iitm_bisect_pinder_submission / inference_app.py
Sukanyaaa's picture
fix inference_app.py
0e58a55
raw
history blame
37.2 kB
from __future__ import annotations
import time
import json
import gradio as gr
from gradio_molecule3d import Molecule3D
import torch
from pinder.core import get_pinder_location
get_pinder_location()
from pytorch_lightning import LightningModule
import torch
import lightning.pytorch as pl
import torch.nn.functional as F
import torch.nn as nn
import torchmetrics
import torch.nn as nn
import torch.nn.functional as F
from torch_geometric.nn import MessagePassing
from torch_geometric.nn import global_mean_pool
from torch.nn import Sequential, Linear, BatchNorm1d, ReLU
from torch_scatter import scatter
from torch.nn import Module
import pinder.core as pinder
pinder.__version__
from torch_geometric.loader import DataLoader
from pinder.core.loader.dataset import get_geo_loader
from pinder.core import download_dataset
from pinder.core import get_index
from pinder.core import get_metadata
from pathlib import Path
import pandas as pd
from pinder.core import PinderSystem
import torch
from pinder.core.loader.dataset import PPIDataset
from pinder.core.loader.geodata import NodeRepresentation
import pickle
from pinder.core import get_index, PinderSystem
from torch_geometric.data import HeteroData
import os
from enum import Enum
import numpy as np
import torch
import lightning.pytorch as pl
from numpy.typing import NDArray
from torch_geometric.data import HeteroData
from pinder.core.index.system import PinderSystem
from pinder.core.loader.structure import Structure
from pinder.core.utils import constants as pc
from pinder.core.utils.log import setup_logger
from pinder.core.index.system import _align_monomers_with_mask
from pinder.core.loader.structure import Structure
import torch
import torch.nn as nn
import torch.nn.functional as F
from torch_geometric.nn import MessagePassing
from torch_geometric.nn import global_mean_pool
from torch.nn import Sequential, Linear, BatchNorm1d, ReLU
from torch_scatter import scatter
from torch.nn import Module
import time
from torch_geometric.nn import global_max_pool
import copy
import inspect
import warnings
from typing import Optional, Tuple, Union
import torch
from torch import Tensor
from torch_geometric.data import Data, Dataset, HeteroData
from torch_geometric.data.feature_store import FeatureStore
from torch_geometric.data.graph_store import GraphStore
from torch_geometric.loader import (
LinkLoader,
LinkNeighborLoader,
NeighborLoader,
NodeLoader,
)
from torch_geometric.loader.dataloader import DataLoader
from torch_geometric.loader.utils import get_edge_label_index, get_input_nodes
from torch_geometric.sampler import BaseSampler, NeighborSampler
from torch_geometric.typing import InputEdges, InputNodes
try:
from lightning.pytorch import LightningDataModule as PLLightningDataModule
no_pytorch_lightning = False
except (ImportError, ModuleNotFoundError):
PLLightningDataModule = object
no_pytorch_lightning = True
from lightning.pytorch.callbacks import ModelCheckpoint
from lightning.pytorch.loggers.tensorboard import TensorBoardLogger
from lightning.pytorch.callbacks.early_stopping import EarlyStopping
from torch_geometric.data.lightning.datamodule import LightningDataset
from pytorch_lightning.loggers.wandb import WandbLogger
def get_system(system_id: str) -> PinderSystem:
return PinderSystem(system_id)
from Bio import PDB
from Bio.PDB.PDBIO import PDBIO
def extract_coordinates_from_pdb(filename):
r"""
Extracts atom coordinates from a PDB file and returns them as a list of tuples.
Each tuple contains (x, y, z) coordinates of an atom.
