Spaces:
Sleeping
Sleeping
File size: 2,779 Bytes
bebad14 8b16c9c bebad14 dffaf30 bebad14 28cb117 809b460 bebad14 fd32c9f 8b16c9c bebad14 8b16c9c bebad14 f624b87 bebad14 fd32c9f 1891093 fd32c9f 809b460 1891093 fd32c9f f354223 bebad14 28cb117 bebad14 44470f9 28cb117 fd32c9f 28cb117 7e327ca 28cb117 6242bac 28cb117 4853a01 54bb0ac 6242bac 54bb0ac 4853a01 6242bac 4853a01 54bb0ac 6242bac 54bb0ac 6242bac 54bb0ac 6242bac 54bb0ac 28cb117 8b16c9c 28cb117 8b16c9c bebad14 8b16c9c dffaf30 bebad14 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 |
import time
import json
import gradio as gr
from gradio_molecule3d import Molecule3D
def predict (input_seq_1, input_msa_1, input_protein_1, input_seq_2,input_msa_2, input_protein_2):
start_time = time.time()
# Do inference here
# return an output pdb file with the protein and two chains A and B.
# also return a JSON with any metrics you want to report
metrics = {"mean_plddt": 80, "binding_affinity": 2}
end_time = time.time()
run_time = end_time - start_time
return "test_out.pdb",json.dumps(metrics), run_time
with gr.Blocks() as app:
gr.Markdown("# Template for inference")
gr.Markdown("Title, description, and other information about the model")
with gr.Row():
with gr.Column():
input_seq_1 = gr.Textbox(lines=3, label="Input Protein 1 sequence (FASTA)")
input_msa_1 = gr.File(label="Input MSA Protein 1 (A3M)")
input_protein_1 = gr.File(label="Input Protein 2 monomer (PDB)")
with gr.Column():
input_seq_2 = gr.Textbox(lines=3, label="Input Protein 2 sequence (FASTA)")
input_msa_2 = gr.File(label="Input MSA Protein 2 (A3M)")
input_protein_2 = gr.File(label="Input Protein 2 structure (PDB)")
# define any options here
# for automated inference the default options are used
# slider_option = gr.Slider(0,10, label="Slider Option")
# checkbox_option = gr.Checkbox(label="Checkbox Option")
# dropdown_option = gr.Dropdown(["Option 1", "Option 2", "Option 3"], label="Radio Option")
btn = gr.Button("Run Inference")
gr.Examples(
[
[
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
"3v1c_A.pdb",
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
"3v1c_B.pdb",
],
],
[input_seq_1, input_protein_1, input_seq_2, input_protein_2],
)
reps = [
{
"model": 0,
"style": "cartoon",
"chain": "A",
"color": "whiteCarbon",
},
{
"model": 0,
"style": "cartoon",
"chain": "B",
"color": "greenCarbon",
},
{
"model": 0,
"chain": "A",
"style": "stick",
"sidechain": True,
"color": "whiteCarbon",
},
{
"model": 0,
"chain": "B",
"style": "stick",
"sidechain": True,
"color": "greenCarbon"
}
]
# outputs
out = Molecule3D(reps=reps)
metrics = gr.JSON(label="Metrics")
run_time = gr.Textbox(label="Runtime")
btn.click(predict, inputs=[input_seq_1, input_msa_1, input_protein_1, input_seq_2, input_msa_2, input_protein_2], outputs=[out, metrics, run_time])
app.launch()
|