx=jnxMbgSgwIfGtpV2ICsDenINRatTx, jnxMbgSgwPPGtpV2ICsISRDeactRx=jnxMbgSgwPPGtpV2ICsISRDeactRx, jnxMbgSgwPPBrResCmdRx=jnxMbgSgwPPBrResCmdRx, jnxMbgSgwPPGtpV2ICsNoResTx=jnxMbgSgwPPGtpV2ICsNoResTx, jnxMbgSgwPPGtpV2ICsAllDynAdOcRx=jnxMbgSgwPPGtpV2ICsAllDynAdOcRx, jnxMbgSgwIfGtpV2ICsDtForNtSupTx=jnxMbgSgwIfGtpV2ICsDtForNtSupTx, jnxMbgSgwIfV2NumMsgTx=jnxMbgSgwIfV2NumMsgTx, jnxMbgSgwIfGtpV2ICsInvLenTx=jnxMbgSgwIfGtpV2ICsInvLenTx, jnxMbgSgwDlDataNotiFlrIndTx=jnxMbgSgwDlDataNotiFlrIndTx, jnxMbgSgwIfGtpV2ICsRPrNtRspTx=jnxMbgSgwIfGtpV2ICsRPrNtRspTx, jnxMbgSgwGtpV2ICsDeniedINRatTx=jnxMbgSgwGtpV2ICsDeniedINRatTx, jnxMbgSgwGtpV2ICsProtoNtSupRx=jnxMbgSgwGtpV2ICsProtoNtSupRx, jnxMbgSgwPPModBrFlrIndRx=jnxMbgSgwPPModBrFlrIndRx, jnxMbgSgwV2VerNotSupRx=jnxMbgSgwV2VerNotSupRx, jnxMbgSgwPPGtpV1EndMarkerRx=jnxMbgSgwPPGtpV1EndMarkerRx, jnxMbgSgwGtpV2ICsISRDeactTx=jnxMbgSgwGtpV2ICsISRDeactTx, jnxMbgSgwGtpV2ICsServDeniedRx=jnxMbgSgwGtpV2ICsServDeniedRx, jnxMbgSgwIfDlDataNotiFlrIndTx=jnxMbgSgwIfDlDataNotiFlrIndTx, jnxMbgSgwCrIndTunReqTx=jnxMbgSgwCrIndTunReqTx, jnxMbgSgwGtpV2ICsUserAUTHFlTx=jnxMbgSgwGtpV2ICsUserAUTHFlTx, jnxMbgSgwPPV2NumBytesRx=jnxMbgSgwPPV2NumBytesRx, jnxMbgSgwS4PiggybackMsgRx=jnxMbgSgwS4PiggybackMsgRx, jnxMbgSgwIfDlDataAckTx=jnxMbgSgwIfDlDataAckTx, jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx=jnxMbgSgwIfGtpV2ICsGREKeyNtFdRx, jnxMbgSgwGtpV2ICsISRDeactRx=jnxMbgSgwGtpV2ICsISRDeactRx, jnxMbgSgwIfDelSessReqTx=jnxMbgSgwIfDelSessReqTx, jnxMbgSgwIfRelAcsBrReqTx=jnxMbgSgwIfRelAcsBrReqTx, jnxMbgSgwDelSessRspRx=jnxMbgSgwDelSessRspRx, jnxMbgSgwPPModBrRspTx=jnxMbgSgwPPModBrRspTx, jnxMbgSgwIfV2EchoRespRx=jnxMbgSgwIfV2EchoRespRx, jnxMbgSgwBrResCmdRx=jnxMbgSgwBrResCmdRx, jnxMbgSgwPPGtpV2ICsAPNResTIncTx=jnxMbgSgwPPGtpV2ICsAPNResTIncTx, jnxMbgSgwPPGtpV2ICsInvTotLenRx=jnxMbgSgwPPGtpV2ICsInvTotLenRx, jnxMbgSgwGtpV2ICsUnPgUESusRx=jnxMbgSgwGtpV2ICsUnPgUESusRx, jnxMbgSgwIfGtpV2ICsOptIEIncorTx=jnxMbgSgwIfGtpV2ICsOptIEIncorTx, jnxMbgSgwGtpV2ICsCmpDetTx=jnxMbgSgwGtpV2ICsCmpDetTx, jnxMbgSgwModBrFlrIndRx=jnxMbgSgwModBrFlrIndRx, jnxMbgSgwIfGtpV2ICsRMValRcvTx=jnxMbgSgwIfGtpV2ICsRMValRcvTx, jnxMbgSgwGtpCPerPeerStatsTable=jnxMbgSgwGtpCPerPeerStatsTable, jnxMbgSgwGtpInterfaceType=jnxMbgSgwGtpInterfaceType, jnxMbgSgwPPGtpV2ICsServNotSupTx=jnxMbgSgwPPGtpV2ICsServNotSupTx, jnxMbgSgwPPBrResFlrIndRx=jnxMbgSgwPPBrResFlrIndRx, jnxMbgSgwIfGtpV2ICsCondIEMsRx=jnxMbgSgwIfGtpV2ICsCondIEMsRx, jnxMbgSgwIfGtpV2ICsAPNResTIncTx=jnxMbgSgwIfGtpV2ICsAPNResTIncTx, jnxMbgSgwIfGtpV2ICsISRDeactTx=jnxMbgSgwIfGtpV2ICsISRDeactTx, jnxMbgSgwUpdBrReqRx=jnxMbgSgwUpdBrReqRx, jnxMbgSgwV2EchoRespRx=jnxMbgSgwV2EchoRespRx, jnxMbgSgwIfGtpV2ICsUnabPageUETx=jnxMbgSgwIfGtpV2ICsUnabPageUETx, jnxMbgSgwV2NumBytesTx=jnxMbgSgwV2NumBytesTx, jnxMbgSgwIfBrResFlrIndTx=jnxMbgSgwIfBrResFlrIndTx, jnxMbgSgwPPCreateSessRspRx=jnxMbgSgwPPCreateSessRspRx, jnxMbgSgwPPGtpV2ICsReqAcceptTx=jnxMbgSgwPPGtpV2ICsReqAcceptTx, jnxMbgSgwIfGtpV2ICsVerNotSuppRx=jnxMbgSgwIfGtpV2ICsVerNotSuppRx, jnxMbgSgwPPGtpV2ICsReqRejTx=jnxMbgSgwPPGtpV2ICsReqRejTx, jnxMbgSgwIfT3RespTmrExpRx=jnxMbgSgwIfT3RespTmrExpRx, jnxMbgSgwPPUpdConnSetRspTx=jnxMbgSgwPPUpdConnSetRspTx, jnxMbgSgwPPGtpRmtAddr=jnxMbgSgwPPGtpRmtAddr, jnxMbgSgwGtpGlbStatsEntry=jnxMbgSgwGtpGlbStatsEntry, jnxMbgSgwGtpV2ICsEIFRNCEnRx=jnxMbgSgwGtpV2ICsEIFRNCEnRx, jnxMbgSgwIfCrIndTunRespRx=jnxMbgSgwIfCrIndTunRespRx, jnxMbgSgwGtpV2ICsRPrNtRspRx=jnxMbgSgwGtpV2ICsRPrNtRspRx, jnxMbgSgwPPGtpRtgInst=jnxMbgSgwPPGtpRtgInst) |
if __name__ == '__main__':
n = int(input())
s = set()
for i in range (n):
s.add(input())
print((len(s)))
| if __name__ == '__main__':
n = int(input())
s = set()
for i in range(n):
s.add(input())
print(len(s)) |
# -*- coding:utf-8 -*-
# @Time:2020/6/15 11:38
# @Author:TimVan
# @File:leetcode.py
# @Software:PyCharm
# Definition for singly-linked list.
# for j in range(10, 5, -1):
# print(j)
print('a'.find(' '))
| print('a'.find(' ')) |
def main():
a = ["a", 1, "5", 2.3, 1.2j]
some_condition = True
for x in a:
# If it's all isinstance, we can use a type switch
if isinstance(x, (str, float)):
print("String or float!")
elif isinstance(x, int):
print("Integer!")
else:
print("Dunno!")
print(":)")
# If it's got mixed expressions, we will inline a switch for the isinstance expression
if isinstance(x, str) and some_condition:
print("String")
elif isinstance(x, int):
print("Integer!")
else:
print("Dunno!!")
print(":O")
if __name__ == '__main__':
main()
| def main():
a = ['a', 1, '5', 2.3, 1.2j]
some_condition = True
for x in a:
if isinstance(x, (str, float)):
print('String or float!')
elif isinstance(x, int):
print('Integer!')
else:
print('Dunno!')
print(':)')
if isinstance(x, str) and some_condition:
print('String')
elif isinstance(x, int):
print('Integer!')
else:
print('Dunno!!')
print(':O')
if __name__ == '__main__':
main() |
___assertIs(isinstance(True, bool), True)
___assertIs(isinstance(False, bool), True)
___assertIs(isinstance(True, int), True)
___assertIs(isinstance(False, int), True)
___assertIs(isinstance(1, bool), False)
___assertIs(isinstance(0, bool), False)
| ___assert_is(isinstance(True, bool), True)
___assert_is(isinstance(False, bool), True)
___assert_is(isinstance(True, int), True)
___assert_is(isinstance(False, int), True)
___assert_is(isinstance(1, bool), False)
___assert_is(isinstance(0, bool), False) |
# Copyright (c) 2013 Huan Do, http://huan.do
class Declaration(object):
def __init__(self, name):
self.name = name
self.delete = False
self._conditional = None
@property
def conditional(self):
assert self._conditional is not None
return self.delete or self._conditional
def generator():
_ = '_'
while True:
# yield Declaration('_' + str(len(_)))
yield Declaration(_)
_ += '_'
| class Declaration(object):
def __init__(self, name):
self.name = name
self.delete = False
self._conditional = None
@property
def conditional(self):
assert self._conditional is not None
return self.delete or self._conditional
def generator():
_ = '_'
while True:
yield declaration(_)
_ += '_' |
description = 'Verify the user can add an action to the teardown'
pages = ['common',
'index',
'tests',
'test_builder']
def setup(data):
common.access_golem(data.env.url, data.env.admin)
index.create_access_project('test')
common.navigate_menu('Tests')
tests.create_access_random_test()
def test(data):
test_builder.add_action('click', where='teardown')
test_builder.save_test()
refresh_page()
test_builder.verify_last_action('click', where='teardown')
| description = 'Verify the user can add an action to the teardown'
pages = ['common', 'index', 'tests', 'test_builder']
def setup(data):
common.access_golem(data.env.url, data.env.admin)
index.create_access_project('test')
common.navigate_menu('Tests')
tests.create_access_random_test()
def test(data):
test_builder.add_action('click', where='teardown')
test_builder.save_test()
refresh_page()
test_builder.verify_last_action('click', where='teardown') |
def process(record):
ids = (record.get('idsurface', '') or '').split(' ')
if len(ids) > 4:
return {'language': record['language'],
'longitude': float(record['longitude'] or 0),
'latitude': float(record['latitude'] or 0),
'idsurface': ids}
| def process(record):
ids = (record.get('idsurface', '') or '').split(' ')
if len(ids) > 4:
return {'language': record['language'], 'longitude': float(record['longitude'] or 0), 'latitude': float(record['latitude'] or 0), 'idsurface': ids} |
a = 2 ** 50
b = 2 ** 50 * 3
c = 2 ** 50 * 3 - 1000
d = 400 / 2 ** 50 + 50
print(a,b,c,d) | a = 2 ** 50
b = 2 ** 50 * 3
c = 2 ** 50 * 3 - 1000
d = 400 / 2 ** 50 + 50
print(a, b, c, d) |
G = 6.67408e-11 # N-m2/kg2
#
# Normalize the constants such that m, r, t and v are of the order 10^1.
#
def get_normalization_constants_alphacentauri():
# Normalize the masses to the mass of our sun
m_nd = 1.989e+30 # kg
# Normalize distances to the distance between Alpha Centauri A and Alpha Centauri B
r_nd = 5.326e+12 # m
# Normalize velocities to the velocity of earth around the sun
v_nd = 30000 # m/s
# Normalize time to the orbital period of Alpha Centauri A and B
t_nd = 79.91 * 365 * 24 * 3600 * 0.51 # s
return m_nd, r_nd, v_nd, t_nd
def get_normalization_constants_earthsun():
# Normalize the masses to the mass of our sun
m_nd = 1.989e+30 # kg
# Normalize distances to the distance between Earth and Sun
r_nd = 149.47e9 # m
# Normalize velocities to the velocity of earth around the sun
v_nd = 29.78e3 # m/s
# Normalize time to the orbital period of Earth and Sun
t_nd = 365 * 24 * 3600 * 0.51 # s
return m_nd, r_nd, v_nd, t_nd
def normalization_constants_none():
return 1, 1, 1, 1
m_nd, r_nd, v_nd, t_nd = get_normalization_constants_alphacentauri()
| g = 6.67408e-11
def get_normalization_constants_alphacentauri():
m_nd = 1.989e+30
r_nd = 5326000000000.0
v_nd = 30000
t_nd = 79.91 * 365 * 24 * 3600 * 0.51
return (m_nd, r_nd, v_nd, t_nd)
def get_normalization_constants_earthsun():
m_nd = 1.989e+30
r_nd = 149470000000.0
v_nd = 29780.0
t_nd = 365 * 24 * 3600 * 0.51
return (m_nd, r_nd, v_nd, t_nd)
def normalization_constants_none():
return (1, 1, 1, 1)
(m_nd, r_nd, v_nd, t_nd) = get_normalization_constants_alphacentauri() |
# Time: 0.72 s
movies = []
for _ in range(int(input())):
movies.append(tuple(map(int, input().split())))
movies.sort(key=lambda x: x[1])
last_end_time = 0
movie_count = 0
for start_time, end_time in movies:
if start_time >= last_end_time:
last_end_time = end_time
movie_count += 1
print(movie_count)
| movies = []
for _ in range(int(input())):
movies.append(tuple(map(int, input().split())))
movies.sort(key=lambda x: x[1])
last_end_time = 0
movie_count = 0
for (start_time, end_time) in movies:
if start_time >= last_end_time:
last_end_time = end_time
movie_count += 1
print(movie_count) |
# 072220
# CodeSignal
# https://app.codesignal.com/arcade/intro/level-6/mCkmbxdMsMTjBc3Bm/solutions
def array_replace(inputArray, elemToReplace, substitutionElem):
# loop through input array
# if element = elemToReplace
# replace that element
for index,i in enumerate(inputArray):
if i == elemToReplace:
inputArray[index] = substitutionElem
return inputArray
| def array_replace(inputArray, elemToReplace, substitutionElem):
for (index, i) in enumerate(inputArray):
if i == elemToReplace:
inputArray[index] = substitutionElem
return inputArray |
while True:
print('\n--- MULTIPLICATION TABLE ---')
num = int(input('Type a number integer: '))
if num < 0:
break
for c in range(1, 11):
print(f'{c} X {num} = {c*num}')
print('END PROGRAM') | while True:
print('\n--- MULTIPLICATION TABLE ---')
num = int(input('Type a number integer: '))
if num < 0:
break
for c in range(1, 11):
print(f'{c} X {num} = {c * num}')
print('END PROGRAM') |
def plot(width, height):
for j in range(height):
y = height - j - 1
print("y = {0:3} |".format(y), end="")
for x in range(width):
print("{0:3}".format(f(x,y)), end="")
print()
print(" +", end="")
for x in range(width):
print("---", end="")
print()
print(" ", end="")
for x in range(width):
print("{0:3}".format(x), end="")
print()
def f(x, y):
if x == y:
if x % 2 == 0:
return x + y
else:
return 1 + f(x-1, y-1)
elif x - 2 == y:
return f(x, y + 2) - 2
return ""
def test():
assert f(4, 2) == 6, "Test 1 failed"
assert f(6, 6) == 12, "Test 2 failed"
assert f(3, 4) == "", "Test 3 failed"
print("All tests passed")
if __name__ == '__main__':
lines = int(input())
for i in range(lines):
x, y = input().split()
n = f(int(x), int(y))
if n == "":
print("No Number")
else:
print(n)
#plot(20, 20)
| def plot(width, height):
for j in range(height):
y = height - j - 1
print('y = {0:3} |'.format(y), end='')
for x in range(width):
print('{0:3}'.format(f(x, y)), end='')
print()
print(' +', end='')
for x in range(width):
print('---', end='')
print()
print(' ', end='')
for x in range(width):
print('{0:3}'.format(x), end='')
print()
def f(x, y):
if x == y:
if x % 2 == 0:
return x + y
else:
return 1 + f(x - 1, y - 1)
elif x - 2 == y:
return f(x, y + 2) - 2
return ''
def test():
assert f(4, 2) == 6, 'Test 1 failed'
assert f(6, 6) == 12, 'Test 2 failed'
assert f(3, 4) == '', 'Test 3 failed'
print('All tests passed')
if __name__ == '__main__':
lines = int(input())
for i in range(lines):
(x, y) = input().split()
n = f(int(x), int(y))
if n == '':
print('No Number')
else:
print(n) |
'''
Psuedo-joystick object for playback of recorded macros
'''
class PlaybackJoystick():
def __init__(self, playback_data):
self.playback_data = playback_data
self.t = 0
def setTime(self, t=0):
self.t = t
def getRawAxis(self, axis):
#TODO fix me, get correct index for time t
# in the simulator it's called multiple times per millisecond, but the recorder only stores one per millisecond,
# so in the simulator index is usually the same as t.... but in the real bot it would be like every 50 ms or so
index = self.t
if(index < len(self.playback_data)):
return float(self.playback_data[index][axis + 2])
return 0
def getX(self, hand=None):
return self.getRawAxis(0)
def getY(self, hand=None):
return self.getRawAxis(1)
| """
Psuedo-joystick object for playback of recorded macros
"""
class Playbackjoystick:
def __init__(self, playback_data):
self.playback_data = playback_data
self.t = 0
def set_time(self, t=0):
self.t = t
def get_raw_axis(self, axis):
index = self.t
if index < len(self.playback_data):
return float(self.playback_data[index][axis + 2])
return 0
def get_x(self, hand=None):
return self.getRawAxis(0)
def get_y(self, hand=None):
return self.getRawAxis(1) |
default_app_config = "freight.apps.FreightConfig"
__version__ = "1.5.1"
__title__ = "Freight"
| default_app_config = 'freight.apps.FreightConfig'
__version__ = '1.5.1'
__title__ = 'Freight' |
words_file = open('wordlist.txt')
print("export const VALIDGUESSES6 = [")
for word in words_file.read().split('\n'):
word = word.strip()
if word.isalpha() and len(word) == 6:
print(' "%s",' % word.lower())
print("];") | words_file = open('wordlist.txt')
print('export const VALIDGUESSES6 = [')
for word in words_file.read().split('\n'):
word = word.strip()
if word.isalpha() and len(word) == 6:
print(' "%s",' % word.lower())
print('];') |
graph = {}
n = input().split(' ')
node, edge, start = map(int, n)
for i in range(edge):
edge_number = input().split(' ')
n1, n2 = map(int, edge_number)
if n1 not in graph:
graph[n1] = [n2]
elif n2 not in graph[n1]:
graph[n1].append(n2)
if n2 not in graph:
graph[n2] = [n1]
elif n1 not in graph[n2]:
graph[n2].append(n1)
def DFS(graph, start):
visited = []
stack = [start]
while stack:
n = stack.pop()
if n not in visited:
visited.append(n)
if n in graph:
tmp = list(set(graph[n]) - set(visited))
tmp.sort(reverse=True)
stack += tmp
return " ".join(map(str, visited))
def BFS(graph, start):
visited = []
queue = [start]
while queue:
n = queue.pop(0)
if n not in visited:
visited.append(n)
if n in graph:
tmp = list(set(graph[n]) - set(visited))
tmp.sort()
queue += tmp
return " ".join(map(str, visited))
print(DFS(graph, start))
print(BFS(graph, start))
| graph = {}
n = input().split(' ')
(node, edge, start) = map(int, n)
for i in range(edge):
edge_number = input().split(' ')
(n1, n2) = map(int, edge_number)
if n1 not in graph:
graph[n1] = [n2]
elif n2 not in graph[n1]:
graph[n1].append(n2)
if n2 not in graph:
graph[n2] = [n1]
elif n1 not in graph[n2]:
graph[n2].append(n1)
def dfs(graph, start):
visited = []
stack = [start]
while stack:
n = stack.pop()
if n not in visited:
visited.append(n)
if n in graph:
tmp = list(set(graph[n]) - set(visited))
tmp.sort(reverse=True)
stack += tmp
return ' '.join(map(str, visited))
def bfs(graph, start):
visited = []
queue = [start]
while queue:
n = queue.pop(0)
if n not in visited:
visited.append(n)
if n in graph:
tmp = list(set(graph[n]) - set(visited))
tmp.sort()
queue += tmp
return ' '.join(map(str, visited))
print(dfs(graph, start))
print(bfs(graph, start)) |
#
# PySNMP MIB module TPLINK-COMMANDER-MIB (http://snmplabs.com/pysmi)
# ASN.1 source file:///Users/davwang4/Dev/mibs.snmplabs.com/asn1/TPLINK-COMMANDER-MIB
# Produced by pysmi-0.3.4 at Mon Apr 29 21:16:55 2019
# On host DAVWANG4-M-1475 platform Darwin version 18.5.0 by user davwang4
# Using Python version 3.7.3 (default, Mar 27 2019, 09:23:15)
#
ObjectIdentifier, Integer, OctetString = mibBuilder.importSymbols("ASN1", "ObjectIdentifier", "Integer", "OctetString")
NamedValues, = mibBuilder.importSymbols("ASN1-ENUMERATION", "NamedValues")