"""
parser = PDB.PDBParser(QUIET=True)
structure = parser.get_structure("structure", filename)
coordinates = []
# Loop through each model, chain, residue, and atom to collect coordinates
for model in structure:
for chain in model:
for residue in chain:
# Retrieve atoms and their coordinates
for atom in residue:
xyz = atom.coord # Coordinates are in a numpy array
# Append the coordinates (x, y, z) as a tuple
coordinates.append((xyz[0], xyz[1], xyz[2]))
return coordinates
log = setup_logger(__name__)
try:
from torch_cluster import knn_graph
torch_cluster_installed = True
except ImportError as e:
log.warning(
"torch-cluster is not installed!"
"Please install the appropriate library for your pytorch installation."
"See https://github.com/rusty1s/pytorch_cluster/issues/185 for background."
)
torch_cluster_installed = False
def structure2tensor(
atom_coordinates: NDArray[np.double] | None = None,
atom_types: NDArray[np.str_] | None = None,
element_types: NDArray[np.str_] | None = None,
residue_coordinates: NDArray[np.double] | None = None,
residue_ids: NDArray[np.int_] | None = None,
residue_types: NDArray[np.str_] | None = None,
chain_ids: NDArray[np.str_] | None = None,
dtype: torch.dtype = torch.float32,
) -> dict[str, torch.Tensor]:
property_dict = {}
if atom_types is not None:
unknown_name_idx = max(pc.ALL_ATOM_POSNS.values()) + 1
types_array_at = np.zeros((len(atom_types), 1))
for i, name in enumerate(atom_types):
types_array_at[i] = pc.ALL_ATOM_POSNS.get(name, unknown_name_idx)
property_dict["atom_types"] = torch.tensor(types_array_at).type(dtype)
if element_types is not None:
types_array_ele = np.zeros((len(element_types), 1))
for i, name in enumerate(element_types):
types_array_ele[i] = pc.ELE2NUM.get(name, pc.ELE2NUM["other"])
property_dict["element_types"] = torch.tensor(types_array_ele).type(dtype)
if residue_types is not None:
unknown_name_idx = max(pc.AA_TO_INDEX.values()) + 1
types_array_res = np.zeros((len(residue_types), 1))
for i, name in enumerate(residue_types):
types_array_res[i] = pc.AA_TO_INDEX.get(name, unknown_name_idx)
property_dict["residue_types"] = torch.tensor(types_array_res).type(dtype)
if atom_coordinates is not None:
property_dict["atom_coordinates"] = torch.tensor(atom_coordinates, dtype=dtype)
if residue_coordinates is not None:
property_dict["residue_coordinates"] = torch.tensor(
residue_coordinates, dtype=dtype
)
if residue_ids is not None:
property_dict["residue_ids"] = torch.tensor(residue_ids, dtype=dtype)
if chain_ids is not None:
property_dict["chain_ids"] = torch.zeros(len(chain_ids), dtype=dtype)
property_dict["chain_ids"][chain_ids == "L"] = 1
return property_dict
class NodeRepresentation(Enum):
Surface = "surface"
Atom = "atom"
Residue = "residue"
class PairedPDB(HeteroData): # type: ignore
@classmethod
def from_tuple_system(
cls,
tupal: tuple = (Structure , Structure , Structure),
add_edges: bool = True,
k: int = 10,
) -> PairedPDB:
return cls.from_structure_pair(
holo=tupal[0],
apo=tupal[1],
add_edges=add_edges,
k=k,
)
@classmethod
def from_structure_pair(
cls,
holo: Structure,
apo: Structure,
add_edges: bool = True,
k: int = 10,
) -> PairedPDB:
graph = cls()
holo_calpha = holo.filter("atom_name", mask=["CA"])
apo_calpha = apo.filter("atom_name", mask=["CA"])
r_h = (holo.dataframe['chain_id'] == 'R').sum()
r_a = (apo.dataframe['chain_id'] == 'R').sum()
holo_r_props = structure2tensor(
atom_coordinates=holo.coords[:r_h],
atom_types=holo.atom_array.atom_name[:r_h],
element_types=holo.atom_array.element[:r_h],
residue_coordinates=holo_calpha.coords[:r_h],
residue_types=holo_calpha.atom_array.res_name[:r_h],
residue_ids=holo_calpha.atom_array.res_id[:r_h],
)