ConstraintsUnion, ValueRangeConstraint, ConstraintsIntersection, ValueSizeConstraint, SingleValueConstraint = mibBuilder.importSymbols("ASN1-REFINEMENT", "ConstraintsUnion", "ValueRangeConstraint", "ConstraintsIntersection", "ValueSizeConstraint", "SingleValueConstraint")
ModuleCompliance, NotificationGroup = mibBuilder.importSymbols("SNMPv2-CONF", "ModuleCompliance", "NotificationGroup")
NotificationType, Unsigned32, MibScalar, MibTable, MibTableRow, MibTableColumn, TimeTicks, MibIdentifier, iso, IpAddress, ModuleIdentity, ObjectIdentity, Counter64, Bits, Integer32, Counter32, Gauge32 = mibBuilder.importSymbols("SNMPv2-SMI", "NotificationType", "Unsigned32", "MibScalar", "MibTable", "MibTableRow", "MibTableColumn", "TimeTicks", "MibIdentifier", "iso", "IpAddress", "ModuleIdentity", "ObjectIdentity", "Counter64", "Bits", "Integer32", "Counter32", "Gauge32")
TextualConvention, DisplayString = mibBuilder.importSymbols("SNMPv2-TC", "TextualConvention", "DisplayString")
clusterManage, = mibBuilder.importSymbols("TPLINK-CLUSTER-MIB", "clusterManage")
clusterConfig = MibIdentifier((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2))
commanderConfig = MibIdentifier((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4))
clusterName = MibScalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 1), DisplayString().subtype(subtypeSpec=ValueSizeConstraint(1, 16))).setMaxAccess("readonly")
if mibBuilder.loadTexts: clusterName.setStatus('current')
clusterHoldTime = MibScalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 2), Integer32().subtype(subtypeSpec=ValueRangeConstraint(1, 255))).setMaxAccess("readwrite")
if mibBuilder.loadTexts: clusterHoldTime.setStatus('current')
clusterIntervalTime = MibScalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 3), Integer32().subtype(subtypeSpec=ValueRangeConstraint(1, 255))).setMaxAccess("readwrite")
if mibBuilder.loadTexts: clusterIntervalTime.setStatus('current')
commanderClusterName = MibScalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 1), DisplayString().subtype(subtypeSpec=ValueSizeConstraint(1, 16))).setMaxAccess("readwrite")
if mibBuilder.loadTexts: commanderClusterName.setStatus('current')
clusterIp = MibScalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 2), IpAddress()).setMaxAccess("readwrite")
if mibBuilder.loadTexts: clusterIp.setStatus('current')
clusterIpMask = MibScalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 3), IpAddress()).setMaxAccess("readwrite")
if mibBuilder.loadTexts: clusterIpMask.setStatus('current')
clusterCommit = MibScalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 4), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(1))).clone(namedValues=NamedValues(("commit", 1)))).setMaxAccess("readwrite")
if mibBuilder.loadTexts: clusterCommit.setStatus('current')
mibBuilder.exportSymbols("TPLINK-COMMANDER-MIB", commanderConfig=commanderConfig, clusterIntervalTime=clusterIntervalTime, clusterConfig=clusterConfig, clusterIp=clusterIp, clusterHoldTime=clusterHoldTime, clusterIpMask=clusterIpMask, clusterName=clusterName, clusterCommit=clusterCommit, commanderClusterName=commanderClusterName)
| (object_identifier, integer, octet_string) = mibBuilder.importSymbols('ASN1', 'ObjectIdentifier', 'Integer', 'OctetString')
(named_values,) = mibBuilder.importSymbols('ASN1-ENUMERATION', 'NamedValues')
(constraints_union, value_range_constraint, constraints_intersection, value_size_constraint, single_value_constraint) = mibBuilder.importSymbols('ASN1-REFINEMENT', 'ConstraintsUnion', 'ValueRangeConstraint', 'ConstraintsIntersection', 'ValueSizeConstraint', 'SingleValueConstraint')
(module_compliance, notification_group) = mibBuilder.importSymbols('SNMPv2-CONF', 'ModuleCompliance', 'NotificationGroup')
(notification_type, unsigned32, mib_scalar, mib_table, mib_table_row, mib_table_column, time_ticks, mib_identifier, iso, ip_address, module_identity, object_identity, counter64, bits, integer32, counter32, gauge32) = mibBuilder.importSymbols('SNMPv2-SMI', 'NotificationType', 'Unsigned32', 'MibScalar', 'MibTable', 'MibTableRow', 'MibTableColumn', 'TimeTicks', 'MibIdentifier', 'iso', 'IpAddress', 'ModuleIdentity', 'ObjectIdentity', 'Counter64', 'Bits', 'Integer32', 'Counter32', 'Gauge32')
(textual_convention, display_string) = mibBuilder.importSymbols('SNMPv2-TC', 'TextualConvention', 'DisplayString')
(cluster_manage,) = mibBuilder.importSymbols('TPLINK-CLUSTER-MIB', 'clusterManage')
cluster_config = mib_identifier((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2))
commander_config = mib_identifier((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4))
cluster_name = mib_scalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 1), display_string().subtype(subtypeSpec=value_size_constraint(1, 16))).setMaxAccess('readonly')
if mibBuilder.loadTexts:
clusterName.setStatus('current')
cluster_hold_time = mib_scalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 2), integer32().subtype(subtypeSpec=value_range_constraint(1, 255))).setMaxAccess('readwrite')
if mibBuilder.loadTexts:
clusterHoldTime.setStatus('current')
cluster_interval_time = mib_scalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 3), integer32().subtype(subtypeSpec=value_range_constraint(1, 255))).setMaxAccess('readwrite')
if mibBuilder.loadTexts:
clusterIntervalTime.setStatus('current')
commander_cluster_name = mib_scalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 1), display_string().subtype(subtypeSpec=value_size_constraint(1, 16))).setMaxAccess('readwrite')
if mibBuilder.loadTexts:
commanderClusterName.setStatus('current')
cluster_ip = mib_scalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 2), ip_address()).setMaxAccess('readwrite')
if mibBuilder.loadTexts:
clusterIp.setStatus('current')
cluster_ip_mask = mib_scalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 3), ip_address()).setMaxAccess('readwrite')
if mibBuilder.loadTexts:
clusterIpMask.setStatus('current')
cluster_commit = mib_scalar((1, 3, 6, 1, 4, 1, 11863, 6, 33, 1, 1, 3, 2, 4, 4), integer32().subtype(subtypeSpec=constraints_union(single_value_constraint(1))).clone(namedValues=named_values(('commit', 1)))).setMaxAccess('readwrite')
if mibBuilder.loadTexts:
clusterCommit.setStatus('current')
mibBuilder.exportSymbols('TPLINK-COMMANDER-MIB', commanderConfig=commanderConfig, clusterIntervalTime=clusterIntervalTime, clusterConfig=clusterConfig, clusterIp=clusterIp, clusterHoldTime=clusterHoldTime, clusterIpMask=clusterIpMask, clusterName=clusterName, clusterCommit=clusterCommit, commanderClusterName=commanderClusterName) |
def hello(name):
return 'Hello ' + 'name'
def test_hello():
assert hello('name') == 'Hello name' | def hello(name):
return 'Hello ' + 'name'
def test_hello():
assert hello('name') == 'Hello name' |
#!/usr/bin/env python
class MatrixUtil:
@classmethod
def allocateMatrix(cls, numRows, numCols):
rv = [0.0] * numRows
for i in range(numRows):
rv[i] = [0.0] * numCols
return rv
@classmethod
def allocateMatrixAsRowMajorArray(cls, numRows, numCols):
return [0.0] * numRows * numCols
@classmethod
def torben(cls, m, numRows, numCols):
n = numRows * numCols
midn = int((n + 1) / 2)
less = int()
greater = int()
equal = int()
min = float()
max = float()
guess = float()
maxltguess = float()
mingtguess = float()
min = max = m[0][0]
for i in range(numRows):
for j in range(numCols):
v = m[i][j]
if v < min:
min = v
if v > max:
max = v
while True:
guess = float((min + max) / 2)
less = 0
greater = 0
equal = 0
maxltguess = min
mingtguess = max
for _i in range(numRows):
for _j in range(numCols):
v = m[_i][_j]
if v < guess:
less += 1
if v > maxltguess:
maxltguess = v
elif v > guess:
greater += 1
if v < mingtguess:
mingtguess = v
else:
equal += 1
if less <= midn and greater <= midn:
break
elif less > greater:
max = maxltguess
else:
min = mingtguess
if less >= midn:
return maxltguess
elif less + equal >= midn:
return guess
else:
return mingtguess
| class Matrixutil:
@classmethod
def allocate_matrix(cls, numRows, numCols):
rv = [0.0] * numRows
for i in range(numRows):
rv[i] = [0.0] * numCols
return rv
@classmethod
def allocate_matrix_as_row_major_array(cls, numRows, numCols):
return [0.0] * numRows * numCols
@classmethod
def torben(cls, m, numRows, numCols):
n = numRows * numCols
midn = int((n + 1) / 2)
less = int()
greater = int()
equal = int()
min = float()
max = float()
guess = float()
maxltguess = float()
mingtguess = float()
min = max = m[0][0]
for i in range(numRows):
for j in range(numCols):
v = m[i][j]
if v < min:
min = v
if v > max:
max = v
while True:
guess = float((min + max) / 2)
less = 0
greater = 0
equal = 0
maxltguess = min
mingtguess = max
for _i in range(numRows):
for _j in range(numCols):
v = m[_i][_j]
if v < guess:
less += 1
if v > maxltguess:
maxltguess = v
elif v > guess:
greater += 1
if v < mingtguess:
mingtguess = v
else:
equal += 1
if less <= midn and greater <= midn:
break
elif less > greater:
max = maxltguess
else:
min = mingtguess
if less >= midn:
return maxltguess
elif less + equal >= midn:
return guess
else:
return mingtguess |
with open("input.txt") as input_file:
lines = input_file.readlines()
result = 0
for line in lines:
print(line.strip(), result)
result += int(line.strip())
print(result)
| with open('input.txt') as input_file:
lines = input_file.readlines()
result = 0
for line in lines:
print(line.strip(), result)
result += int(line.strip())
print(result) |
#License: https://bit.ly/3oLErEI
def test(strs):
return [*map(len, strs)]
strs = ['cat', 'car', 'fear', 'center']
print("Original strings:")
print(strs)
print("Lengths of the said list of non-empty strings:")
print(test(strs))
strs = ['cat', 'dog', 'shatter', 'donut', 'at', 'todo', '']
print("\nOriginal strings:")
print(strs)
print("Lengths of the said list of non-empty strings:")
print(test(strs))
| def test(strs):
return [*map(len, strs)]
strs = ['cat', 'car', 'fear', 'center']
print('Original strings:')
print(strs)
print('Lengths of the said list of non-empty strings:')
print(test(strs))
strs = ['cat', 'dog', 'shatter', 'donut', 'at', 'todo', '']
print('\nOriginal strings:')
print(strs)
print('Lengths of the said list of non-empty strings:')
print(test(strs)) |
# Write a Python program to compute the greatest common divisor (GCD) of two positive integers.
n1 = int(input("Enter the first number: "))
n2 = int(input("Enter the second number: "))
a1 = []
a2 = []
a3 = []
for i in range(1, n1 + 1):
if n1 % i == 0:
a1.append(i)
for i in range(1, n2 + 1):
if n2 % i == 0:
a2.append(i)
for i in a1:
if i in a2:
a3.append(i)
print(max(a3))
| n1 = int(input('Enter the first number: '))
n2 = int(input('Enter the second number: '))
a1 = []
a2 = []
a3 = []
for i in range(1, n1 + 1):
if n1 % i == 0:
a1.append(i)
for i in range(1, n2 + 1):
if n2 % i == 0:
a2.append(i)
for i in a1:
if i in a2:
a3.append(i)
print(max(a3)) |
# Only used for PyTorch open source BUCK build
IGNORED_ATTRIBUTE_PREFIX = [
"apple",
"fbobjc",
"windows",
"fbandroid",
"macosx",
]
IGNORED_ATTRIBUTES = [
"feature",
"platforms",
]
def filter_attributes(kwgs):
keys = list(kwgs.keys())
# drop unncessary attributes
for key in keys:
if key in IGNORED_ATTRIBUTES:
kwgs.pop(key)
else:
for invalid_prefix in IGNORED_ATTRIBUTE_PREFIX:
if key.startswith(invalid_prefix):
kwgs.pop(key)
return kwgs
| ignored_attribute_prefix = ['apple', 'fbobjc', 'windows', 'fbandroid', 'macosx']
ignored_attributes = ['feature', 'platforms']
def filter_attributes(kwgs):
keys = list(kwgs.keys())
for key in keys:
if key in IGNORED_ATTRIBUTES:
kwgs.pop(key)
else:
for invalid_prefix in IGNORED_ATTRIBUTE_PREFIX:
if key.startswith(invalid_prefix):
kwgs.pop(key)
return kwgs |
def media_suicida (mediaProvas, mediaTrabalhos):
if mediaProvas >= 5 and mediaTrabalhos >= 5:
return mediaProvas * 0.6 + mediaTrabalhos * 0.4
return min(mediaProvas, mediaTrabalhos)
notasProva = []
notasTrabalho = []
quantidadeProva = int(input("Quantidade de provas: "))
for item in range(quantidadeProva):
n = float(input("Nota da prova {}: ".format(item + 1)))
notasProva.append(n)
quantidadeTrabalho = int(input("Quantidade de trabalhos: "))
for item in range(quantidadeTrabalho):
n = float(input("Nota do trabalho {}: ".format(item + 1)))
notasTrabalho.append((n))
mediaProva = sum(notasProva) / quantidadeProva
mediaTrabalho = sum(notasTrabalho) / quantidadeTrabalho
print("Media final = {}".format(media_suicida(mediaProva, mediaTrabalho)))
| def media_suicida(mediaProvas, mediaTrabalhos):
if mediaProvas >= 5 and mediaTrabalhos >= 5:
return mediaProvas * 0.6 + mediaTrabalhos * 0.4
return min(mediaProvas, mediaTrabalhos)
notas_prova = []
notas_trabalho = []
quantidade_prova = int(input('Quantidade de provas: '))
for item in range(quantidadeProva):
n = float(input('Nota da prova {}: '.format(item + 1)))
notasProva.append(n)
quantidade_trabalho = int(input('Quantidade de trabalhos: '))
for item in range(quantidadeTrabalho):
n = float(input('Nota do trabalho {}: '.format(item + 1)))
notasTrabalho.append(n)
media_prova = sum(notasProva) / quantidadeProva
media_trabalho = sum(notasTrabalho) / quantidadeTrabalho
print('Media final = {}'.format(media_suicida(mediaProva, mediaTrabalho))) |
print('Begin', __name__)
print('Defines fA')
def fA():
print('Inside fA')
if __name__ == "__main__":
print('Calls fA')
fA()
print('End', __name__)
| print('Begin', __name__)
print('Defines fA')
def f_a():
print('Inside fA')
if __name__ == '__main__':
print('Calls fA')
f_a()
print('End', __name__) |
def find_missing_number(sequence):
try:
numbers = sorted(int(word) for word in sequence.split(" ") if word)
except ValueError:
return 1
return next((i + 1 for i, n in enumerate(numbers) if i + 1 != n), 0) | def find_missing_number(sequence):
try:
numbers = sorted((int(word) for word in sequence.split(' ') if word))
except ValueError:
return 1
return next((i + 1 for (i, n) in enumerate(numbers) if i + 1 != n), 0) |
# Lucas Reicher Prompt #3 - Coding Journal #1
def main():
# Uses formatted strings to output the required info (result & type)
# Adds floats
x = 1.342 # float
y = 3.433 # float
z = x + y # float
float_sum_string = "Addition: {0} + {1} = {2} with type = {3}".format(str(x),str(y),str(z),str(type(z)))
print(float_sum_string)
# Subtracts integers
x = 5 # int
y = 2 # int
z = x - y # int
float_difference_string = "Subtraction: {0} - {1} = {2} with type = {3}".format(str(x),str(y),str(z),str(type(z)))
print(float_difference_string)
# Multiplies float and int
x = 1.342 # float
y = 3 # int
z = x * y # float
float_product_string = "Multiplication: {0} * {1} = {2} with type = {3}".format(str(x),str(y),str(z),str(type(z)))
print(float_product_string)
if __name__ == "__main__":
main()
| def main():
x = 1.342
y = 3.433
z = x + y
float_sum_string = 'Addition: {0} + {1} = {2} with type = {3}'.format(str(x), str(y), str(z), str(type(z)))
print(float_sum_string)
x = 5
y = 2
z = x - y
float_difference_string = 'Subtraction: {0} - {1} = {2} with type = {3}'.format(str(x), str(y), str(z), str(type(z)))
print(float_difference_string)
x = 1.342
y = 3
z = x * y
float_product_string = 'Multiplication: {0} * {1} = {2} with type = {3}'.format(str(x), str(y), str(z), str(type(z)))
print(float_product_string)
if __name__ == '__main__':
main() |
# OpenWeatherMap API Key
weather_api_key = "e1067d92d6b631a16363bf4db3023b19"
# Google API Key
g_key = "AIzaSyA4RYdQ1nxoMTIW854C7wvVJMf0Qz5qjNk"
| weather_api_key = 'e1067d92d6b631a16363bf4db3023b19'
g_key = 'AIzaSyA4RYdQ1nxoMTIW854C7wvVJMf0Qz5qjNk' |
class DmsRequestError(Exception):
def __init__(self, error_message, status_code):
self.message = "Error requesting DMS API %s with code %s" \
% (error_message, status_code)
super(DmsRequestError, self).__init__(self.message)
| class Dmsrequesterror(Exception):
def __init__(self, error_message, status_code):
self.message = 'Error requesting DMS API %s with code %s' % (error_message, status_code)
super(DmsRequestError, self).__init__(self.message) |
class Keyword:
def __init__(self, keyword):
if keyword in ['add', 'find']:
self.value = keyword
else:
self.value = 'find'
| class Keyword:
def __init__(self, keyword):
if keyword in ['add', 'find']:
self.value = keyword
else:
self.value = 'find' |
# import datetime
# import logging
# logger = logging.getLogger(__name__)
# logger.setLevel(logging.INFO)
def run(event, context):
# current_time = datetime.datetime.now().time()
# name = context.function_name
# logger.info("Your cron function " + name + " ran at " + str(current_time))
return "hello world!"