holo_l_props = structure2tensor(
atom_coordinates=holo.coords[r_h:],
atom_types=holo.atom_array.atom_name[r_h:],
element_types=holo.atom_array.element[r_h:],
residue_coordinates=holo_calpha.coords[r_h:],
residue_types=holo_calpha.atom_array.res_name[r_h:],
residue_ids=holo_calpha.atom_array.res_id[r_h:],
)
apo_r_props = structure2tensor(
atom_coordinates=apo.coords[:r_a],
atom_types=apo.atom_array.atom_name[:r_a],
element_types=apo.atom_array.element[:r_a],
residue_coordinates=apo_calpha.coords[:r_a],
residue_types=apo_calpha.atom_array.res_name[:r_a],
residue_ids=apo_calpha.atom_array.res_id[:r_a],
)
apo_l_props = structure2tensor(
atom_coordinates=apo.coords[r_a:],
atom_types=apo.atom_array.atom_name[r_a:],
element_types=apo.atom_array.element[r_a:],
residue_coordinates=apo_calpha.coords[r_a:],
residue_types=apo_calpha.atom_array.res_name[r_a:],
residue_ids=apo_calpha.atom_array.res_id[r_a:],
)
graph["ligand"].x = apo_l_props["atom_types"]
graph["ligand"].pos = apo_l_props["atom_coordinates"]
graph["receptor"].x = apo_r_props["atom_types"]
graph["receptor"].pos = apo_r_props["atom_coordinates"]
graph["ligand"].y = holo_l_props["atom_coordinates"]
# graph["ligand"].pos = holo_l_props["atom_coordinates"]
graph["receptor"].y = holo_r_props["atom_coordinates"]
# graph["receptor"].pos = holo_r_props["atom_coordinates"]
if add_edges and torch_cluster_installed:
graph["ligand"].edge_index = knn_graph(
graph["ligand"].pos, k=k
)
graph["receptor"].edge_index = knn_graph(
graph["receptor"].pos, k=k
)
# graph["ligand"].edge_index = knn_graph(
# graph["ligand"].pos, k=k
# )
# graph["receptor"].edge_index = knn_graph(
# graph["receptor"].pos, k=k
# )
return graph
#create_graph takes inputs apo_ligand, apo_residue and paired holo as pdb3(ground truth).
def create_graph(pdb1, pdb2, k=5):
r"""
Create a heterogeneous graph from two PDB files, with the ligand and receptor
as separate nodes, and their respective features and edges.
Args:
pdb1 (str): PDB file path for ligand.
pdb2 (str): PDB file path for receptor.
coords3 (list): List of coordinates used for `y` values (e.g., binding affinity, etc.).
k (int): Number of nearest neighbors for constructing the knn graph.
Returns:
HeteroData: A PyG HeteroData object containing ligand and receptor data.
"""
# Extract coordinates from PDB files
coords1 = torch.tensor(extract_coordinates_from_pdb(pdb1),dtype=torch.float)
coords2 = torch.tensor(extract_coordinates_from_pdb(pdb2),dtype=torch.float)
# coords3 = torch.tensor(extract_coordinates_from_pdb(pdb3),dtype=torch.float)
# Create the HeteroData object
data = HeteroData()
# Define ligand node features
data["ligand"].x = torch.tensor(coords1, dtype=torch.float)
data["ligand"].pos = coords1
# data["ligand"].y = torch.tensor(coords3[:len(coords1)], dtype=torch.float)
# Define receptor node features
data["receptor"].x = torch.tensor(coords2, dtype=torch.float)
data["receptor"].pos = coords2
# data["receptor"].y = torch.tensor(coords3[len(coords1):], dtype=torch.float)
# Construct k-NN graph for ligand
ligand_edge_index = knn_graph(data["ligand"].pos, k=k)
data["ligand"].edge_index = ligand_edge_index
# Construct k-NN graph for receptor
receptor_edge_index = knn_graph(data["receptor"].pos, k=k)
data["receptor"].edge_index = receptor_edge_index
# Convert edge index to SparseTensor for ligand
data["ligand", "ligand"].edge_index = ligand_edge_index
# Convert edge index to SparseTensor for receptor
data["receptor", "receptor"].edge_index = receptor_edge_index
return data
def update_pdb_coordinates_from_tensor(input_filename, output_filename, coordinates_tensor):
r"""
Updates atom coordinates in a PDB file with new transformed coordinates provided in a tensor.
Parameters:
- input_filename (str): Path to the original PDB file.
- output_filename (str): Path to the new PDB file to save updated coordinates.
- coordinates_tensor (torch.Tensor): Tensor of shape (1, N, 3) with transformed coordinates.
"""
# Convert the tensor to a list of tuples
new_coordinates = coordinates_tensor.squeeze(0).tolist()
# Create a parser and parse the structure
parser = PDB.PDBParser(QUIET=True)
structure = parser.get_structure("structure", input_filename)
# Flattened iterator for atoms to update coordinates
atom_iterator = (atom for model in structure for chain in model for residue in chain for atom in residue)
# Update each atom's coordinates
for atom, (new_x, new_y, new_z) in zip(atom_iterator, new_coordinates):
original_anisou = atom.get_anisou()
original_uij = atom.get_siguij()
original_tm= atom.get_sigatm()
original_occupancy = atom.get_occupancy()
original_bfactor = atom.get_bfactor()
original_altloc = atom.get_altloc()
original_fullname = atom.get_fullname()
original_serial_number = atom.get_serial_number()
original_element = atom.get_charge()
original_id = atom.get_full_id()
original_idx = atom.get_id()
original_level = atom.get_level()
original_name = atom.get_name()
original_parent = atom.get_parent()
original_radius = atom.get_radius()
# Update only the atom coordinates, keep other fields intact
atom.coord = np.array([new_x, new_y, new_z])
# Reapply the preserved properties
atom.set_anisou(original_anisou)
atom.set_siguij(original_uij)
atom.set_sigatm(original_tm)
atom.set_occupancy(original_occupancy)
atom.set_bfactor(original_bfactor)
atom.set_altloc(original_altloc)
# atom.set_fullname(original_fullname)
atom.set_serial_number(original_serial_number)
atom.set_charge(original_element)
atom.set_radius(original_radius)
atom.set_parent(original_parent)
# atom.set_name(original_name)
# atom.set_leve
output_filename = "/tmp/" + output_filename
# Save the updated structure to a new PDB file
io = PDBIO()
io.set_structure(structure)
io.save(output_filename)
# Return the path to the updated PDB file
return output_filename
def merge_pdb_files(file1, file2, output_file):
r"""
Merges two PDB files by concatenating them without altering their contents.
Parameters:
- file1 (str): Path to the first PDB file (e.g., receptor).
- file2 (str): Path to the second PDB file (e.g., ligand).
- output_file (str): Path to the output file where the merged structure will be saved.
"""
output_file = "/tmp/" + output_file
with open(output_file, 'w') as outfile:
# Copy the contents of the first file
with open(file1, 'r') as f1:
lines = f1.readlines()
# Write all lines except the last 'END' line
outfile.writelines(lines[:-1])
# Copy the contents of the second file
with open(file2, 'r') as f2:
outfile.write(f2.read())
print(f"Merged PDB saved to {output_file}")
return output_file
class MPNNLayer(MessagePassing):
def __init__(self, emb_dim=64, edge_dim=4, aggr='add'):
r"""Message Passing Neural Network Layer
Args:
emb_dim: (int) - hidden dimension d
edge_dim: (int) - edge feature dimension d_e
aggr: (str) - aggregation function \oplus (sum/mean/max)
"""
# Set the aggregation function
super().__init__(aggr=aggr)
self.emb_dim = emb_dim
self.edge_dim = edge_dim
# MLP \psi for computing messages m_ij
# Implemented as a stack of Linear->BN->ReLU->Linear->BN->ReLU
# dims: (2d + d_e) -> d
self.mlp_msg = Sequential(
Linear(2*emb_dim + edge_dim, emb_dim), BatchNorm1d(emb_dim), ReLU(),
Linear(emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU()
)
# MLP \phi for computing updated node features h_i^{l+1}
# Implemented as a stack of Linear->BN->ReLU->Linear->BN->ReLU
# dims: 2d -> d
self.mlp_upd = Sequential(
Linear(2*emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU(),
Linear(emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU()
)
def forward(self, h, edge_index, edge_attr):
r"""
The forward pass updates node features h via one round of message passing.