| def run(event, context):
return 'hello world!' |
# coding: utf-8
class RurouniException(Exception):
pass
class ConfigException(RurouniException):
pass
class TokenBucketFull(RurouniException):
pass
class UnexpectedMetric(RurouniException):
pass | class Rurouniexception(Exception):
pass
class Configexception(RurouniException):
pass
class Tokenbucketfull(RurouniException):
pass
class Unexpectedmetric(RurouniException):
pass |
# Write a program that reads a word and prints all substrings, sorted by length. For
# example, if the user provides the input "rum" , the program prints
# r
# u
# m
# ru
# um
# rum
word = str(input("Enter a word: "))
wordLen = len(word)
subLen = 1
start = 0
for i in range(wordLen):
start = 0
while start + subLen <= wordLen:
print(word[start:start+subLen])
start += 1
subLen += 1 | word = str(input('Enter a word: '))
word_len = len(word)
sub_len = 1
start = 0
for i in range(wordLen):
start = 0
while start + subLen <= wordLen:
print(word[start:start + subLen])
start += 1
sub_len += 1 |
x = 100
y = 50
print('x=', x, 'y=', y)
| x = 100
y = 50
print('x=', x, 'y=', y) |
BASE_CASE = {
"model": {
"random_seed": 495279142,
"default_age_grid": "0 0.01917808 0.07671233 1 5 10 20 30 40 50 60 70 80 90 100",
"default_time_grid": "1990 1995 2000 2005 2010 2015 2016",
"add_calc_emr": "from_both",
"birth_prev": 0,
"ode_step_size": 5,
"minimum_meas_cv": 0.2,
"rate_case": "iota_pos_rho_zero",
"data_density": "log_gaussian",
"constrain_omega": 1,
"modelable_entity_id": 2005,
"decomp_step_id": 3,
"research_area": 2,
"drill": "drill",
"drill_location_start": 70,
"bundle_id": 173,
"crosswalk_version_id": 5699,
"split_sex": "most_detailed",
"add_csmr_cause": 587,
"drill_sex": 2,
"model_version_id": 472515,
"title": "test diabetes australasia marlena -- 2",
"relabel_incidence": 2,
"description": "<p>diabetes<\/p>",
"addl_ode_stpes": "0.01917808 0.07671233 1.0",
"zero_sum_random": [
"iota"
],
"bound_frac_fixed": 1.0e-8,
"drill_location_end": [72],
"quasi_fixed": 0
},
"max_num_iter": {
"fixed": 200,
"random": 100
},
"print_level": {
"fixed": 5,
"random": 0
},
"accept_after_max_steps": {
"fixed": 5,
"random": 5
},
"students_dof": {
"priors": 5,
"data": 5
},
"log_students_dof": {
"priors": 5,
"data": 5
},
"eta": {
"priors": 1.0e-5,
"data": 1.0e-5
},
"config_version": "mnorwood",
"rate": [
{
"age_time_specific": 1,
"default": {
"value": {
"density": "gaussian",
"min": 1.0e-6,
"mean": 0.00015,
"max": 0.01,
"std": 1.5,
"eta": 1.0e-6
},
"dage": {
"density": "gaussian",
"min": -1,
"mean": 0,
"max": 1,
"std": 0.01
},
"dtime": {
"density": "gaussian",
"min": -1,
"mean": 0,
"max": 1,
"std": 0.01
}
},
"rate": "iota",
"age_grid": "0 5 10 50 100"
},
{
"age_time_specific": 1,
"default": {
"value": {
"density": "gaussian",
"min": 1.0e-6,
"mean": 0.0004,
"max": 0.01,
"std": 0.2
},
"dage": {
"density": "gaussian",
"min": -1,
"mean": 0,
"max": 1,
"std": 0.01
},
"dtime": {
"density": "gaussian",
"min": -1,
"mean": 0,
"max": 1,
"std": 0.01
}
},
"rate": "chi"
},
{
"age_time_specific": 0,
"default": {
"value": {
"density": "log_gaussian",
"min": 0,
"mean": 0.1,
"max": 0.2,
"std": 1,
"eta": 1.0e-6
},
"dage": {
"density": "uniform",
"min": -1,
"mean": 0,
"max": 1
},
"dtime": {
"density": "uniform",
"min": -1,
"mean": 0,
"max": 1
}
},
"rate": "pini"
}
],
"random_effect": [
{
"age_time_specific": 0,
"default": {
"value": {
"density": "gaussian",
"mean": 0,
"std": 1
},
"dage": {
"mean": 0,
"std": 1,
"density": "uniform"
},
"dtime": {
"mean": 0,
"std": 1,
"density": "uniform"
}
},
"rate": "iota"
}
],
"study_covariate": [
{
"age_time_specific": 0,
"mulcov_type": "rate_value",
"default": {
"value": {
"density": "uniform",
"min": -1,
"mean": 0,
"max": 1
},
"dage": {
"density": "uniform",
"min": -1,
"mean": 0,
"max": 1
},
"dtime": {
"density": "uniform",
"min": -1,
"mean": 0,
"max": 1
}
},
"study_covariate_id": 0,
"transformation": 0,
"measure_id": 41
}
],
"country_covariate": [
{
"age_time_specific": 0,
"mulcov_type": "rate_value",
"measure_id": 41,
"country_covariate_id": 28,
"transformation": 0,
"default": {
"value": {
"density": "uniform",
"min": -1,
"mean": 0,
"max": 1,
"eta": 1.0e-5
}
}
}
],
"gbd_round_id": 6,
"csmr_cod_output_version_id": 84,
"csmr_mortality_output_version_id": 8003,
"location_set_version_id": 684,
"tolerance": {
"fixed": 1.0e-6,
"random": 1.0e-6
}
}
| base_case = {'model': {'random_seed': 495279142, 'default_age_grid': '0 0.01917808 0.07671233 1 5 10 20 30 40 50 60 70 80 90 100', 'default_time_grid': '1990 1995 2000 2005 2010 2015 2016', 'add_calc_emr': 'from_both', 'birth_prev': 0, 'ode_step_size': 5, 'minimum_meas_cv': 0.2, 'rate_case': 'iota_pos_rho_zero', 'data_density': 'log_gaussian', 'constrain_omega': 1, 'modelable_entity_id': 2005, 'decomp_step_id': 3, 'research_area': 2, 'drill': 'drill', 'drill_location_start': 70, 'bundle_id': 173, 'crosswalk_version_id': 5699, 'split_sex': 'most_detailed', 'add_csmr_cause': 587, 'drill_sex': 2, 'model_version_id': 472515, 'title': 'test diabetes australasia marlena -- 2', 'relabel_incidence': 2, 'description': '<p>diabetes<\\/p>', 'addl_ode_stpes': '0.01917808 0.07671233 1.0', 'zero_sum_random': ['iota'], 'bound_frac_fixed': 1e-08, 'drill_location_end': [72], 'quasi_fixed': 0}, 'max_num_iter': {'fixed': 200, 'random': 100}, 'print_level': {'fixed': 5, 'random': 0}, 'accept_after_max_steps': {'fixed': 5, 'random': 5}, 'students_dof': {'priors': 5, 'data': 5}, 'log_students_dof': {'priors': 5, 'data': 5}, 'eta': {'priors': 1e-05, 'data': 1e-05}, 'config_version': 'mnorwood', 'rate': [{'age_time_specific': 1, 'default': {'value': {'density': 'gaussian', 'min': 1e-06, 'mean': 0.00015, 'max': 0.01, 'std': 1.5, 'eta': 1e-06}, 'dage': {'density': 'gaussian', 'min': -1, 'mean': 0, 'max': 1, 'std': 0.01}, 'dtime': {'density': 'gaussian', 'min': -1, 'mean': 0, 'max': 1, 'std': 0.01}}, 'rate': 'iota', 'age_grid': '0 5 10 50 100'}, {'age_time_specific': 1, 'default': {'value': {'density': 'gaussian', 'min': 1e-06, 'mean': 0.0004, 'max': 0.01, 'std': 0.2}, 'dage': {'density': 'gaussian', 'min': -1, 'mean': 0, 'max': 1, 'std': 0.01}, 'dtime': {'density': 'gaussian', 'min': -1, 'mean': 0, 'max': 1, 'std': 0.01}}, 'rate': 'chi'}, {'age_time_specific': 0, 'default': {'value': {'density': 'log_gaussian', 'min': 0, 'mean': 0.1, 'max': 0.2, 'std': 1, 'eta': 1e-06}, 'dage': {'density': 'uniform', 'min': -1, 'mean': 0, 'max': 1}, 'dtime': {'density': 'uniform', 'min': -1, 'mean': 0, 'max': 1}}, 'rate': 'pini'}], 'random_effect': [{'age_time_specific': 0, 'default': {'value': {'density': 'gaussian', 'mean': 0, 'std': 1}, 'dage': {'mean': 0, 'std': 1, 'density': 'uniform'}, 'dtime': {'mean': 0, 'std': 1, 'density': 'uniform'}}, 'rate': 'iota'}], 'study_covariate': [{'age_time_specific': 0, 'mulcov_type': 'rate_value', 'default': {'value': {'density': 'uniform', 'min': -1, 'mean': 0, 'max': 1}, 'dage': {'density': 'uniform', 'min': -1, 'mean': 0, 'max': 1}, 'dtime': {'density': 'uniform', 'min': -1, 'mean': 0, 'max': 1}}, 'study_covariate_id': 0, 'transformation': 0, 'measure_id': 41}], 'country_covariate': [{'age_time_specific': 0, 'mulcov_type': 'rate_value', 'measure_id': 41, 'country_covariate_id': 28, 'transformation': 0, 'default': {'value': {'density': 'uniform', 'min': -1, 'mean': 0, 'max': 1, 'eta': 1e-05}}}], 'gbd_round_id': 6, 'csmr_cod_output_version_id': 84, 'csmr_mortality_output_version_id': 8003, 'location_set_version_id': 684, 'tolerance': {'fixed': 1e-06, 'random': 1e-06}} |
#Write a function named "falling_distance" that accepts an object's falling time
#(in seconds) as an argument. The function should return the distance, in meters
#, that the object has fallen during the time interval.Write a program that
#calls the function in a loop that passes the values 1 through 10 as arguments
#and displays the return value.
def main():
print("This program shows an object's fall distance (in meters) with each")
print('passing second from 1 to 10.')
print()
print('Time(s)\tDistance(m)')
print('--------------------')
for time in range (10 + 1):
distance = falling_distance(time)
print(time, '\t', format(distance, ',.1f'))
def falling_distance(time):
g = 9.8
distance = 0.5*g*time**2 #I believe the formula is incorrect, i think it
return distance #means (1/2)gt^2
main()
| def main():
print("This program shows an object's fall distance (in meters) with each")
print('passing second from 1 to 10.')
print()
print('Time(s)\tDistance(m)')
print('--------------------')
for time in range(10 + 1):
distance = falling_distance(time)
print(time, '\t', format(distance, ',.1f'))
def falling_distance(time):
g = 9.8
distance = 0.5 * g * time ** 2
return distance
main() |
a=list(input().split(','))
st,num=[],[]
for i in a:
s1,n=i.split(':')
st.append(s1)
num.append(n)
print(st)
print(num)
for i in range(len(num)):
for j in range(i):
print(st[j])
| a = list(input().split(','))
(st, num) = ([], [])
for i in a:
(s1, n) = i.split(':')
st.append(s1)
num.append(n)
print(st)
print(num)
for i in range(len(num)):
for j in range(i):
print(st[j]) |
GitHubTarballPackage ('mono', 'mono-basic', '3.0', 'a74642af7f72d1012c87d82d7a12ac04a17858d5',
configure = './configure --prefix="%{prefix}"',
override_properties = { 'make': 'make' }
)
| git_hub_tarball_package('mono', 'mono-basic', '3.0', 'a74642af7f72d1012c87d82d7a12ac04a17858d5', configure='./configure --prefix="%{prefix}"', override_properties={'make': 'make'}) |
# Asking for height and weight input
height = float(input("What is your height in meters: "))
weight = float(input("What is your weight in kilograms: "))
# Calculating BMI (formula is weight/height^2)
bmi = str(round(weight/(height ** 2), 2))
# Printing BMI
print("Your BMI is " + bmi)
| height = float(input('What is your height in meters: '))
weight = float(input('What is your weight in kilograms: '))
bmi = str(round(weight / height ** 2, 2))
print('Your BMI is ' + bmi) |
# IMAGES #
# UI NAVIGATION #
img_addFriend = "add_friend.png"
img_allow = "allow.png"
img_allowFlash = "enableflash_0.png"
img_allowFlash1 = "enableflash_1.png"
img_allowFlash2 = "enableflash_2.png"
img_alreadyStarted = "alreadystarted.png"
img_alreadyStarted1 = "alreadystarted1.png"
img_backButton = "back_button.png"
img_beginningGame = "beginninggame.png"
img_challengeFriend = "challenge_friend.png"
img_cheapButtonFriend = "cheap_button_friend.png"
img_cheapButton = "cheap_button.png"
img_cueUpdate = "cueUpdate.png"
img_cues = "cues.png"
img_collectCoins = "collectcoins.png"
img_collectCoins1 = "collectcoins_1.png"
img_defaultAcct = "defaultaccount.png"
img_eightBallSpinButton = "8ballspin_button.png"
img_emailArea = "email_area.png"
img_facebookLogo = "facebooklogo.png"
img_inviteFriend = "invite_friend.png"
img_isGameStart = "isgamestart.png"
img_loginButton3 = "login3_button.png"
img_loginWithMiniclip = "login_with_miniclip.png"
img_luckyShot = "luckyShot.png"
img_mainMenuBefore = "mainmenu_before.png"
img_passwordArea = "password_area.png"
img_playButtonGuest = "play_button_guest.png"
img_playButtonLogged = "play_button_logged.png"
img_playFree = "playFree.png"
img_playFriends = "playfriends.png"
img_playNow = "playnow.png"
img_poolChoice = "poolchoice.png"
img_poolChoice1 = "poolchoice1.png"
img_poolChoice200 = "poolchoice200.png"
img_poolChoice200_1 = "poolchoice200_1.png"
img_searchFriends = "search_friends.png"
img_searchFriends1 = "search_friends2.png"
img_searchFriends2 = "search_friends3.png"
img_signUpLogin = "signup_login_button.png"
img_spinWinCollect = "spinwin_collect.png"
img_spinWinIcon = "spinwinicon.png"
img_spinWinX = "spinwin_x.png"
img_topRightCorner = "top_right_corner.png"
img_topRightCornerLogged = "top_right_corner_logged.png"
img_turn = "turn.png"
img_turn1 = "turn1.png"
img_opponentTurn = "playertwoturn.png"
img_opponentTurn1 = "playertwoturn1.png"
img_url = "url.png"
img_url2 = "url2.png"
img_url3 = "url3.png"
img_urlBar = "urlbar.png"
img_unsecure = "unsecure.png"
img_xOut = "xout.png"
# UI NAVIGATION #
# GAME NAVIGATION #
img_1ball = "1ball.png"
img_2ball = "2ball.png"
img_3ball = "3ball.png"
img_4ball = "4ball.png"
img_5ball = "5ball.png"
img_6ball = "6ball.png"
img_7ball = "7ball.png"
img_8ball = "8ball.png"
img_9ball = "9ball.png"
img_10ball = "10ball.png"
img_11ball = "11ball.png"
img_12ball = "12ball.png"
img_13ball = "13ball.png"
img_14ball = "14ball.png"
img_15ball = "15ball.png"
img_1ballDark = "1ballDark.png"
img_2ballDark = "2ballDark.png"
img_3ballDark = "3ballDark.png"
img_4ballDark = "4ballDark.png"
img_5ballDark = "5ballDark.png"
img_6ballDark = "6ballDark.png"
img_7ballDark = "7ballDark.png"
img_8ballDark = "8ballDark.png"
img_9ballDark = "9ballDark.png"
img_10ballDark = "10ballDark.png"
img_11ballDark = "11ballDark.png"
img_12ballDark = "12ballDark.png"
img_13ballDark = "13ballDark.png"
img_14ballDark = "14ballDark.png"
img_15ballDark = "15ballDark.png"
img_cueball = "cueball.png"
img_eightball = "eightball.png"
img_ballPic1 = "ballpic1.png"
img_tlh = "tlh.png"
img_tmh = "tmh.png"
img_trh = "trh.png"
img_blh = "blh.png"
img_bmh = "bmh.png"
img_brh = "brh.png"
img_topRail = "toprail.png"
img_bottomRail = "bottomrail.png"
img_leftRail = "leftrail.png"
img_rightRail = "rightrail.png"
# GAME NAVIGATION #
# IMAGES #
debug = False | img_add_friend = 'add_friend.png'
img_allow = 'allow.png'
img_allow_flash = 'enableflash_0.png'
img_allow_flash1 = 'enableflash_1.png'
img_allow_flash2 = 'enableflash_2.png'
img_already_started = 'alreadystarted.png'
img_already_started1 = 'alreadystarted1.png'
img_back_button = 'back_button.png'
img_beginning_game = 'beginninggame.png'
img_challenge_friend = 'challenge_friend.png'
img_cheap_button_friend = 'cheap_button_friend.png'
img_cheap_button = 'cheap_button.png'
img_cue_update = 'cueUpdate.png'
img_cues = 'cues.png'
img_collect_coins = 'collectcoins.png'
img_collect_coins1 = 'collectcoins_1.png'
img_default_acct = 'defaultaccount.png'
img_eight_ball_spin_button = '8ballspin_button.png'
img_email_area = 'email_area.png'
img_facebook_logo = 'facebooklogo.png'
img_invite_friend = 'invite_friend.png'
img_is_game_start = 'isgamestart.png'
img_login_button3 = 'login3_button.png'
img_login_with_miniclip = 'login_with_miniclip.png'
img_lucky_shot = 'luckyShot.png'
img_main_menu_before = 'mainmenu_before.png'
img_password_area = 'password_area.png'
img_play_button_guest = 'play_button_guest.png'
img_play_button_logged = 'play_button_logged.png'
img_play_free = 'playFree.png'
img_play_friends = 'playfriends.png'
img_play_now = 'playnow.png'
img_pool_choice = 'poolchoice.png'
img_pool_choice1 = 'poolchoice1.png'
img_pool_choice200 = 'poolchoice200.png'
img_pool_choice200_1 = 'poolchoice200_1.png'
img_search_friends = 'search_friends.png'
img_search_friends1 = 'search_friends2.png'
img_search_friends2 = 'search_friends3.png'
img_sign_up_login = 'signup_login_button.png'
img_spin_win_collect = 'spinwin_collect.png'
img_spin_win_icon = 'spinwinicon.png'
img_spin_win_x = 'spinwin_x.png'
img_top_right_corner = 'top_right_corner.png'
img_top_right_corner_logged = 'top_right_corner_logged.png'
img_turn = 'turn.png'
img_turn1 = 'turn1.png'
img_opponent_turn = 'playertwoturn.png'
img_opponent_turn1 = 'playertwoturn1.png'
img_url = 'url.png'
img_url2 = 'url2.png'
img_url3 = 'url3.png'
img_url_bar = 'urlbar.png'
img_unsecure = 'unsecure.png'
img_x_out = 'xout.png'
img_1ball = '1ball.png'
img_2ball = '2ball.png'
img_3ball = '3ball.png'
img_4ball = '4ball.png'
img_5ball = '5ball.png'
img_6ball = '6ball.png'
img_7ball = '7ball.png'
img_8ball = '8ball.png'
img_9ball = '9ball.png'
img_10ball = '10ball.png'
img_11ball = '11ball.png'
img_12ball = '12ball.png'
img_13ball = '13ball.png'
img_14ball = '14ball.png'
img_15ball = '15ball.png'
img_1ball_dark = '1ballDark.png'
img_2ball_dark = '2ballDark.png'
img_3ball_dark = '3ballDark.png'
img_4ball_dark = '4ballDark.png'
img_5ball_dark = '5ballDark.png'
img_6ball_dark = '6ballDark.png'
img_7ball_dark = '7ballDark.png'
img_8ball_dark = '8ballDark.png'
img_9ball_dark = '9ballDark.png'
img_10ball_dark = '10ballDark.png'
img_11ball_dark = '11ballDark.png'
img_12ball_dark = '12ballDark.png'
img_13ball_dark = '13ballDark.png'
img_14ball_dark = '14ballDark.png'
img_15ball_dark = '15ballDark.png'
img_cueball = 'cueball.png'
img_eightball = 'eightball.png'
img_ball_pic1 = 'ballpic1.png'
img_tlh = 'tlh.png'
img_tmh = 'tmh.png'
img_trh = 'trh.png'
img_blh = 'blh.png'
img_bmh = 'bmh.png'
img_brh = 'brh.png'
img_top_rail = 'toprail.png'
img_bottom_rail = 'bottomrail.png'
img_left_rail = 'leftrail.png'
img_right_rail = 'rightrail.png'
debug = False |
class EfficiencyMeasurement():
# input_voltage = None
# input_current = None
# output_voltage = None
# output_current = None
# input_power = None
# output_power = None
# loss_power = None
# efficiency = None
def __init__(self, input_voltage: float, input_current: float,
output_voltage: float, output_current: float):
self.input_voltage = input_voltage
self.input_current = input_current
self.output_voltage = output_voltage