As our MPNNLayer class inherits from the PyG MessagePassing parent class,
we simply need to call the propagate() function which starts the
message passing procedure: message() -> aggregate() -> update().
The MessagePassing class handles most of the logic for the implementation.
To build custom GNNs, we only need to define our own message(),
aggregate(), and update() functions (defined subsequently).
Args:
h: (n, d) - initial node features
edge_index: (e, 2) - pairs of edges (i, j)
edge_attr: (e, d_e) - edge features
Returns:
out: (n, d) - updated node features
"""
out = self.propagate(edge_index, h=h, edge_attr=edge_attr)
return out
def message(self, h_i, h_j, edge_attr):
r"""Step (1) Message
The message() function constructs messages from source nodes j
to destination nodes i for each edge (i, j) in edge_index.
The arguments can be a bit tricky to understand: message() can take
any arguments that were initially passed to propagate. Additionally,
we can differentiate destination nodes and source nodes by appending
_i or _j to the variable name, e.g. for the node features h, we
can use h_i and h_j.
This part is critical to understand as the message() function
constructs messages for each edge in the graph. The indexing of the
original node features h (or other node variables) is handled under
the hood by PyG.
Args:
h_i: (e, d) - destination node features
h_j: (e, d) - source node features
edge_attr: (e, d_e) - edge features
Returns:
msg: (e, d) - messages m_ij passed through MLP \psi
"""
msg = torch.cat([h_i, h_j, edge_attr], dim=-1)
return self.mlp_msg(msg)
def aggregate(self, inputs, index):
r"""Step (2) Aggregate
The aggregate function aggregates the messages from neighboring nodes,
according to the chosen aggregation function ('sum' by default).
Args:
inputs: (e, d) - messages m_ij from destination to source nodes
index: (e, 1) - list of source nodes for each edge/message in input
Returns:
aggr_out: (n, d) - aggregated messages m_i
"""
return scatter(inputs, index, dim=self.node_dim, reduce=self.aggr)
def update(self, aggr_out, h):
r"""
Step (3) Update
The update() function computes the final node features by combining the
aggregated messages with the initial node features.
update() takes the first argument aggr_out, the result of aggregate(),
as well as any optional arguments that were initially passed to
propagate(). E.g. in this case, we additionally pass h.