self.output_current = output_current
self.input_power = calc_power(voltage = input_voltage, current = input_current)
self.output_power = calc_power(voltage = output_voltage, current = output_current)
self.loss_power = calc_loss_power(input_power=self.input_power, ouput_power=self.output_power)
class TsetPoint():
setup = None
measurement = None #EfficiencyMeasurement()
class TestSet_Efficiency():
def __init__(self, s: dict):
self.source_bias = s['source_bias']
self.dut = s['powertrain']
self.load = s['load'] | class Efficiencymeasurement:
def __init__(self, input_voltage: float, input_current: float, output_voltage: float, output_current: float):
self.input_voltage = input_voltage
self.input_current = input_current
self.output_voltage = output_voltage
self.output_current = output_current
self.input_power = calc_power(voltage=input_voltage, current=input_current)
self.output_power = calc_power(voltage=output_voltage, current=output_current)
self.loss_power = calc_loss_power(input_power=self.input_power, ouput_power=self.output_power)
class Tsetpoint:
setup = None
measurement = None
class Testset_Efficiency:
def __init__(self, s: dict):
self.source_bias = s['source_bias']
self.dut = s['powertrain']
self.load = s['load'] |
class Y:
def __init__(self, v0):
self.v0 = v0
self.g = 9.81
def value(self, t):
return self.v0*t - 0.5*self.g*t**2
def formula(self):
return "v0*t - 0.5*g*t**2; v0=%g" % self.v0
| class Y:
def __init__(self, v0):
self.v0 = v0
self.g = 9.81
def value(self, t):
return self.v0 * t - 0.5 * self.g * t ** 2
def formula(self):
return 'v0*t - 0.5*g*t**2; v0=%g' % self.v0 |
class ATMOS(object):
'''
class ATMOS
- attributes:
- self defined
- methods:
- None
'''
def __init__(self,info):
self.info = info
for key in info.keys():
setattr(self, key, info[key])
def __repr__(self):
return 'Instance of class ATMOS' | class Atmos(object):
"""
class ATMOS
- attributes:
- self defined
- methods:
- None
"""
def __init__(self, info):
self.info = info
for key in info.keys():
setattr(self, key, info[key])
def __repr__(self):
return 'Instance of class ATMOS' |
t=int(input())
if not (1 <= t <= 100000): exit(-1)
dp=[0]*100001
dp[3]=3
for i in range(4,100001):
if i%3==0 or i%7==0: dp[i]=i
dp[i]+=dp[i-1]
query=[*map(int,input().split())]
if len(query)!=t: exit(-1)
for i in query:
if not (10 <= int(i) <= 80000): exit(-1)
print(dp[int(i)])
succ=False
try: input()
except: succ=True
if not succ: exit(-1) | t = int(input())
if not 1 <= t <= 100000:
exit(-1)
dp = [0] * 100001
dp[3] = 3
for i in range(4, 100001):
if i % 3 == 0 or i % 7 == 0:
dp[i] = i
dp[i] += dp[i - 1]
query = [*map(int, input().split())]
if len(query) != t:
exit(-1)
for i in query:
if not 10 <= int(i) <= 80000:
exit(-1)
print(dp[int(i)])
succ = False
try:
input()
except:
succ = True
if not succ:
exit(-1) |
N = int(input())
A = list(map(int, input().split()))
ans = 0
for a in A:
if a > 10:
ans += a - 10
print(ans) | n = int(input())
a = list(map(int, input().split()))
ans = 0
for a in A:
if a > 10:
ans += a - 10
print(ans) |
#!/usr/bin/env python
# encoding: utf-8
def run(whatweb, pluginname):
whatweb.recog_from_content(pluginname, "espcms")
whatweb.recog_from_file(pluginname, "templates/wap/cn/public/footer.html", "espcms")
| def run(whatweb, pluginname):
whatweb.recog_from_content(pluginname, 'espcms')
whatweb.recog_from_file(pluginname, 'templates/wap/cn/public/footer.html', 'espcms') |
vetor = []
entradaUsuario = int(input())
repetir = 1000
indice = 0
adicionar = 0
while(repetir > 0):
vetor.append(adicionar)
adicionar += 1
if(adicionar == entradaUsuario):
adicionar = 0
repetir -= 1
repetir = 1000
while(repetir>0):
repetir -= 1
print("N[{}] = {}".format(indice, vetor[indice]))
indice += 1
| vetor = []
entrada_usuario = int(input())
repetir = 1000
indice = 0
adicionar = 0
while repetir > 0:
vetor.append(adicionar)
adicionar += 1
if adicionar == entradaUsuario:
adicionar = 0
repetir -= 1
repetir = 1000
while repetir > 0:
repetir -= 1
print('N[{}] = {}'.format(indice, vetor[indice]))
indice += 1 |
# AUTHOR = PAUL KEARNEY
# DATE = 2018-02-05
# STUDENT ID = G00364787
# EXERCISE 03
#
# filename= gmit--exercise03--collatz--20180205d.py
#
# the Collatz conjecture
print("The COLLATZ CONJECTURE")
# define the variables
num = ""
x = 0
# obtain user input
num = input("A start nummber: ")
x = int(num)
print("--Start of sequence.")
print (x)
# calculate the sequence/conjecture
while x != 1:
if x % 2 == 0:
x = x / 2
else:
x = (x * 3) + 1
print(int(x))
print("--End of sequence")
#
#
#
#
#
#
#
# WEEK 03
#
# filename= gmit--week03--collatz--20180205d.py
#
# STUDENT ID= g00364787
#
# the Collatz conjecture
#
#
#
#The COLLATZ CONJECTURE
#
#A start nummber: 12
#--Start of sequence.
#12
#6
#3
#10
#5
#16
#8
#4
#2
#1
#--End of sequence
#
## end ##
| print('The COLLATZ CONJECTURE')
num = ''
x = 0
num = input('A start nummber: ')
x = int(num)
print('--Start of sequence.')
print(x)
while x != 1:
if x % 2 == 0:
x = x / 2
else:
x = x * 3 + 1
print(int(x))
print('--End of sequence') |
DEFAULT_TEXT_TYPE = "mrkdwn"
class BaseBlock:
def generate(self):
raise NotImplemented("Subclass missing generate implementation")
class TextBlock(BaseBlock):
def __init__(self, text, _type=DEFAULT_TEXT_TYPE):
self._text = text
self._type = _type
def __repr__(self):
return f"TextBlock({self._text}, _type={self._type})"
def generate(self):
return {"type": "section", "text": {"type": self._type, "text": self._text}}
| default_text_type = 'mrkdwn'
class Baseblock:
def generate(self):
raise not_implemented('Subclass missing generate implementation')
class Textblock(BaseBlock):
def __init__(self, text, _type=DEFAULT_TEXT_TYPE):
self._text = text
self._type = _type
def __repr__(self):
return f'TextBlock({self._text}, _type={self._type})'
def generate(self):
return {'type': 'section', 'text': {'type': self._type, 'text': self._text}} |
#Script to calc. area of circle.
print("enter the radius")
r= float(input())
area= 3.14*r**2
print("area of circle is",area)
| print('enter the radius')
r = float(input())
area = 3.14 * r ** 2
print('area of circle is', area) |
#doc4
#1.
print([1, 'Hello', 1.0])
#2
print([1, 1, [1,2]][2][1])
#3. out: 'b', 'c'
print(['a','b', 'c'][1:])
#4.
weekDict= {'Sunday':0,'Monday':1,'Tuesday':2,'Wednesday':3,'Thursday':4,'Friday':5,'Saturday':6, }
#5. out: 2 if you replace D[k1][1] with D['k1][1]
D={'k1':[1,2,3]}
print(D['k1'][1])
#6.
tup = ( 'a', [1,[2,3]] )
print(tup)
#7.
x= set('Missipi')
print(x)
#8
x.add('X')
print(x)
#9 out: [1, 2, ,3]
print(set([1,1,2,3]))
#10
for i in range(2000,3001):
if (i%7==0) and (i%5!=0):
print(i) | print([1, 'Hello', 1.0])
print([1, 1, [1, 2]][2][1])
print(['a', 'b', 'c'][1:])
week_dict = {'Sunday': 0, 'Monday': 1, 'Tuesday': 2, 'Wednesday': 3, 'Thursday': 4, 'Friday': 5, 'Saturday': 6}
d = {'k1': [1, 2, 3]}
print(D['k1'][1])
tup = ('a', [1, [2, 3]])
print(tup)
x = set('Missipi')
print(x)
x.add('X')
print(x)
print(set([1, 1, 2, 3]))
for i in range(2000, 3001):
if i % 7 == 0 and i % 5 != 0:
print(i) |
description = 'Resi instrument setup'
group = 'basic'
includes = ['base']
| description = 'Resi instrument setup'
group = 'basic'
includes = ['base'] |
def quick_sort(array):
'''
Prototypical quick sort algorithm using Python
Time and Space Complexity:
* Best: O(n * log(n)) time | O(log(n)) space
* Avg: O(n * log(n)) time | O(log(n)) space
* Worst: O(n^2) time | O(log(n)) space
'''
return _quick_sort(array, 0, len(array)-1)
def _quick_sort(array, start, end):
# We don't need to sort an array of size 1 (already sorted), or less
if start >= end:
return
pivot = partition(array, start, end)
_quick_sort(array, start, pivot-1)
_quick_sort(array, pivot+1, end)
def partition(array, start, end):
pivot, pivotVal = start, array[start]
left, right = start+1, end
while left <= right:
if array[left] > pivotVal and array[right] < pivotVal:
swap(array, left, right)
if array[left] <= pivotVal:
left += 1
if pivotVal <= array[right]:
right -= 1
swap(array, pivot, right)
return right
def swap(array, i, j):
'''
Swaps the value at the i-th index with the value at the j-th index in place.
'''
if i < 0 or i > len(array)-1:
raise IndexError(f'Index <i> of {i} is not a valid index of <array>')
elif j < 0 or j > len(array)-1:
raise IndexError(f'Index <j> of {j} is not a valid index of <array>')
elif i == j:
return
array[i], array[j] = array[j], array[i]
test_cases = [
[],
[3,2],
[2,3,1],
[1,2,3],
[33, 33, 33, 33, 33],
[33, 33, 33, 33, 44],
[16, 1, 53, 99, 16, 9, 100, 300, 12],
]
for test_case in test_cases:
result = test_case.copy()
quick_sort(result)
assert result == sorted(test_case) | def quick_sort(array):
"""
Prototypical quick sort algorithm using Python
Time and Space Complexity:
* Best: O(n * log(n)) time | O(log(n)) space
* Avg: O(n * log(n)) time | O(log(n)) space
* Worst: O(n^2) time | O(log(n)) space
"""
return _quick_sort(array, 0, len(array) - 1)
def _quick_sort(array, start, end):
if start >= end:
return
pivot = partition(array, start, end)
_quick_sort(array, start, pivot - 1)
_quick_sort(array, pivot + 1, end)
def partition(array, start, end):
(pivot, pivot_val) = (start, array[start])
(left, right) = (start + 1, end)
while left <= right:
if array[left] > pivotVal and array[right] < pivotVal:
swap(array, left, right)
if array[left] <= pivotVal:
left += 1
if pivotVal <= array[right]:
right -= 1
swap(array, pivot, right)
return right
def swap(array, i, j):
"""
Swaps the value at the i-th index with the value at the j-th index in place.
"""
if i < 0 or i > len(array) - 1:
raise index_error(f'Index <i> of {i} is not a valid index of <array>')
elif j < 0 or j > len(array) - 1:
raise index_error(f'Index <j> of {j} is not a valid index of <array>')
elif i == j:
return
(array[i], array[j]) = (array[j], array[i])
test_cases = [[], [3, 2], [2, 3, 1], [1, 2, 3], [33, 33, 33, 33, 33], [33, 33, 33, 33, 44], [16, 1, 53, 99, 16, 9, 100, 300, 12]]
for test_case in test_cases:
result = test_case.copy()
quick_sort(result)
assert result == sorted(test_case) |
def loops():
# String Array
names = ["Apple", "Orange", "Pear"]
# \n is a newline in a string
print('\n---------------')
print(' For Each Loop')
print('---------------\n')
# For Each Loop
for i in names:
print(i)
print('\n---------------')
print(' For Loop')
print('---------------\n')
# For Loop
# the range() function can take a min, max, and interval
# value, max is non-inclusive i.e. 101 stops at 100
# example: range(0, 101, 2)
for i in range(5):
if i == 1:
print('1, continue')
# continue will move to the next iteration in the loop
continue
elif i == 3:
print('3, break')
# the break statement will end the loop
break
# if the number doesn't fit the conditions above
# it will be printed to the console
print(i)
print('\n---------------')
print(' While Loop')
print('---------------\n')
# Boolean variables hold True or False, 0 or 1
loop = True
# Integer variables hold whole numbers
iterations = 0
max_iterations = 10
print('0 -', max_iterations, '\n')
# The while loop will run as long as the given
# condition or variable is true
# Parentheses are optional
while loop:
# the += operator adds the given value to
# the current value of a variable
iterations += 1
print(iterations)
if iterations == max_iterations:
# break will end a loops execution
break
if __name__ == '__main__':
loops()
| def loops():
names = ['Apple', 'Orange', 'Pear']
print('\n---------------')
print(' For Each Loop')
print('---------------\n')
for i in names:
print(i)
print('\n---------------')
print(' For Loop')
print('---------------\n')
for i in range(5):
if i == 1:
print('1, continue')
continue
elif i == 3:
print('3, break')
break
print(i)
print('\n---------------')
print(' While Loop')
print('---------------\n')
loop = True
iterations = 0
max_iterations = 10
print('0 -', max_iterations, '\n')
while loop:
iterations += 1
print(iterations)
if iterations == max_iterations:
break
if __name__ == '__main__':
loops() |
class Node:
def __init__(self, value, next_p=None):
self.next = next_p
self.value = value
def __str__(self):
return f'{self.value}'
class InvalidOperationError(Exception):
pass
class Stack:
def __init__(self):
self.top = None
def push(self, value):
current = self.top
if self.top == None:
self.top = Node(value)
else:
node_n = Node(value)
node_n.next = self.top
self.top = node_n
def pop(self):
if not self.top:
raise InvalidOperationError('Method not allowed on empty collection')
if self.top:
top_value = self.top
self.top = self.top.next
return top_value.value
def peek(self):
if not self.top:
raise InvalidOperationError("Method not allowed on empty collection")
return self.top.value
def is_empty(self):
return not self.top
class Queue:
def __init__(self):
self.f = None
self.r = None
def enqueue(self, value):
node = Node(value)
if self.r:
node = self.r.next
node = self.r
def dequeue(self):
if not self.f:
raise InvalidOperationError('Method not allowed on empty collection')
leave = self.f
if self.f == self.r:
self.r = None
self.f = self.f.next
return leave.value
def peek(self):
if not self.f:
raise InvalidOperationError('Method not allowed on empty collection')
return self.f.value
def is_empty(self):
return not self.f and not self.r
| class Node:
def __init__(self, value, next_p=None):
self.next = next_p
self.value = value
def __str__(self):
return f'{self.value}'
class Invalidoperationerror(Exception):
pass
class Stack:
def __init__(self):
self.top = None
def push(self, value):
current = self.top
if self.top == None:
self.top = node(value)
else:
node_n = node(value)
node_n.next = self.top
self.top = node_n
def pop(self):
if not self.top:
raise invalid_operation_error('Method not allowed on empty collection')
if self.top:
top_value = self.top
self.top = self.top.next
return top_value.value
def peek(self):
if not self.top:
raise invalid_operation_error('Method not allowed on empty collection')
return self.top.value
def is_empty(self):
return not self.top
class Queue:
def __init__(self):
self.f = None
self.r = None
def enqueue(self, value):
node = node(value)
if self.r:
node = self.r.next
node = self.r
def dequeue(self):
if not self.f:
raise invalid_operation_error('Method not allowed on empty collection')
leave = self.f
if self.f == self.r:
self.r = None
self.f = self.f.next
return leave.value
def peek(self):
if not self.f:
raise invalid_operation_error('Method not allowed on empty collection')
return self.f.value
def is_empty(self):
return not self.f and (not self.r) |
def main():
number = int(input("Enter number (Only positive integer is allowed)"))
print(f'{number} square is {number ** 2}')
# Press the green button in the gutter to run the script.
if __name__ == '__main__':
main()
| def main():
number = int(input('Enter number (Only positive integer is allowed)'))
print(f'{number} square is {number ** 2}')
if __name__ == '__main__':
main() |
number_of_computers = int(input())
number_of_sales = 0
real_sales = 0
made_sales = 0
counter_sales = 0
total_ratings = 0
for i in range (number_of_computers):
rating = int(input())
rating_scale = rating % 10
possible_sales = rating // 10
total_ratings += rating_scale
if rating_scale == 2:
real_sales = possible_sales * 0 / 100
counter_sales += real_sales
elif rating_scale == 3:
real_sales = possible_sales * 50 / 100
counter_sales += real_sales
elif rating_scale == 4:
real_sales = possible_sales * 70 / 100
counter_sales += real_sales
elif rating_scale == 5:
real_sales = possible_sales * 85 / 100
counter_sales += real_sales
elif rating_scale == 6:
real_sales = possible_sales * 100 / 100
counter_sales += real_sales
average_rating = total_ratings / number_of_computers
print (f'{counter_sales:.2f}')
print (f'{average_rating:.2f}')
| number_of_computers = int(input())
number_of_sales = 0
real_sales = 0
made_sales = 0
counter_sales = 0
total_ratings = 0
for i in range(number_of_computers):
rating = int(input())
rating_scale = rating % 10
possible_sales = rating // 10
total_ratings += rating_scale
if rating_scale == 2:
real_sales = possible_sales * 0 / 100
counter_sales += real_sales
elif rating_scale == 3:
real_sales = possible_sales * 50 / 100
counter_sales += real_sales
elif rating_scale == 4:
real_sales = possible_sales * 70 / 100
counter_sales += real_sales
elif rating_scale == 5:
real_sales = possible_sales * 85 / 100
counter_sales += real_sales
elif rating_scale == 6:
real_sales = possible_sales * 100 / 100
counter_sales += real_sales
average_rating = total_ratings / number_of_computers
print(f'{counter_sales:.2f}')
print(f'{average_rating:.2f}') |
def main():
valid_passwords_by_range_policy = 0
valid_passwords_by_position_policy = 0
with open('input') as f:
for line in f:
policy_string, password = parse_line(line.strip())
policy = Policy.parse(policy_string)
if policy.is_valid_by_range_policy(password):
valid_passwords_by_range_policy += 1
if policy.is_valid_by_position_policy(password):
valid_passwords_by_position_policy += 1
print(f'There are {valid_passwords_by_range_policy} valid passwords by "range" policy.')