Args:
aggr_out: (n, d) - aggregated messages m_i
h: (n, d) - initial node features
Returns:
upd_out: (n, d) - updated node features passed through MLP \phi
"""
upd_out = torch.cat([h, aggr_out], dim=-1)
return self.mlp_upd(upd_out)
def __repr__(self) -> str:
return (f'{self.__class__.__name__}(emb_dim={self.emb_dim}, aggr={self.aggr})')
class MPNNModel(Module):
def __init__(self, num_layers=4, emb_dim=64, in_dim=11, edge_dim=4, out_dim=1):
r"""Message Passing Neural Network model for graph property prediction
Args:
num_layers: (int) - number of message passing layers L
emb_dim: (int) - hidden dimension d
in_dim: (int) - initial node feature dimension d_n
edge_dim: (int) - edge feature dimension d_e
out_dim: (int) - output dimension (fixed to 1)
"""
super().__init__()
# Linear projection for initial node features
# dim: d_n -> d
self.lin_in = Linear(in_dim, emb_dim)
# Stack of MPNN layers
self.convs = torch.nn.ModuleList()
for layer in range(num_layers):
self.convs.append(MPNNLayer(emb_dim, edge_dim, aggr='add'))
# Global pooling/readout function R (mean pooling)
# PyG handles the underlying logic via global_mean_pool()
self.pool = global_mean_pool
# Linear prediction head
# dim: d -> out_dim
self.lin_pred = Linear(emb_dim, out_dim)
def forward(self, data):
r"""
Args:
data: (PyG.Data) - batch of PyG graphs
Returns:
out: (batch_size, out_dim) - prediction for each graph
"""
h = self.lin_in(data.x) # (n, d_n) -> (n, d)
for conv in self.convs:
h = h + conv(h, data.edge_index, data.edge_attr) # (n, d) -> (n, d)
# Note that we add a residual connection after each MPNN layer
h_graph = self.pool(h, data.batch) # (n, d) -> (batch_size, d)
out = self.lin_pred(h_graph) # (batch_size, d) -> (batch_size, 1)
return out.view(-1)
class EquivariantMPNNLayer(MessagePassing):
def __init__(self, emb_dim=64, aggr='add'):
r"""Message Passing Neural Network Layer
This layer is equivariant to 3D rotations and translations.
Args:
emb_dim: (int) - hidden dimension d
edge_dim: (int) - edge feature dimension d_e
aggr: (str) - aggregation function \oplus (sum/mean/max)
"""
# Set the aggregation function
super().__init__(aggr=aggr)
self.emb_dim = emb_dim
#
self.mlp_msg = Sequential(
Linear(2 * emb_dim + 1, emb_dim),
BatchNorm1d(emb_dim),
ReLU(),
Linear(emb_dim, emb_dim),
BatchNorm1d(emb_dim),
ReLU()
)
self.mlp_pos = Sequential(
Linear(emb_dim, emb_dim),
BatchNorm1d(emb_dim),
ReLU(),
Linear(emb_dim,1)
) # MLP \psi
self.mlp_upd = Sequential(
Linear(2*emb_dim, emb_dim), BatchNorm1d(emb_dim), ReLU(), Linear(emb_dim,emb_dim), BatchNorm1d(emb_dim), ReLU()
) # MLP \phi
# ===========================================
def forward(self, h, pos, edge_index):
r"""
The forward pass updates node features h via one round of message passing.
Args:
h: (n, d) - initial node features
pos: (n, 3) - initial node coordinates
edge_index: (e, 2) - pairs of edges (i, j)
edge_attr: (e, d_e) - edge features
Returns:
out: [(n, d),(n,3)] - updated node features
"""
#
out = self.propagate(edge_index=edge_index, h=h, pos=pos)
return out
# ==========================================
#
def message(self, h_i,h_j,pos_i,pos_j):
# Compute distance between nodes i and j (Euclidean distance)
#distance_ij = torch.norm(pos_i - pos_j, dim=-1, keepdim=True) # (e, 1)
pos_diff = pos_i - pos_j
dists = torch.norm(pos_diff,dim=-1).unsqueeze(1)
# Concatenate node features, edge features, and distance
msg = torch.cat([h_i , h_j, dists], dim=-1)
msg = self.mlp_msg(msg)
pos_diff = pos_diff * self.mlp_pos(msg) # (e, 2d + d_e + 1)
# (e, d)
return msg , pos_diff
# ...
#
def aggregate(self, inputs, index):
r"""The aggregate function aggregates the messages from neighboring nodes,
according to the chosen aggregation function ('sum' by default).