print(f'There are {valid_passwords_by_position_policy} valid passwords by "position" policy.')
def parse_line(line):
tokens = line.split(':', 1)
policy_string = tokens[0]
password = tokens[1].strip()
return policy_string, password
class Policy:
def __init__(self, first_number, second_number, letter):
self._first_number = first_number
self._second_number = second_number
self._letter = letter
def is_valid_by_range_policy(self, password):
count = password.count(self._letter)
return count >= self._first_number and count <= self._second_number
def is_valid_by_position_policy(self, password):
index1 = self._first_number - 1
index2 = self._second_number - 1
return (password[index1] == self._letter) != (password[index2] == self._letter)
@classmethod
def parse (cls, string):
tokens = string.split(' ')
first_number_string, second_number_string = tokens[0].split('-')
letter = tokens[1]
return cls(int(first_number_string), int(second_number_string), letter)
if __name__ == '__main__':
main()
| def main():
valid_passwords_by_range_policy = 0
valid_passwords_by_position_policy = 0
with open('input') as f:
for line in f:
(policy_string, password) = parse_line(line.strip())
policy = Policy.parse(policy_string)
if policy.is_valid_by_range_policy(password):
valid_passwords_by_range_policy += 1
if policy.is_valid_by_position_policy(password):
valid_passwords_by_position_policy += 1
print(f'There are {valid_passwords_by_range_policy} valid passwords by "range" policy.')
print(f'There are {valid_passwords_by_position_policy} valid passwords by "position" policy.')
def parse_line(line):
tokens = line.split(':', 1)
policy_string = tokens[0]
password = tokens[1].strip()
return (policy_string, password)
class Policy:
def __init__(self, first_number, second_number, letter):
self._first_number = first_number
self._second_number = second_number
self._letter = letter
def is_valid_by_range_policy(self, password):
count = password.count(self._letter)
return count >= self._first_number and count <= self._second_number
def is_valid_by_position_policy(self, password):
index1 = self._first_number - 1
index2 = self._second_number - 1
return (password[index1] == self._letter) != (password[index2] == self._letter)
@classmethod
def parse(cls, string):
tokens = string.split(' ')
(first_number_string, second_number_string) = tokens[0].split('-')
letter = tokens[1]
return cls(int(first_number_string), int(second_number_string), letter)
if __name__ == '__main__':
main() |
def tree_16b(features):
if features[12] <= 0.0026689696301218646:
if features[2] <= 0.00825153129312639:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.0029812112336458085:
if features[17] <= 0.001915214421615019:
return 0
else: # if features[17] > 0.001915214421615019
return 0
else: # if features[19] > 0.0029812112336458085
if features[2] <= 0.0018615168210089905:
return 0
else: # if features[2] > 0.0018615168210089905
return 0
else: # if features[19] > 0.005966400067336508
if features[19] <= 0.00793332328953511:
if features[18] <= 0.005491076861972033:
return 1
else: # if features[18] > 0.005491076861972033
return 0
else: # if features[19] > 0.00793332328953511
if features[6] <= 0.001075940812143017:
return 1
else: # if features[6] > 0.001075940812143017
return 1
else: # if features[2] > 0.00825153129312639
if features[2] <= 0.011165123326009052:
if features[19] <= 0.0012947088146120223:
if features[9] <= 0.002559585628887362:
return 1
else: # if features[9] > 0.002559585628887362
return 0
else: # if features[19] > 0.0012947088146120223
if features[10] <= 0.0028857488325684244:
return 1
else: # if features[10] > 0.0028857488325684244
return 0
else: # if features[2] > 0.011165123326009052
if features[1] <= 0.012951065746165114:
if features[6] <= 0.009407024106167228:
return 1
else: # if features[6] > 0.009407024106167228
return 0
else: # if features[1] > 0.012951065746165114
return 1
else: # if features[12] > 0.0026689696301218646
if features[19] <= 0.017378134596128803:
if features[2] <= 0.01920186421671133:
if features[0] <= 0.0018734496211436635:
if features[10] <= 0.0055686400628474075:
return 0
else: # if features[10] > 0.0055686400628474075
return 1
else: # if features[0] > 0.0018734496211436635
if features[3] <= 0.02158046904355615:
return 0
else: # if features[3] > 0.02158046904355615
return 1
else: # if features[2] > 0.01920186421671133
if features[3] <= 0.06516701033547179:
if features[15] <= 0.00476715365380187:
return 1
else: # if features[15] > 0.00476715365380187
return 1
else: # if features[3] > 0.06516701033547179
if features[0] <= 0.034261057986668675:
return 1
else: # if features[0] > 0.034261057986668675
return 0
else: # if features[19] > 0.017378134596128803
if features[0] <= 0.0035281312398183218:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008929712100780307:
return 1
else: # if features[14] > 0.008929712100780307
return 0
else: # if features[2] > 0.0026570368299871916
if features[19] <= 0.03522761479757719:
return 1
else: # if features[19] > 0.03522761479757719
return 0
else: # if features[0] > 0.0035281312398183218
if features[8] <= 0.0518500053851767:
if features[13] <= 0.010222432115369884:
return 1
else: # if features[13] > 0.010222432115369884
return 0
else: # if features[8] > 0.0518500053851767
if features[0] <= 0.03477615719248206:
return 1
else: # if features[0] > 0.03477615719248206
return 0
##################################################
def tree_15b(features):
if features[12] <= 0.0026689696301218646:
if features[2] <= 0.008249542493103945:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.002979222433623363:
if features[17] <= 0.0019132256215925736:
return 0
else: # if features[17] > 0.0019132256215925736
return 0
else: # if features[19] > 0.002979222433623363
if features[2] <= 0.0018615168210089905:
return 0
else: # if features[2] > 0.0018615168210089905
return 0
else: # if features[19] > 0.005966400067336508
if features[19] <= 0.007935312089557556:
if features[18] <= 0.005493065661994478:
return 1
else: # if features[18] > 0.005493065661994478
return 0
else: # if features[19] > 0.007935312089557556
if features[6] <= 0.0010739520121205715:
return 1
else: # if features[6] > 0.0010739520121205715
return 1
else: # if features[2] > 0.008249542493103945
if features[2] <= 0.011165123326009052:
if features[19] <= 0.0012927200145895767:
if features[9] <= 0.0025575968288649165:
return 1
else: # if features[9] > 0.0025575968288649165
return 0
else: # if features[19] > 0.0012927200145895767
if features[10] <= 0.00288773763259087:
return 1
else: # if features[10] > 0.00288773763259087
return 0
else: # if features[2] > 0.011165123326009052
if features[1] <= 0.012951065746165114:
if features[6] <= 0.009407024106167228:
return 1
else: # if features[6] > 0.009407024106167228
return 0
else: # if features[1] > 0.012951065746165114
return 1
else: # if features[12] > 0.0026689696301218646
if features[19] <= 0.017378134596128803:
if features[2] <= 0.019199875416688883:
if features[0] <= 0.0018734496211436635:
if features[10] <= 0.0055686400628474075:
return 0
else: # if features[10] > 0.0055686400628474075
return 1
else: # if features[0] > 0.0018734496211436635
if features[3] <= 0.021582457843578595:
return 0
else: # if features[3] > 0.021582457843578595
return 1
else: # if features[2] > 0.019199875416688883
if features[3] <= 0.06516502153544934:
if features[15] <= 0.0047651648537794244:
return 1
else: # if features[15] > 0.0047651648537794244
return 1
else: # if features[3] > 0.06516502153544934
if features[0] <= 0.03426304678669112:
return 1
else: # if features[0] > 0.03426304678669112
return 0
else: # if features[19] > 0.017378134596128803
if features[0] <= 0.0035281312398183218:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008929712100780307:
return 1
else: # if features[14] > 0.008929712100780307
return 0
else: # if features[2] > 0.0026570368299871916
if features[19] <= 0.035225625997554744:
return 1
else: # if features[19] > 0.035225625997554744
return 0
else: # if features[0] > 0.0035281312398183218
if features[8] <= 0.051848016585154255:
if features[13] <= 0.010222432115369884:
return 1
else: # if features[13] > 0.010222432115369884
return 0
else: # if features[8] > 0.051848016585154255
if features[0] <= 0.03477615719248206:
return 1
else: # if features[0] > 0.03477615719248206
return 0
##################################################
def tree_14b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008249542493103945:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.002983200033668254:
if features[17] <= 0.0019172032216374646:
return 0
else: # if features[17] > 0.0019172032216374646
return 0
else: # if features[19] > 0.002983200033668254
if features[2] <= 0.0018615168210089905:
return 0
else: # if features[2] > 0.0018615168210089905
return 0
else: # if features[19] > 0.005966400067336508
if features[19] <= 0.007931334489512665:
if features[18] <= 0.005489088061949587:
return 1
else: # if features[18] > 0.005489088061949587
return 0
else: # if features[19] > 0.007931334489512665
if features[6] <= 0.0010739520121205715:
return 1
else: # if features[6] > 0.0010739520121205715
return 1
else: # if features[2] > 0.008249542493103945
if features[2] <= 0.011161145725964161:
if features[19] <= 0.0012966976146344678:
if features[9] <= 0.0025615744289098075:
return 1
else: # if features[9] > 0.0025615744289098075
return 0
else: # if features[19] > 0.0012966976146344678
if features[10] <= 0.00288773763259087:
return 1
else: # if features[10] > 0.00288773763259087
return 0
else: # if features[2] > 0.011161145725964161
if features[1] <= 0.012951065746165114:
if features[6] <= 0.009411001706212119:
return 1
else: # if features[6] > 0.009411001706212119
return 0
else: # if features[1] > 0.012951065746165114
return 1
else: # if features[12] > 0.0026729472301667556
if features[19] <= 0.01737415699608391:
if features[2] <= 0.019203853016733774:
if features[0] <= 0.0018774272211885545:
if features[10] <= 0.0055686400628474075:
return 0
else: # if features[10] > 0.0055686400628474075
return 1
else: # if features[0] > 0.0018774272211885545
if features[3] <= 0.021582457843578595:
return 0
else: # if features[3] > 0.021582457843578595
return 1
else: # if features[2] > 0.019203853016733774
if features[3] <= 0.06516104393540445:
if features[15] <= 0.0047651648537794244:
return 1
else: # if features[15] > 0.0047651648537794244
return 1
else: # if features[3] > 0.06516104393540445
if features[0] <= 0.03426304678669112:
return 1
else: # if features[0] > 0.03426304678669112
return 0
else: # if features[19] > 0.01737415699608391
if features[0] <= 0.0035321088398632128:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008925734500735416:
return 1
else: # if features[14] > 0.008925734500735416
return 0
else: # if features[2] > 0.0026570368299871916
if features[19] <= 0.035225625997554744:
return 1
else: # if features[19] > 0.035225625997554744
return 0
else: # if features[0] > 0.0035321088398632128
if features[8] <= 0.051851994185199146:
if features[13] <= 0.010222432115369884:
return 1
else: # if features[13] > 0.010222432115369884
return 0
else: # if features[8] > 0.051851994185199146
if features[0] <= 0.03477217959243717:
return 1
else: # if features[0] > 0.03477217959243717
return 0
##################################################
def tree_13b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008257497693193727:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.002975244833578472:
if features[17] <= 0.0019092480215476826:
return 0
else: # if features[17] > 0.0019092480215476826
return 0
else: # if features[19] > 0.002975244833578472
if features[2] <= 0.0018615168210089905:
return 0
else: # if features[2] > 0.0018615168210089905
return 0
else: # if features[19] > 0.005966400067336508
if features[19] <= 0.007939289689602447:
if features[18] <= 0.005489088061949587:
return 1
else: # if features[18] > 0.005489088061949587
return 0
else: # if features[19] > 0.007939289689602447
if features[6] <= 0.0010819072122103535:
return 1
else: # if features[6] > 0.0010819072122103535
return 1
else: # if features[2] > 0.008257497693193727
if features[2] <= 0.011169100926053943:
if features[19] <= 0.0012887424145446857:
if features[9] <= 0.0025615744289098075:
return 1
else: # if features[9] > 0.0025615744289098075
return 0
else: # if features[19] > 0.0012887424145446857
if features[10] <= 0.002879782432501088:
return 1
else: # if features[10] > 0.002879782432501088
return 0
else: # if features[2] > 0.011169100926053943
if features[1] <= 0.012951065746165114:
if features[6] <= 0.009403046506122337:
return 1
else: # if features[6] > 0.009403046506122337
return 0
else: # if features[1] > 0.012951065746165114
return 1
else: # if features[12] > 0.0026729472301667556
if features[19] <= 0.01737415699608391:
if features[2] <= 0.019203853016733774:
if features[0] <= 0.0018774272211885545:
if features[10] <= 0.0055686400628474075:
return 0
else: # if features[10] > 0.0055686400628474075
return 1
else: # if features[0] > 0.0018774272211885545
if features[3] <= 0.021574502643488813:
return 0
else: # if features[3] > 0.021574502643488813
return 1
else: # if features[2] > 0.019203853016733774
if features[3] <= 0.06515308873531467:
if features[15] <= 0.0047731200538692065:
return 1
else: # if features[15] > 0.0047731200538692065
return 1
else: # if features[3] > 0.06515308873531467
if features[0] <= 0.03425509158660134:
return 1
else: # if features[0] > 0.03425509158660134
return 0
else: # if features[19] > 0.01737415699608391
if features[0] <= 0.0035321088398632128:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008925734500735416:
return 1
else: # if features[14] > 0.008925734500735416
return 0
else: # if features[2] > 0.0026570368299871916
if features[19] <= 0.035225625997554744:
return 1
else: # if features[19] > 0.035225625997554744
return 0
else: # if features[0] > 0.0035321088398632128
if features[8] <= 0.051851994185199146:
if features[13] <= 0.010214476915280102:
return 1
else: # if features[13] > 0.010214476915280102
return 0
else: # if features[8] > 0.051851994185199146
if features[0] <= 0.03478013479252695:
return 1
else: # if features[0] > 0.03478013479252695
return 0
##################################################
def tree_12b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008241587293014163:
if features[19] <= 0.005950489667156944:
if features[19] <= 0.002991155233758036:
if features[17] <= 0.0019092480215476826:
return 0
else: # if features[17] > 0.0019092480215476826
return 0
else: # if features[19] > 0.002991155233758036
if features[2] <= 0.0018456064208294265:
return 0
else: # if features[2] > 0.0018456064208294265
return 0
else: # if features[19] > 0.005950489667156944
if features[19] <= 0.007923379289422883:
if features[18] <= 0.0055049984621291514:
return 1
else: # if features[18] > 0.0055049984621291514
return 0
else: # if features[19] > 0.007923379289422883
if features[6] <= 0.0010819072122103535:
return 1
else: # if features[6] > 0.0010819072122103535
return 1
else: # if features[2] > 0.008241587293014163
if features[2] <= 0.011169100926053943:
if features[19] <= 0.0013046528147242498:
if features[9] <= 0.0025456640287302434:
return 1
else: # if features[9] > 0.0025456640287302434
return 0
else: # if features[19] > 0.0013046528147242498
if features[10] <= 0.002895692832680652:
return 1
else: # if features[10] > 0.002895692832680652
return 0
else: # if features[2] > 0.011169100926053943
if features[1] <= 0.012951065746165114:
if features[6] <= 0.0094189569063019:
return 1
else: # if features[6] > 0.0094189569063019
return 0
else: # if features[1] > 0.012951065746165114
return 1
else: # if features[12] > 0.0026729472301667556
if features[19] <= 0.01737415699608391:
if features[2] <= 0.01918794261655421:
if features[0] <= 0.0018774272211885545:
if features[10] <= 0.0055686400628474075:
return 0
else: # if features[10] > 0.0055686400628474075
return 1
else: # if features[0] > 0.0018774272211885545
if features[3] <= 0.021574502643488813:
return 0
else: # if features[3] > 0.021574502643488813
return 1
else: # if features[2] > 0.01918794261655421
if features[3] <= 0.0651371783351351:
if features[15] <= 0.0047731200538692065:
return 1
else: # if features[15] > 0.0047731200538692065
return 1
else: # if features[3] > 0.0651371783351351
if features[0] <= 0.0342710019867809:
return 1
else: # if features[0] > 0.0342710019867809
return 0
else: # if features[19] > 0.01737415699608391
if features[0] <= 0.0035321088398632128:
if features[2] <= 0.0026411264298076276:
if features[14] <= 0.00894164490091498:
return 1
else: # if features[14] > 0.00894164490091498
return 0
else: # if features[2] > 0.0026411264298076276
if features[19] <= 0.035225625997554744:
return 1
else: # if features[19] > 0.035225625997554744
return 0
else: # if features[0] > 0.0035321088398632128
if features[8] <= 0.05183608378501958:
if features[13] <= 0.010214476915280102:
return 1
else: # if features[13] > 0.010214476915280102
return 0
else: # if features[8] > 0.05183608378501958
if features[0] <= 0.03478013479252695:
return 1
else: # if features[0] > 0.03478013479252695
return 0
##################################################
def tree_11b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008273408093373291:
if features[19] <= 0.005982310467516072:
if features[19] <= 0.002991155233758036:
if features[17] <= 0.0019092480215476826:
return 0
else: # if features[17] > 0.0019092480215476826
return 0
else: # if features[19] > 0.002991155233758036
if features[2] <= 0.0018456064208294265:
return 0
else: # if features[2] > 0.0018456064208294265
return 0
else: # if features[19] > 0.005982310467516072
if features[19] <= 0.00795520008978201:
if features[18] <= 0.005473177661770023:
return 1
else: # if features[18] > 0.005473177661770023
return 0
else: # if features[19] > 0.00795520008978201
if features[6] <= 0.0010819072122103535:
return 1
else: # if features[6] > 0.0010819072122103535
return 1
else: # if features[2] > 0.008273408093373291
if features[2] <= 0.011137280125694815:
if features[19] <= 0.0012728320143651217:
if features[9] <= 0.0025456640287302434:
return 1
else: # if features[9] > 0.0025456640287302434
return 0
else: # if features[19] > 0.0012728320143651217
if features[10] <= 0.002863872032321524:
return 1
else: # if features[10] > 0.002863872032321524
return 0
else: # if features[2] > 0.011137280125694815
if features[1] <= 0.012919244945805985:
if features[6] <= 0.0094189569063019:
return 1
else: # if features[6] > 0.0094189569063019
return 0
else: # if features[1] > 0.012919244945805985
return 1
else: # if features[12] > 0.0026729472301667556
if features[19] <= 0.01737415699608391:
if features[2] <= 0.019219763416913338:
if features[0] <= 0.0018456064208294265:
if features[10] <= 0.0055368192624882795:
return 0
else: # if features[10] > 0.0055368192624882795
return 1
else: # if features[0] > 0.0018456064208294265
if features[3] <= 0.021574502643488813:
return 0
else: # if features[3] > 0.021574502643488813
return 1
else: # if features[2] > 0.019219763416913338
if features[3] <= 0.06510535753477598:
if features[15] <= 0.0047731200538692065:
return 1
else: # if features[15] > 0.0047731200538692065
return 1
else: # if features[3] > 0.06510535753477598
if features[0] <= 0.034239181186421774:
return 1
else: # if features[0] > 0.034239181186421774
return 0
else: # if features[19] > 0.01737415699608391
if features[0] <= 0.0035002880395040847:
if features[2] <= 0.0026729472301667556:
if features[14] <= 0.008909824100555852:
return 1
else: # if features[14] > 0.008909824100555852
return 0
else: # if features[2] > 0.0026729472301667556
if features[19] <= 0.03525744679791387:
return 1
else: # if features[19] > 0.03525744679791387
return 0
else: # if features[0] > 0.0035002880395040847
if features[8] <= 0.05186790458537871:
if features[13] <= 0.01024629771563923:
return 1
else: # if features[13] > 0.01024629771563923
return 0
else: # if features[8] > 0.05186790458537871
if features[0] <= 0.03474831399216782:
return 1
else: # if features[0] > 0.03474831399216782
return 0
##################################################
def tree_10b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008273408093373291:
if features[19] <= 0.005982310467516072:
if features[19] <= 0.00292751363303978:
if features[17] <= 0.0019092480215476826:
return 0
else: # if features[17] > 0.0019092480215476826
return 0
else: # if features[19] > 0.00292751363303978
if features[2] <= 0.0019092480215476826:
return 0
else: # if features[2] > 0.0019092480215476826
return 0
else: # if features[19] > 0.005982310467516072
if features[19] <= 0.007891558489063755:
if features[18] <= 0.005473177661770023:
return 1
else: # if features[18] > 0.005473177661770023
return 0
else: # if features[19] > 0.007891558489063755
if features[6] <= 0.0010182656114920974:
return 1
else: # if features[6] > 0.0010182656114920974
return 1
else: # if features[2] > 0.008273408093373291
if features[2] <= 0.011200921726413071:
if features[19] <= 0.0012728320143651217:
if features[9] <= 0.0025456640287302434:
return 1
else: # if features[9] > 0.0025456640287302434
return 0
else: # if features[19] > 0.0012728320143651217
if features[10] <= 0.00292751363303978:
return 1
else: # if features[10] > 0.00292751363303978
return 0
else: # if features[2] > 0.011200921726413071
if features[1] <= 0.012982886546524242:
if features[6] <= 0.0094189569063019:
return 1
else: # if features[6] > 0.0094189569063019
return 0
else: # if features[1] > 0.012982886546524242
return 1
else: # if features[12] > 0.0026729472301667556
if features[19] <= 0.017437798596802168:
if features[2] <= 0.019219763416913338:
if features[0] <= 0.0019092480215476826:
if features[10] <= 0.005600460863206536:
return 0
else: # if features[10] > 0.005600460863206536
return 1
else: # if features[0] > 0.0019092480215476826
if features[3] <= 0.02163814424420707:
return 0
else: # if features[3] > 0.02163814424420707
return 1
else: # if features[2] > 0.019219763416913338
if features[3] <= 0.06504171593405772:
if features[15] <= 0.00470947845315095:
return 1
else: # if features[15] > 0.00470947845315095
return 1
else: # if features[3] > 0.06504171593405772
if features[0] <= 0.034239181186421774:
return 1
else: # if features[0] > 0.034239181186421774
return 0
else: # if features[19] > 0.017437798596802168
if features[0] <= 0.003563929640222341:
if features[2] <= 0.0026729472301667556:
if features[14] <= 0.008909824100555852:
return 1
else: # if features[14] > 0.008909824100555852
return 0
else: # if features[2] > 0.0026729472301667556
if features[19] <= 0.03525744679791387:
return 1
else: # if features[19] > 0.03525744679791387
return 0
else: # if features[0] > 0.003563929640222341
if features[8] <= 0.051804262984660454:
if features[13] <= 0.010182656114920974:
return 1
else: # if features[13] > 0.010182656114920974
return 0
else: # if features[8] > 0.051804262984660454
if features[0] <= 0.03474831399216782:
return 1
else: # if features[0] > 0.03474831399216782
return 0
##################################################
def tree_9b(features):
if features[12] <= 0.0025456640287302434:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.00585502726607956:
if features[19] <= 0.003054796834476292:
if features[17] <= 0.0020365312229841948:
return 0
else: # if features[17] > 0.0020365312229841948
return 0
else: # if features[19] > 0.003054796834476292
if features[2] <= 0.0017819648201111704:
return 0
else: # if features[2] > 0.0017819648201111704
return 0
else: # if features[19] > 0.00585502726607956
if features[19] <= 0.007891558489063755:
if features[18] <= 0.005600460863206536:
return 1
else: # if features[18] > 0.005600460863206536
return 0
else: # if features[19] > 0.007891558489063755
if features[6] <= 0.0010182656114920974:
return 1
else: # if features[6] > 0.0010182656114920974
return 1
else: # if features[2] > 0.008146124891936779
if features[2] <= 0.011200921726413071:
if features[19] <= 0.0012728320143651217:
if features[9] <= 0.0025456640287302434:
return 1
else: # if features[9] > 0.0025456640287302434
return 0
else: # if features[19] > 0.0012728320143651217
if features[10] <= 0.002800230431603268:
return 1
else: # if features[10] > 0.002800230431603268
return 0
else: # if features[2] > 0.011200921726413071
if features[1] <= 0.012982886546524242:
if features[6] <= 0.0094189569063019:
return 1
else: # if features[6] > 0.0094189569063019
return 0
else: # if features[1] > 0.012982886546524242
return 1
else: # if features[12] > 0.0025456640287302434
if features[19] <= 0.017310515395365655:
if features[2] <= 0.019092480215476826:
if features[0] <= 0.0017819648201111704:
if features[10] <= 0.005600460863206536:
return 0
else: # if features[10] > 0.005600460863206536
return 1
else: # if features[0] > 0.0017819648201111704
if features[3] <= 0.02163814424420707:
return 0
else: # if features[3] > 0.02163814424420707
return 1
else: # if features[2] > 0.019092480215476826
if features[3] <= 0.06491443273262121:
if features[15] <= 0.0048367616545874625:
return 1
else: # if features[15] > 0.0048367616545874625
return 1
else: # if features[3] > 0.06491443273262121
if features[0] <= 0.034366464387858286:
return 1
else: # if features[0] > 0.034366464387858286
return 0
else: # if features[19] > 0.017310515395365655
if features[0] <= 0.003563929640222341:
if features[2] <= 0.0025456640287302434:
if features[14] <= 0.008909824100555852:
return 1
else: # if features[14] > 0.008909824100555852
return 0
else: # if features[2] > 0.0025456640287302434
if features[19] <= 0.03513016359647736:
return 1
else: # if features[19] > 0.03513016359647736
return 0
else: # if features[0] > 0.003563929640222341
if features[8] <= 0.051931546186096966:
if features[13] <= 0.010182656114920974:
return 1
else: # if features[13] > 0.010182656114920974
return 0
else: # if features[8] > 0.051931546186096966
if features[0] <= 0.034875597193604335:
return 1
else: # if features[0] > 0.034875597193604335
return 0
##################################################
def tree_8b(features):
if features[12] <= 0.0025456640287302434:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.006109593668952584:
if features[19] <= 0.003054796834476292:
if features[17] <= 0.0020365312229841948:
return 0
else: # if features[17] > 0.0020365312229841948
return 0
else: # if features[19] > 0.003054796834476292
if features[2] <= 0.0020365312229841948:
return 0
else: # if features[2] > 0.0020365312229841948
return 0
else: # if features[19] > 0.006109593668952584
if features[19] <= 0.008146124891936779:
if features[18] <= 0.005600460863206536:
return 1
else: # if features[18] > 0.005600460863206536
return 0
else: # if features[19] > 0.008146124891936779
if features[6] <= 0.0010182656114920974:
return 1
else: # if features[6] > 0.0010182656114920974
return 1
else: # if features[2] > 0.008146124891936779
if features[2] <= 0.011200921726413071:
if features[19] <= 0.001527398417238146:
if features[9] <= 0.0025456640287302434:
return 1
else: # if features[9] > 0.0025456640287302434
return 0
else: # if features[19] > 0.001527398417238146
if features[10] <= 0.003054796834476292:
return 1
else: # if features[10] > 0.003054796834476292
return 0
else: # if features[2] > 0.011200921726413071
if features[1] <= 0.012728320143651217:
if features[6] <= 0.009164390503428876:
return 1
else: # if features[6] > 0.009164390503428876
return 0
else: # if features[1] > 0.012728320143651217
return 1
else: # if features[12] > 0.0025456640287302434
if features[19] <= 0.017310515395365655:
if features[2] <= 0.01934704661834985:
if features[0] <= 0.0020365312229841948:
if features[10] <= 0.005600460863206536:
return 0
else: # if features[10] > 0.005600460863206536
return 1
else: # if features[0] > 0.0020365312229841948
if features[3] <= 0.021383577841334045:
return 0
else: # if features[3] > 0.021383577841334045
return 1
else: # if features[2] > 0.01934704661834985
if features[3] <= 0.06465986632974818:
if features[15] <= 0.004582195251714438:
return 1
else: # if features[15] > 0.004582195251714438
return 1
else: # if features[3] > 0.06465986632974818
if features[0] <= 0.03411189798498526:
return 1
else: # if features[0] > 0.03411189798498526
return 0
else: # if features[19] > 0.017310515395365655
if features[0] <= 0.003563929640222341:
if features[2] <= 0.0025456640287302434:
if features[14] <= 0.009164390503428876:
return 1
else: # if features[14] > 0.009164390503428876
return 0
else: # if features[2] > 0.0025456640287302434
if features[19] <= 0.03513016359647736:
return 1
else: # if features[19] > 0.03513016359647736
return 0
else: # if features[0] > 0.003563929640222341
if features[8] <= 0.051931546186096966:
if features[13] <= 0.010182656114920974:
return 1
else: # if features[13] > 0.010182656114920974
return 0
else: # if features[8] > 0.051931546186096966
if features[0] <= 0.03462103079073131:
return 1
else: # if features[0] > 0.03462103079073131
return 0
##################################################
def tree_7b(features):
if features[12] <= 0.003054796834476292:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.006109593668952584:
if features[19] <= 0.003054796834476292:
if features[17] <= 0.0020365312229841948:
return 0
else: # if features[17] > 0.0020365312229841948
return 0
else: # if features[19] > 0.003054796834476292
if features[2] <= 0.0020365312229841948:
return 0
else: # if features[2] > 0.0020365312229841948
return 0
else: # if features[19] > 0.006109593668952584
if features[19] <= 0.008146124891936779:
if features[18] <= 0.005091328057460487:
return 1
else: # if features[18] > 0.005091328057460487
return 0
else: # if features[19] > 0.008146124891936779
if features[6] <= 0.0010182656114920974:
return 1
else: # if features[6] > 0.0010182656114920974
return 1
else: # if features[2] > 0.008146124891936779
if features[2] <= 0.011200921726413071:
if features[19] <= 0.0010182656114920974:
if features[9] <= 0.003054796834476292:
return 1
else: # if features[9] > 0.003054796834476292
return 0
else: # if features[19] > 0.0010182656114920974
if features[10] <= 0.003054796834476292:
return 1
else: # if features[10] > 0.003054796834476292
return 0
else: # if features[2] > 0.011200921726413071
if features[1] <= 0.013237452949397266:
if features[6] <= 0.009164390503428876:
return 1
else: # if features[6] > 0.009164390503428876
return 0
else: # if features[1] > 0.013237452949397266
return 1
else: # if features[12] > 0.003054796834476292
if features[19] <= 0.017310515395365655:
if features[2] <= 0.01934704661834985:
if features[0] <= 0.0020365312229841948:
if features[10] <= 0.005091328057460487:
return 0
else: # if features[10] > 0.005091328057460487
return 1
else: # if features[0] > 0.0020365312229841948
if features[3] <= 0.021383577841334045:
return 0
else: # if features[3] > 0.021383577841334045
return 1
else: # if features[2] > 0.01934704661834985
if features[3] <= 0.06415073352400213:
if features[15] <= 0.005091328057460487:
return 1
else: # if features[15] > 0.005091328057460487
return 1
else: # if features[3] > 0.06415073352400213
if features[0] <= 0.03462103079073131:
return 1
else: # if features[0] > 0.03462103079073131
return 0
else: # if features[19] > 0.017310515395365655
if features[0] <= 0.003054796834476292:
if features[2] <= 0.003054796834476292:
if features[14] <= 0.009164390503428876:
return 1
else: # if features[14] > 0.009164390503428876
return 0
else: # if features[2] > 0.003054796834476292
if features[19] <= 0.03563929640222341:
return 1
else: # if features[19] > 0.03563929640222341
return 0
else: # if features[0] > 0.003054796834476292
if features[8] <= 0.051931546186096966:
if features[13] <= 0.010182656114920974:
return 1
else: # if features[13] > 0.010182656114920974
return 0
else: # if features[8] > 0.051931546186096966
if features[0] <= 0.03462103079073131:
return 1
else: # if features[0] > 0.03462103079073131
return 0
##################################################
def tree_6b(features):
if features[12] <= 0.0020365312229841948:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.006109593668952584:
if features[19] <= 0.0020365312229841948:
if features[17] <= 0.0020365312229841948:
return 0
else: # if features[17] > 0.0020365312229841948
return 0
else: # if features[19] > 0.0020365312229841948
if features[2] <= 0.0020365312229841948:
return 0
else: # if features[2] > 0.0020365312229841948
return 0
else: # if features[19] > 0.006109593668952584
if features[19] <= 0.008146124891936779:
if features[18] <= 0.006109593668952584:
return 1
else: # if features[18] > 0.006109593668952584
return 0
else: # if features[19] > 0.008146124891936779
if features[6] <= 0.0020365312229841948:
return 1
else: # if features[6] > 0.0020365312229841948
return 1
else: # if features[2] > 0.008146124891936779
if features[2] <= 0.010182656114920974:
if features[19] <= 0.0020365312229841948:
if features[9] <= 0.0020365312229841948:
return 1
else: # if features[9] > 0.0020365312229841948
return 0
else: # if features[19] > 0.0020365312229841948
if features[10] <= 0.0020365312229841948:
return 1
else: # if features[10] > 0.0020365312229841948
return 0
else: # if features[2] > 0.010182656114920974
if features[1] <= 0.012219187337905169:
if features[6] <= 0.010182656114920974:
return 1
else: # if features[6] > 0.010182656114920974
return 0
else: # if features[1] > 0.012219187337905169
return 1
else: # if features[12] > 0.0020365312229841948
if features[19] <= 0.018328781006857753:
if features[2] <= 0.018328781006857753:
if features[0] <= 0.0020365312229841948:
if features[10] <= 0.006109593668952584:
return 0
else: # if features[10] > 0.006109593668952584
return 1
else: # if features[0] > 0.0020365312229841948
if features[3] <= 0.022401843452826142:
return 0
else: # if features[3] > 0.022401843452826142
return 1
else: # if features[2] > 0.018328781006857753
if features[3] <= 0.06313246791251004:
if features[15] <= 0.0040730624459683895:
return 1
else: # if features[15] > 0.0040730624459683895
return 1
else: # if features[3] > 0.06313246791251004
if features[0] <= 0.03462103079073131:
return 1
else: # if features[0] > 0.03462103079073131
return 0
else: # if features[19] > 0.018328781006857753
if features[0] <= 0.0040730624459683895:
if features[2] <= 0.0020365312229841948:
if features[14] <= 0.008146124891936779:
return 1
else: # if features[14] > 0.008146124891936779
return 0
else: # if features[2] > 0.0020365312229841948
if features[19] <= 0.03462103079073131:
return 1
else: # if features[19] > 0.03462103079073131
return 0
else: # if features[0] > 0.0040730624459683895
if features[8] <= 0.05091328057460487:
if features[13] <= 0.010182656114920974:
return 1
else: # if features[13] > 0.010182656114920974
return 0
else: # if features[8] > 0.05091328057460487
if features[0] <= 0.03462103079073131:
return 1
else: # if features[0] > 0.03462103079073131
return 0
##################################################
def tree_5b(features):
if features[12] <= 0.0040730624459683895:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.0040730624459683895:
if features[19] <= 0.0040730624459683895:
if features[17] <= 0.0:
return 0
else: # if features[17] > 0.0
return 0
else: # if features[19] > 0.0040730624459683895
if features[2] <= 0.0:
return 0
else: # if features[2] > 0.0
return 0
else: # if features[19] > 0.0040730624459683895
if features[19] <= 0.008146124891936779:
if features[18] <= 0.0040730624459683895:
return 1
else: # if features[18] > 0.0040730624459683895
return 0
else: # if features[19] > 0.008146124891936779
if features[6] <= 0.0:
return 1
else: # if features[6] > 0.0
return 1
else: # if features[2] > 0.008146124891936779
if features[2] <= 0.012219187337905169:
if features[19] <= 0.0:
if features[9] <= 0.0040730624459683895:
return 1
else: # if features[9] > 0.0040730624459683895
return 0
else: # if features[19] > 0.0
if features[10] <= 0.0040730624459683895:
return 1
else: # if features[10] > 0.0040730624459683895
return 0
else: # if features[2] > 0.012219187337905169
if features[1] <= 0.012219187337905169:
if features[6] <= 0.008146124891936779:
return 1
else: # if features[6] > 0.008146124891936779
return 0
else: # if features[1] > 0.012219187337905169
return 1
else: # if features[12] > 0.0040730624459683895
if features[19] <= 0.016292249783873558:
if features[2] <= 0.020365312229841948:
if features[0] <= 0.0:
if features[10] <= 0.0040730624459683895:
return 0
else: # if features[10] > 0.0040730624459683895
return 1
else: # if features[0] > 0.0
if features[3] <= 0.020365312229841948:
return 0
else: # if features[3] > 0.020365312229841948
return 1
else: # if features[2] > 0.020365312229841948
if features[3] <= 0.06109593668952584:
if features[15] <= 0.0040730624459683895:
return 1
else: # if features[15] > 0.0040730624459683895
return 1
else: # if features[3] > 0.06109593668952584
if features[0] <= 0.032584499567747116:
return 1
else: # if features[0] > 0.032584499567747116
return 0
else: # if features[19] > 0.016292249783873558
if features[0] <= 0.0040730624459683895:
if features[2] <= 0.0040730624459683895:
if features[14] <= 0.008146124891936779:
return 1
else: # if features[14] > 0.008146124891936779
return 0
else: # if features[2] > 0.0040730624459683895
if features[19] <= 0.036657562013715506:
return 1
else: # if features[19] > 0.036657562013715506
return 0
else: # if features[0] > 0.0040730624459683895
if features[8] <= 0.052949811797589064:
if features[13] <= 0.012219187337905169:
return 1
else: # if features[13] > 0.012219187337905169
return 0
else: # if features[8] > 0.052949811797589064
if features[0] <= 0.036657562013715506:
return 1
else: # if features[0] > 0.036657562013715506
return 0
##################################################
def tree_4b(features):
if features[12] <= 0.0:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.008146124891936779:
if features[19] <= 0.0:
if features[17] <= 0.0:
return 0
else: # if features[17] > 0.0
return 0
else: # if features[19] > 0.0
if features[2] <= 0.0:
return 0
else: # if features[2] > 0.0
return 0
else: # if features[19] > 0.008146124891936779
if features[19] <= 0.008146124891936779:
if features[18] <= 0.008146124891936779:
return 1
else: # if features[18] > 0.008146124891936779
return 0
else: # if features[19] > 0.008146124891936779
if features[6] <= 0.0:
return 1
else: # if features[6] > 0.0
return 1
else: # if features[2] > 0.008146124891936779
if features[2] <= 0.008146124891936779:
if features[19] <= 0.0:
if features[9] <= 0.0:
return 1
else: # if features[9] > 0.0
return 0
else: # if features[19] > 0.0
if features[10] <= 0.0:
return 1
else: # if features[10] > 0.0
return 0
else: # if features[2] > 0.008146124891936779
if features[1] <= 0.016292249783873558:
if features[6] <= 0.008146124891936779:
return 1
else: # if features[6] > 0.008146124891936779
return 0
else: # if features[1] > 0.016292249783873558
return 1
else: # if features[12] > 0.0
if features[19] <= 0.016292249783873558:
if features[2] <= 0.016292249783873558:
if features[0] <= 0.0:
if features[10] <= 0.008146124891936779:
return 0
else: # if features[10] > 0.008146124891936779
return 1
else: # if features[0] > 0.0
if features[3] <= 0.024438374675810337:
return 0
else: # if features[3] > 0.024438374675810337
return 1
else: # if features[2] > 0.016292249783873558
if features[3] <= 0.05702287424355745:
if features[15] <= 0.008146124891936779:
return 1
else: # if features[15] > 0.008146124891936779
return 1
else: # if features[3] > 0.05702287424355745
if features[0] <= 0.032584499567747116:
return 1
else: # if features[0] > 0.032584499567747116
return 0
else: # if features[19] > 0.016292249783873558
if features[0] <= 0.0:
if features[2] <= 0.0:
if features[14] <= 0.008146124891936779:
return 1
else: # if features[14] > 0.008146124891936779
return 0
else: # if features[2] > 0.0
if features[19] <= 0.032584499567747116:
return 1
else: # if features[19] > 0.032584499567747116
return 0
else: # if features[0] > 0.0
if features[8] <= 0.048876749351620674:
if features[13] <= 0.008146124891936779:
return 1
else: # if features[13] > 0.008146124891936779
return 0
else: # if features[8] > 0.048876749351620674
if features[0] <= 0.032584499567747116:
return 1
else: # if features[0] > 0.032584499567747116
return 0
##################################################
def tree_3b(features):
if features[12] <= 0.0:
if features[2] <= 0.016292249783873558:
if features[19] <= 0.0:
if features[19] <= 0.0:
if features[17] <= 0.0:
return 0
else: # if features[17] > 0.0
return 0
else: # if features[19] > 0.0
if features[2] <= 0.0:
return 0
else: # if features[2] > 0.0
return 0
else: # if features[19] > 0.0
if features[19] <= 0.0:
if features[18] <= 0.0:
return 1
else: # if features[18] > 0.0
return 0
else: # if features[19] > 0.0
if features[6] <= 0.0:
return 1
else: # if features[6] > 0.0
return 1
else: # if features[2] > 0.016292249783873558
if features[2] <= 0.016292249783873558:
if features[19] <= 0.0:
if features[9] <= 0.0:
return 1
else: # if features[9] > 0.0
return 0
else: # if features[19] > 0.0
if features[10] <= 0.0:
return 1
else: # if features[10] > 0.0
return 0
else: # if features[2] > 0.016292249783873558
if features[1] <= 0.016292249783873558:
if features[6] <= 0.016292249783873558:
return 1
else: # if features[6] > 0.016292249783873558
return 0
else: # if features[1] > 0.016292249783873558
return 1
else: # if features[12] > 0.0
if features[19] <= 0.016292249783873558:
if features[2] <= 0.016292249783873558:
if features[0] <= 0.0:
if features[10] <= 0.0:
return 0
else: # if features[10] > 0.0
return 1
else: # if features[0] > 0.0
if features[3] <= 0.016292249783873558:
return 0
else: # if features[3] > 0.016292249783873558
return 1
else: # if features[2] > 0.016292249783873558
if features[3] <= 0.048876749351620674:
if features[15] <= 0.0:
return 1
else: # if features[15] > 0.0
return 1
else: # if features[3] > 0.048876749351620674
if features[0] <= 0.032584499567747116:
return 1
else: # if features[0] > 0.032584499567747116
return 0
else: # if features[19] > 0.016292249783873558
if features[0] <= 0.0:
if features[2] <= 0.0:
if features[14] <= 0.016292249783873558:
return 1
else: # if features[14] > 0.016292249783873558
return 0
else: # if features[2] > 0.0
if features[19] <= 0.032584499567747116:
return 1
else: # if features[19] > 0.032584499567747116
return 0
else: # if features[0] > 0.0
if features[8] <= 0.048876749351620674:
if features[13] <= 0.016292249783873558:
return 1
else: # if features[13] > 0.016292249783873558
return 0
else: # if features[8] > 0.048876749351620674
if features[0] <= 0.032584499567747116:
return 1
else: # if features[0] > 0.032584499567747116
return 0
##################################################
def tree_2b(features):
if features[12] <= 0.0:
if features[2] <= 0.0:
if features[19] <= 0.0:
if features[19] <= 0.0:
if features[17] <= 0.0:
return 0
else: # if features[17] > 0.0
return 0
else: # if features[19] > 0.0
if features[2] <= 0.0:
return 0
else: # if features[2] > 0.0
return 0
else: # if features[19] > 0.0
if features[19] <= 0.0:
if features[18] <= 0.0:
return 1
else: # if features[18] > 0.0
return 0
else: # if features[19] > 0.0
if features[6] <= 0.0:
return 1
else: # if features[6] > 0.0
return 1
else: # if features[2] > 0.0
if features[2] <= 0.0:
if features[19] <= 0.0:
if features[9] <= 0.0:
return 1
else: # if features[9] > 0.0
return 0
else: # if features[19] > 0.0
if features[10] <= 0.0:
return 1
else: # if features[10] > 0.0
return 0
else: # if features[2] > 0.0
if features[1] <= 0.0:
if features[6] <= 0.0:
return 1
else: # if features[6] > 0.0
return 0
else: # if features[1] > 0.0
return 1
else: # if features[12] > 0.0
if features[19] <= 0.032584499567747116:
if features[2] <= 0.032584499567747116:
if features[0] <= 0.0:
if features[10] <= 0.0:
return 0
else: # if features[10] > 0.0
return 1
else: # if features[0] > 0.0
if features[3] <= 0.032584499567747116:
return 0
else: # if features[3] > 0.032584499567747116
return 1
else: # if features[2] > 0.032584499567747116
if features[3] <= 0.032584499567747116:
if features[15] <= 0.0:
return 1
else: # if features[15] > 0.0
return 1
else: # if features[3] > 0.032584499567747116
if features[0] <= 0.032584499567747116:
return 1
else: # if features[0] > 0.032584499567747116
return 0
else: # if features[19] > 0.032584499567747116
if features[0] <= 0.0:
if features[2] <= 0.0:
if features[14] <= 0.0:
return 1
else: # if features[14] > 0.0
return 0
else: # if features[2] > 0.0
if features[19] <= 0.032584499567747116:
return 1
else: # if features[19] > 0.032584499567747116
return 0
else: # if features[0] > 0.0
if features[8] <= 0.032584499567747116:
if features[13] <= 0.0:
return 1
else: # if features[13] > 0.0
return 0
else: # if features[8] > 0.032584499567747116
if features[0] <= 0.032584499567747116:
return 1
else: # if features[0] > 0.032584499567747116
return 0
##################################################
| def tree_16b(features):
if features[12] <= 0.0026689696301218646:
if features[2] <= 0.00825153129312639:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.0029812112336458085:
if features[17] <= 0.001915214421615019:
return 0
else:
return 0
elif features[2] <= 0.0018615168210089905:
return 0
else:
return 0
elif features[19] <= 0.00793332328953511:
if features[18] <= 0.005491076861972033:
return 1
else:
return 0
elif features[6] <= 0.001075940812143017:
return 1
else:
return 1
elif features[2] <= 0.011165123326009052:
if features[19] <= 0.0012947088146120223:
if features[9] <= 0.002559585628887362:
return 1
else:
return 0
elif features[10] <= 0.0028857488325684244:
return 1
else:
return 0
elif features[1] <= 0.012951065746165114:
if features[6] <= 0.009407024106167228:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.017378134596128803:
if features[2] <= 0.01920186421671133:
if features[0] <= 0.0018734496211436635:
if features[10] <= 0.0055686400628474075:
return 0
else:
return 1
elif features[3] <= 0.02158046904355615:
return 0
else:
return 1
elif features[3] <= 0.06516701033547179:
if features[15] <= 0.00476715365380187:
return 1
else:
return 1
elif features[0] <= 0.034261057986668675:
return 1
else:
return 0
elif features[0] <= 0.0035281312398183218:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008929712100780307:
return 1
else:
return 0
elif features[19] <= 0.03522761479757719:
return 1
else:
return 0
elif features[8] <= 0.0518500053851767:
if features[13] <= 0.010222432115369884:
return 1
else:
return 0
elif features[0] <= 0.03477615719248206:
return 1
else:
return 0
def tree_15b(features):
if features[12] <= 0.0026689696301218646:
if features[2] <= 0.008249542493103945:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.002979222433623363:
if features[17] <= 0.0019132256215925736:
return 0
else:
return 0
elif features[2] <= 0.0018615168210089905:
return 0
else:
return 0
elif features[19] <= 0.007935312089557556:
if features[18] <= 0.005493065661994478:
return 1
else:
return 0
elif features[6] <= 0.0010739520121205715:
return 1
else:
return 1
elif features[2] <= 0.011165123326009052:
if features[19] <= 0.0012927200145895767:
if features[9] <= 0.0025575968288649165:
return 1
else:
return 0
elif features[10] <= 0.00288773763259087:
return 1
else:
return 0
elif features[1] <= 0.012951065746165114:
if features[6] <= 0.009407024106167228:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.017378134596128803:
if features[2] <= 0.019199875416688883:
if features[0] <= 0.0018734496211436635:
if features[10] <= 0.0055686400628474075:
return 0
else:
return 1
elif features[3] <= 0.021582457843578595:
return 0
else:
return 1
elif features[3] <= 0.06516502153544934:
if features[15] <= 0.0047651648537794244:
return 1
else:
return 1
elif features[0] <= 0.03426304678669112:
return 1
else:
return 0
elif features[0] <= 0.0035281312398183218:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008929712100780307:
return 1
else:
return 0
elif features[19] <= 0.035225625997554744:
return 1
else:
return 0
elif features[8] <= 0.051848016585154255:
if features[13] <= 0.010222432115369884:
return 1
else:
return 0
elif features[0] <= 0.03477615719248206:
return 1
else:
return 0
def tree_14b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008249542493103945:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.002983200033668254:
if features[17] <= 0.0019172032216374646:
return 0
else:
return 0
elif features[2] <= 0.0018615168210089905:
return 0
else:
return 0
elif features[19] <= 0.007931334489512665:
if features[18] <= 0.005489088061949587:
return 1
else:
return 0
elif features[6] <= 0.0010739520121205715:
return 1
else:
return 1
elif features[2] <= 0.011161145725964161:
if features[19] <= 0.0012966976146344678:
if features[9] <= 0.0025615744289098075:
return 1
else:
return 0
elif features[10] <= 0.00288773763259087:
return 1
else:
return 0
elif features[1] <= 0.012951065746165114:
if features[6] <= 0.009411001706212119:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.01737415699608391:
if features[2] <= 0.019203853016733774:
if features[0] <= 0.0018774272211885545:
if features[10] <= 0.0055686400628474075:
return 0
else:
return 1
elif features[3] <= 0.021582457843578595:
return 0
else:
return 1
elif features[3] <= 0.06516104393540445:
if features[15] <= 0.0047651648537794244:
return 1
else:
return 1
elif features[0] <= 0.03426304678669112:
return 1
else:
return 0
elif features[0] <= 0.0035321088398632128:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008925734500735416:
return 1
else:
return 0
elif features[19] <= 0.035225625997554744:
return 1
else:
return 0
elif features[8] <= 0.051851994185199146:
if features[13] <= 0.010222432115369884:
return 1
else:
return 0
elif features[0] <= 0.03477217959243717:
return 1
else:
return 0
def tree_13b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008257497693193727:
if features[19] <= 0.005966400067336508:
if features[19] <= 0.002975244833578472:
if features[17] <= 0.0019092480215476826:
return 0
else:
return 0
elif features[2] <= 0.0018615168210089905:
return 0
else:
return 0
elif features[19] <= 0.007939289689602447:
if features[18] <= 0.005489088061949587:
return 1
else:
return 0
elif features[6] <= 0.0010819072122103535:
return 1
else:
return 1
elif features[2] <= 0.011169100926053943:
if features[19] <= 0.0012887424145446857:
if features[9] <= 0.0025615744289098075:
return 1
else:
return 0
elif features[10] <= 0.002879782432501088:
return 1
else:
return 0
elif features[1] <= 0.012951065746165114:
if features[6] <= 0.009403046506122337:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.01737415699608391:
if features[2] <= 0.019203853016733774:
if features[0] <= 0.0018774272211885545:
if features[10] <= 0.0055686400628474075:
return 0
else:
return 1
elif features[3] <= 0.021574502643488813:
return 0
else:
return 1
elif features[3] <= 0.06515308873531467:
if features[15] <= 0.0047731200538692065:
return 1
else:
return 1
elif features[0] <= 0.03425509158660134:
return 1
else:
return 0
elif features[0] <= 0.0035321088398632128:
if features[2] <= 0.0026570368299871916:
if features[14] <= 0.008925734500735416:
return 1
else:
return 0
elif features[19] <= 0.035225625997554744:
return 1
else:
return 0
elif features[8] <= 0.051851994185199146:
if features[13] <= 0.010214476915280102:
return 1
else:
return 0
elif features[0] <= 0.03478013479252695:
return 1
else:
return 0
def tree_12b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008241587293014163:
if features[19] <= 0.005950489667156944:
if features[19] <= 0.002991155233758036:
if features[17] <= 0.0019092480215476826:
return 0
else:
return 0
elif features[2] <= 0.0018456064208294265:
return 0
else:
return 0
elif features[19] <= 0.007923379289422883:
if features[18] <= 0.0055049984621291514:
return 1
else:
return 0
elif features[6] <= 0.0010819072122103535:
return 1
else:
return 1
elif features[2] <= 0.011169100926053943:
if features[19] <= 0.0013046528147242498:
if features[9] <= 0.0025456640287302434:
return 1
else:
return 0
elif features[10] <= 0.002895692832680652:
return 1
else:
return 0
elif features[1] <= 0.012951065746165114:
if features[6] <= 0.0094189569063019:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.01737415699608391:
if features[2] <= 0.01918794261655421:
if features[0] <= 0.0018774272211885545:
if features[10] <= 0.0055686400628474075:
return 0
else:
return 1
elif features[3] <= 0.021574502643488813:
return 0
else:
return 1
elif features[3] <= 0.0651371783351351:
if features[15] <= 0.0047731200538692065:
return 1
else:
return 1
elif features[0] <= 0.0342710019867809:
return 1
else:
return 0
elif features[0] <= 0.0035321088398632128:
if features[2] <= 0.0026411264298076276:
if features[14] <= 0.00894164490091498:
return 1
else:
return 0
elif features[19] <= 0.035225625997554744:
return 1
else:
return 0
elif features[8] <= 0.05183608378501958:
if features[13] <= 0.010214476915280102:
return 1
else:
return 0
elif features[0] <= 0.03478013479252695:
return 1
else:
return 0
def tree_11b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008273408093373291:
if features[19] <= 0.005982310467516072:
if features[19] <= 0.002991155233758036:
if features[17] <= 0.0019092480215476826:
return 0
else:
return 0
elif features[2] <= 0.0018456064208294265:
return 0
else:
return 0
elif features[19] <= 0.00795520008978201:
if features[18] <= 0.005473177661770023:
return 1
else:
return 0
elif features[6] <= 0.0010819072122103535:
return 1
else:
return 1
elif features[2] <= 0.011137280125694815:
if features[19] <= 0.0012728320143651217:
if features[9] <= 0.0025456640287302434:
return 1
else:
return 0
elif features[10] <= 0.002863872032321524:
return 1
else:
return 0
elif features[1] <= 0.012919244945805985:
if features[6] <= 0.0094189569063019:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.01737415699608391:
if features[2] <= 0.019219763416913338:
if features[0] <= 0.0018456064208294265:
if features[10] <= 0.0055368192624882795:
return 0
else:
return 1
elif features[3] <= 0.021574502643488813:
return 0
else:
return 1
elif features[3] <= 0.06510535753477598:
if features[15] <= 0.0047731200538692065:
return 1
else:
return 1
elif features[0] <= 0.034239181186421774:
return 1
else:
return 0
elif features[0] <= 0.0035002880395040847:
if features[2] <= 0.0026729472301667556:
if features[14] <= 0.008909824100555852:
return 1
else:
return 0
elif features[19] <= 0.03525744679791387:
return 1
else:
return 0
elif features[8] <= 0.05186790458537871:
if features[13] <= 0.01024629771563923:
return 1
else:
return 0
elif features[0] <= 0.03474831399216782:
return 1
else:
return 0
def tree_10b(features):
if features[12] <= 0.0026729472301667556:
if features[2] <= 0.008273408093373291:
if features[19] <= 0.005982310467516072:
if features[19] <= 0.00292751363303978:
if features[17] <= 0.0019092480215476826:
return 0
else:
return 0
elif features[2] <= 0.0019092480215476826:
return 0
else:
return 0
elif features[19] <= 0.007891558489063755:
if features[18] <= 0.005473177661770023:
return 1
else:
return 0
elif features[6] <= 0.0010182656114920974:
return 1
else:
return 1
elif features[2] <= 0.011200921726413071:
if features[19] <= 0.0012728320143651217:
if features[9] <= 0.0025456640287302434:
return 1
else:
return 0
elif features[10] <= 0.00292751363303978:
return 1
else:
return 0
elif features[1] <= 0.012982886546524242:
if features[6] <= 0.0094189569063019:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.017437798596802168:
if features[2] <= 0.019219763416913338:
if features[0] <= 0.0019092480215476826:
if features[10] <= 0.005600460863206536:
return 0
else:
return 1
elif features[3] <= 0.02163814424420707:
return 0
else:
return 1
elif features[3] <= 0.06504171593405772:
if features[15] <= 0.00470947845315095:
return 1
else:
return 1
elif features[0] <= 0.034239181186421774:
return 1
else:
return 0
elif features[0] <= 0.003563929640222341:
if features[2] <= 0.0026729472301667556:
if features[14] <= 0.008909824100555852:
return 1
else:
return 0
elif features[19] <= 0.03525744679791387:
return 1
else:
return 0
elif features[8] <= 0.051804262984660454:
if features[13] <= 0.010182656114920974:
return 1
else:
return 0
elif features[0] <= 0.03474831399216782:
return 1
else:
return 0
def tree_9b(features):
if features[12] <= 0.0025456640287302434:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.00585502726607956:
if features[19] <= 0.003054796834476292:
if features[17] <= 0.0020365312229841948:
return 0
else:
return 0
elif features[2] <= 0.0017819648201111704:
return 0
else:
return 0
elif features[19] <= 0.007891558489063755:
if features[18] <= 0.005600460863206536:
return 1
else:
return 0
elif features[6] <= 0.0010182656114920974:
return 1
else:
return 1
elif features[2] <= 0.011200921726413071:
if features[19] <= 0.0012728320143651217:
if features[9] <= 0.0025456640287302434:
return 1
else:
return 0
elif features[10] <= 0.002800230431603268:
return 1
else:
return 0
elif features[1] <= 0.012982886546524242:
if features[6] <= 0.0094189569063019:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.017310515395365655:
if features[2] <= 0.019092480215476826:
if features[0] <= 0.0017819648201111704:
if features[10] <= 0.005600460863206536:
return 0
else:
return 1
elif features[3] <= 0.02163814424420707:
return 0
else:
return 1
elif features[3] <= 0.06491443273262121:
if features[15] <= 0.0048367616545874625:
return 1
else:
return 1
elif features[0] <= 0.034366464387858286:
return 1
else:
return 0
elif features[0] <= 0.003563929640222341:
if features[2] <= 0.0025456640287302434:
if features[14] <= 0.008909824100555852:
return 1
else:
return 0
elif features[19] <= 0.03513016359647736:
return 1
else:
return 0
elif features[8] <= 0.051931546186096966:
if features[13] <= 0.010182656114920974:
return 1
else:
return 0
elif features[0] <= 0.034875597193604335:
return 1
else:
return 0
def tree_8b(features):
if features[12] <= 0.0025456640287302434:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.006109593668952584:
if features[19] <= 0.003054796834476292:
if features[17] <= 0.0020365312229841948:
return 0
else:
return 0
elif features[2] <= 0.0020365312229841948:
return 0
else:
return 0
elif features[19] <= 0.008146124891936779:
if features[18] <= 0.005600460863206536:
return 1
else:
return 0
elif features[6] <= 0.0010182656114920974:
return 1
else:
return 1
elif features[2] <= 0.011200921726413071:
if features[19] <= 0.001527398417238146:
if features[9] <= 0.0025456640287302434:
return 1
else:
return 0
elif features[10] <= 0.003054796834476292:
return 1
else:
return 0
elif features[1] <= 0.012728320143651217:
if features[6] <= 0.009164390503428876:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.017310515395365655:
if features[2] <= 0.01934704661834985:
if features[0] <= 0.0020365312229841948:
if features[10] <= 0.005600460863206536:
return 0
else:
return 1
elif features[3] <= 0.021383577841334045:
return 0
else:
return 1
elif features[3] <= 0.06465986632974818:
if features[15] <= 0.004582195251714438:
return 1
else:
return 1
elif features[0] <= 0.03411189798498526:
return 1
else:
return 0
elif features[0] <= 0.003563929640222341:
if features[2] <= 0.0025456640287302434:
if features[14] <= 0.009164390503428876:
return 1
else:
return 0
elif features[19] <= 0.03513016359647736:
return 1
else:
return 0
elif features[8] <= 0.051931546186096966:
if features[13] <= 0.010182656114920974:
return 1
else:
return 0
elif features[0] <= 0.03462103079073131:
return 1
else:
return 0
def tree_7b(features):
if features[12] <= 0.003054796834476292:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.006109593668952584:
if features[19] <= 0.003054796834476292:
if features[17] <= 0.0020365312229841948:
return 0
else:
return 0
elif features[2] <= 0.0020365312229841948:
return 0
else:
return 0
elif features[19] <= 0.008146124891936779:
if features[18] <= 0.005091328057460487:
return 1
else:
return 0
elif features[6] <= 0.0010182656114920974:
return 1
else:
return 1
elif features[2] <= 0.011200921726413071:
if features[19] <= 0.0010182656114920974:
if features[9] <= 0.003054796834476292:
return 1
else:
return 0
elif features[10] <= 0.003054796834476292:
return 1
else:
return 0
elif features[1] <= 0.013237452949397266:
if features[6] <= 0.009164390503428876:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.017310515395365655:
if features[2] <= 0.01934704661834985:
if features[0] <= 0.0020365312229841948:
if features[10] <= 0.005091328057460487:
return 0
else:
return 1
elif features[3] <= 0.021383577841334045:
return 0
else:
return 1
elif features[3] <= 0.06415073352400213:
if features[15] <= 0.005091328057460487:
return 1
else:
return 1
elif features[0] <= 0.03462103079073131:
return 1
else:
return 0
elif features[0] <= 0.003054796834476292:
if features[2] <= 0.003054796834476292:
if features[14] <= 0.009164390503428876:
return 1
else:
return 0
elif features[19] <= 0.03563929640222341:
return 1
else:
return 0
elif features[8] <= 0.051931546186096966:
if features[13] <= 0.010182656114920974:
return 1
else:
return 0
elif features[0] <= 0.03462103079073131:
return 1
else:
return 0
def tree_6b(features):
if features[12] <= 0.0020365312229841948:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.006109593668952584:
if features[19] <= 0.0020365312229841948:
if features[17] <= 0.0020365312229841948:
return 0
else:
return 0
elif features[2] <= 0.0020365312229841948:
return 0
else:
return 0
elif features[19] <= 0.008146124891936779:
if features[18] <= 0.006109593668952584:
return 1
else:
return 0
elif features[6] <= 0.0020365312229841948:
return 1
else:
return 1
elif features[2] <= 0.010182656114920974:
if features[19] <= 0.0020365312229841948:
if features[9] <= 0.0020365312229841948:
return 1
else:
return 0
elif features[10] <= 0.0020365312229841948:
return 1
else:
return 0
elif features[1] <= 0.012219187337905169:
if features[6] <= 0.010182656114920974:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.018328781006857753:
if features[2] <= 0.018328781006857753:
if features[0] <= 0.0020365312229841948:
if features[10] <= 0.006109593668952584:
return 0
else:
return 1
elif features[3] <= 0.022401843452826142:
return 0
else:
return 1
elif features[3] <= 0.06313246791251004:
if features[15] <= 0.0040730624459683895:
return 1
else:
return 1
elif features[0] <= 0.03462103079073131:
return 1
else:
return 0
elif features[0] <= 0.0040730624459683895:
if features[2] <= 0.0020365312229841948:
if features[14] <= 0.008146124891936779:
return 1
else:
return 0
elif features[19] <= 0.03462103079073131:
return 1
else:
return 0
elif features[8] <= 0.05091328057460487:
if features[13] <= 0.010182656114920974:
return 1
else:
return 0
elif features[0] <= 0.03462103079073131:
return 1
else:
return 0
def tree_5b(features):
if features[12] <= 0.0040730624459683895:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.0040730624459683895:
if features[19] <= 0.0040730624459683895:
if features[17] <= 0.0:
return 0
else:
return 0
elif features[2] <= 0.0:
return 0
else:
return 0
elif features[19] <= 0.008146124891936779:
if features[18] <= 0.0040730624459683895:
return 1
else:
return 0
elif features[6] <= 0.0:
return 1
else:
return 1
elif features[2] <= 0.012219187337905169:
if features[19] <= 0.0:
if features[9] <= 0.0040730624459683895:
return 1
else:
return 0
elif features[10] <= 0.0040730624459683895:
return 1
else:
return 0
elif features[1] <= 0.012219187337905169:
if features[6] <= 0.008146124891936779:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.016292249783873558:
if features[2] <= 0.020365312229841948:
if features[0] <= 0.0:
if features[10] <= 0.0040730624459683895:
return 0
else:
return 1
elif features[3] <= 0.020365312229841948:
return 0
else:
return 1
elif features[3] <= 0.06109593668952584:
if features[15] <= 0.0040730624459683895:
return 1
else:
return 1
elif features[0] <= 0.032584499567747116:
return 1
else:
return 0
elif features[0] <= 0.0040730624459683895:
if features[2] <= 0.0040730624459683895:
if features[14] <= 0.008146124891936779:
return 1
else:
return 0
elif features[19] <= 0.036657562013715506:
return 1
else:
return 0
elif features[8] <= 0.052949811797589064:
if features[13] <= 0.012219187337905169:
return 1
else:
return 0
elif features[0] <= 0.036657562013715506:
return 1
else:
return 0
def tree_4b(features):
if features[12] <= 0.0:
if features[2] <= 0.008146124891936779:
if features[19] <= 0.008146124891936779:
if features[19] <= 0.0:
if features[17] <= 0.0:
return 0
else:
return 0
elif features[2] <= 0.0:
return 0
else:
return 0
elif features[19] <= 0.008146124891936779:
if features[18] <= 0.008146124891936779:
return 1
else:
return 0
elif features[6] <= 0.0:
return 1
else:
return 1
elif features[2] <= 0.008146124891936779:
if features[19] <= 0.0:
if features[9] <= 0.0:
return 1
else:
return 0
elif features[10] <= 0.0:
return 1
else:
return 0
elif features[1] <= 0.016292249783873558:
if features[6] <= 0.008146124891936779:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.016292249783873558:
if features[2] <= 0.016292249783873558:
if features[0] <= 0.0:
if features[10] <= 0.008146124891936779:
return 0
else:
return 1
elif features[3] <= 0.024438374675810337:
return 0
else:
return 1
elif features[3] <= 0.05702287424355745:
if features[15] <= 0.008146124891936779:
return 1
else:
return 1
elif features[0] <= 0.032584499567747116:
return 1
else:
return 0
elif features[0] <= 0.0:
if features[2] <= 0.0:
if features[14] <= 0.008146124891936779:
return 1
else:
return 0
elif features[19] <= 0.032584499567747116:
return 1
else:
return 0
elif features[8] <= 0.048876749351620674:
if features[13] <= 0.008146124891936779:
return 1
else:
return 0
elif features[0] <= 0.032584499567747116:
return 1
else:
return 0
def tree_3b(features):
if features[12] <= 0.0:
if features[2] <= 0.016292249783873558:
if features[19] <= 0.0:
if features[19] <= 0.0:
if features[17] <= 0.0:
return 0
else:
return 0
elif features[2] <= 0.0:
return 0
else:
return 0
elif features[19] <= 0.0:
if features[18] <= 0.0:
return 1
else:
return 0
elif features[6] <= 0.0:
return 1
else:
return 1
elif features[2] <= 0.016292249783873558:
if features[19] <= 0.0:
if features[9] <= 0.0:
return 1
else:
return 0
elif features[10] <= 0.0:
return 1
else:
return 0
elif features[1] <= 0.016292249783873558:
if features[6] <= 0.016292249783873558:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.016292249783873558:
if features[2] <= 0.016292249783873558:
if features[0] <= 0.0:
if features[10] <= 0.0:
return 0
else:
return 1
elif features[3] <= 0.016292249783873558:
return 0
else:
return 1
elif features[3] <= 0.048876749351620674:
if features[15] <= 0.0:
return 1
else:
return 1
elif features[0] <= 0.032584499567747116:
return 1
else:
return 0
elif features[0] <= 0.0:
if features[2] <= 0.0:
if features[14] <= 0.016292249783873558:
return 1
else:
return 0
elif features[19] <= 0.032584499567747116:
return 1
else:
return 0
elif features[8] <= 0.048876749351620674:
if features[13] <= 0.016292249783873558:
return 1
else:
return 0
elif features[0] <= 0.032584499567747116:
return 1
else:
return 0
def tree_2b(features):
if features[12] <= 0.0:
if features[2] <= 0.0:
if features[19] <= 0.0:
if features[19] <= 0.0:
if features[17] <= 0.0:
return 0
else:
return 0
elif features[2] <= 0.0:
return 0
else:
return 0
elif features[19] <= 0.0:
if features[18] <= 0.0:
return 1
else:
return 0
elif features[6] <= 0.0:
return 1
else:
return 1
elif features[2] <= 0.0:
if features[19] <= 0.0:
if features[9] <= 0.0:
return 1
else:
return 0
elif features[10] <= 0.0:
return 1
else:
return 0
elif features[1] <= 0.0:
if features[6] <= 0.0:
return 1
else:
return 0
else:
return 1
elif features[19] <= 0.032584499567747116:
if features[2] <= 0.032584499567747116:
if features[0] <= 0.0:
if features[10] <= 0.0:
return 0
else:
return 1
elif features[3] <= 0.032584499567747116:
return 0
else:
return 1
elif features[3] <= 0.032584499567747116:
if features[15] <= 0.0:
return 1
else:
return 1
elif features[0] <= 0.032584499567747116:
return 1
else:
return 0
elif features[0] <= 0.0:
if features[2] <= 0.0:
if features[14] <= 0.0:
return 1
else:
return 0
elif features[19] <= 0.032584499567747116:
return 1
else:
return 0
elif features[8] <= 0.032584499567747116:
if features[13] <= 0.0:
return 1
else:
return 0
elif features[0] <= 0.032584499567747116:
return 1
else:
return 0 |
class Employee:
def __init__(self, name, emp_id, email_id):
self.__name=name
self.__emp_id=emp_id
self.__email_id=email_id
def get_name(self):
return self.__name
def get_emp_id(self):
return self.__emp_id
def get_email_id(self):
return self.__email_id
class OrganizationDirectory:
def __init__(self,emp_list):
self.__emp_list=emp_list
def lookup(self,key_name):
result_list=[]
for emp in self.__emp_list:
if(key_name in emp.get_name()):
result_list.append(emp)
self.display(result_list)
return result_list
def display(self,result_list):
print("Search results:")
for emp in result_list:
print(emp.get_name()," ", emp.get_emp_id()," ",emp.get_email_id())
emp1=Employee("Kevin",24089, "[email protected]")
emp2=Employee("Jack",56789,"[email protected]")
emp3=Employee("Jackson",67895,"[email protected]")
emp4=Employee("Henry Jack",23456,"[email protected]")
emp_list=[emp1,emp2,emp3,emp4]
org_dir=OrganizationDirectory(emp_list)
#Search for an employee
org_dir.lookup("KEVIN") | class Employee:
def __init__(self, name, emp_id, email_id):
self.__name = name
self.__emp_id = emp_id
self.__email_id = email_id
def get_name(self):
return self.__name
def get_emp_id(self):
return self.__emp_id
def get_email_id(self):
return self.__email_id
class Organizationdirectory:
def __init__(self, emp_list):
self.__emp_list = emp_list
def lookup(self, key_name):
result_list = []
for emp in self.__emp_list:
if key_name in emp.get_name():
result_list.append(emp)
self.display(result_list)
return result_list
def display(self, result_list):
print('Search results:')
for emp in result_list:
print(emp.get_name(), ' ', emp.get_emp_id(), ' ', emp.get_email_id())
emp1 = employee('Kevin', 24089, '[email protected]')
emp2 = employee('Jack', 56789, '[email protected]')
emp3 = employee('Jackson', 67895, '[email protected]')
emp4 = employee('Henry Jack', 23456, '[email protected]')
emp_list = [emp1, emp2, emp3, emp4]
org_dir = organization_directory(emp_list)
org_dir.lookup('KEVIN') |
class tablecloumninfo:
col_name=""
data_type=""
comment=""
def __init__(self,col_name,data_type,comment):
self.col_name=col_name
self.data_type=data_type
self.comment=comment
| class Tablecloumninfo:
col_name = ''
data_type = ''
comment = ''
def __init__(self, col_name, data_type, comment):
self.col_name = col_name
self.data_type = data_type
self.comment = comment |
# See also examples/example_track/track_meta.py for a longer, commented example
track = dict(
author_username='dansbecker',
course_name='Machine Learning',
course_url='https://www.kaggle.com/learn/intro-to-machine-learning'
)
lessons = [
dict(
topic='Your First BiqQuery ML Model',
),
]
notebooks = [
dict(
filename='tut1.ipynb',
lesson_idx=0,
type='tutorial',
scriptid=4076893,
),
dict(
filename='ex1.ipynb',
lesson_idx=0,
type='exercise',
scriptid=4077160,
),
]
| track = dict(author_username='dansbecker', course_name='Machine Learning', course_url='https://www.kaggle.com/learn/intro-to-machine-learning')
lessons = [dict(topic='Your First BiqQuery ML Model')]
notebooks = [dict(filename='tut1.ipynb', lesson_idx=0, type='tutorial', scriptid=4076893), dict(filename='ex1.ipynb', lesson_idx=0, type='exercise', scriptid=4077160)] |
class Solution:
def canThreePartsEqualSum(self, A: List[int]) -> bool:
# Since all the three parts are equal, if we sum all element of arrary it should be a multiplication of 3
# so the sum of each part must be equal to sum of all element divided by 3
quotient, remainder = divmod(sum(A), 3)
if remainder != 0:
return False
subarray = 0
partitions = 0
for num in A:
subarray += num
if subarray == quotient:
partitions += 1
subarray = 0
# Check if it consist at least 3 partitions
return partitions >= 3 | class Solution:
def can_three_parts_equal_sum(self, A: List[int]) -> bool:
(quotient, remainder) = divmod(sum(A), 3)
if remainder != 0:
return False
subarray = 0
partitions = 0
for num in A:
subarray += num
if subarray == quotient:
partitions += 1
subarray = 0
return partitions >= 3 |
STATE_CITY = "fluids_state_city"
OBS_QLIDAR = "fluids_obs_qlidar"
OBS_GRID = "fluids_obs_grid"
OBS_BIRDSEYE = "fluids_obs_birdseye"
OBS_NONE = "fluids_obs_none"
BACKGROUND_CSP = "fluids_background_csp"
BACKGROUND_NULL = "fluids_background_null"
REWARD_PATH = "fluids_reward_path"
REWARD_NONE = "fluids_reward_none"
RIGHT = "RIGHT"
LEFT = "LEFT"
STRAIGHT = "STRAIGHT"
RED = (0xf6, 0x11, 0x46)
YELLOW = (0xfc, 0xef, 0x5e),
GREEN = (0, 0xc6, 0x44)
| state_city = 'fluids_state_city'
obs_qlidar = 'fluids_obs_qlidar'
obs_grid = 'fluids_obs_grid'
obs_birdseye = 'fluids_obs_birdseye'
obs_none = 'fluids_obs_none'
background_csp = 'fluids_background_csp'
background_null = 'fluids_background_null'
reward_path = 'fluids_reward_path'
reward_none = 'fluids_reward_none'
right = 'RIGHT'
left = 'LEFT'
straight = 'STRAIGHT'
red = (246, 17, 70)
yellow = ((252, 239, 94),)
green = (0, 198, 68) |
class Solution:
def generate(self, num_rows):
if num_rows == 0:
return []
ans = [1]
result = [ans]
for _ in range(num_rows - 1):
ans = [1] + [ans[i] + ans[i + 1] for i in range(len(ans[:-1]))] + [1]
result.append(ans)
return result
| class Solution:
def generate(self, num_rows):
if num_rows == 0:
return []
ans = [1]
result = [ans]
for _ in range(num_rows - 1):
ans = [1] + [ans[i] + ans[i + 1] for i in range(len(ans[:-1]))] + [1]
result.append(ans)
return result |
for testcase in range(int(input())):
n = int(input())
dict = {}
comb = 1
m = (10**9)+7
for x in input().split():
no = int(x)
try:
dict[no] = dict[no] + 1
except:
dict[no] = 1
dict = list(dict.items())
dict.sort(key=lambda x: x[0], reverse=True)
dict = [x[1] for x in dict]
for ind in range(len(dict)):
if dict[ind]==0:
continue
if (dict[ind]%2==0):
for j in range(dict[ind]-1,2,-2):
comb = (comb*j) % m
else:
for j in range(dict[ind],2,-2):
comb = (comb*j) % m
comb = (comb*dict[ind+1]) % m
dict[ind+1] -= 1
print(comb)
| for testcase in range(int(input())):
n = int(input())
dict = {}
comb = 1
m = 10 ** 9 + 7
for x in input().split():
no = int(x)
try:
dict[no] = dict[no] + 1
except:
dict[no] = 1
dict = list(dict.items())
dict.sort(key=lambda x: x[0], reverse=True)
dict = [x[1] for x in dict]
for ind in range(len(dict)):
if dict[ind] == 0:
continue
if dict[ind] % 2 == 0:
for j in range(dict[ind] - 1, 2, -2):
comb = comb * j % m
else:
for j in range(dict[ind], 2, -2):
comb = comb * j % m
comb = comb * dict[ind + 1] % m
dict[ind + 1] -= 1
print(comb) |
Subsets and Splits
No saved queries yet
Save your SQL queries to embed, download, and access them later. Queries will appear here once saved.