Args:
inputs: (e, d) - messages m_ij from destination to source nodes
index: (e, 1) - list of source nodes for each edge/message in input
Returns:
aggr_out: (n, d) - aggregated messages m_i
"""
msgs , pos_diffs = inputs
msg_aggr = scatter(msgs, index , dim = self.node_dim , reduce = self.aggr)
pos_aggr = scatter(pos_diffs, index, dim = self.node_dim , reduce = "mean")
return msg_aggr , pos_aggr
def update(self, aggr_out, h , pos):
msg_aggr , pos_aggr = aggr_out
upd_out = self.mlp_upd(torch.cat((h, msg_aggr), dim=-1))
upd_pos = pos + pos_aggr
return upd_out , upd_pos
def __repr__(self) -> str:
return (f'{self.__class__.__name__}(emb_dim={self.emb_dim}, aggr={self.aggr})')
class FinalMPNNModel(MPNNModel):
def __init__(self, num_layers=4, emb_dim=64, in_dim=3, num_heads = 2):
r"""Message Passing Neural Network model for graph property prediction
This model uses both node features and coordinates as inputs, and
is invariant to 3D rotations and translations (the constituent MPNN layers
are equivariant to 3D rotations and translations).
Args:
num_layers: (int) - number of message passing layers L
emb_dim: (int) - hidden dimension d
in_dim: (int) - initial node feature dimension d_n
edge_dim: (int) - edge feature dimension d_e
out_dim: (int) - output dimension (fixed to 1)
"""
super().__init__()
# Linear projection for initial node features
# dim: d_n -> d
self.lin_in = Linear(in_dim, emb_dim)
self.equiv_layer = EquivariantMPNNLayer(emb_dim=emb_dim)
# Stack of MPNN layers
self.convs = torch.nn.ModuleList()
for layer in range(num_layers):
self.convs.append(EquivariantMPNNLayer(emb_dim, aggr='add'))
self.cross_attention = nn.MultiheadAttention(emb_dim, num_heads, batch_first=True)
self.fc_rotation = nn.Linear(emb_dim, 9)
self.fc_translation = nn.Linear(emb_dim, 3)
# Global pooling/readout function R (mean pooling)
# PyG handles the underlying logic via global_mean_pool()
# self.pool = global_mean_pool
def naive_single(self, receptor, ligand , receptor_edge_index , ligand_edge_index):
r"""
Processes a single receptor-ligand pair.
Args:
receptor: Tensor of shape (1, num_receptor_atoms, 3) (receptor coordinates)
ligand: Tensor of shape (1, num_ligand_atoms, 3) (ligand coordinates)
Returns:
rotation_matrix: Tensor of shape (1, 3, 3) predicted rotation matrix for the ligand.
translation_vector: Tensor of shape (1, 3) predicted translation vector for the ligand.
"""
# h_receptor = receptor # Initial node features for the receptor
# h_ligand = ligand
h_receptor = self.lin_in(receptor)
h_ligand = self.lin_in(ligand) # Initial node features for the ligand
pos_receptor = receptor # Initial positions
pos_ligand = ligand
for layer in self.convs:
# Apply the equivariant message-passing layer for both receptor and ligand
h_receptor, pos_receptor = layer(h_receptor, pos_receptor,receptor_edge_index )
h_ligand, pos_ligand = layer(h_ligand, pos_ligand, ligand_edge_index)
# print("Shape of h_receptor:", h_receptor.shape)
# print("Shape of h_ligand:", h_ligand.shape)
# Pass the layer outputs through MLPs for embeddings
emb_features_receptor = h_receptor
emb_features_ligand = h_ligand
attn_output, _ = self.cross_attention(emb_features_receptor, emb_features_ligand, emb_features_ligand)
rotation_matrix = self.fc_rotation(attn_output.mean(dim=0))
rotation_matrix = rotation_matrix.view(-1, 3, 3)
translation_vector = self.fc_translation(attn_output.mean(dim=0))
return rotation_matrix, translation_vector
def forward(self, data):
r"""
The main forward pass of the model.
Args:
batch: Same as in forward_rot_trans.
Returns:
transformed_ligands: List of tensors, each of shape (1, num_ligand_atoms, 3)
representing the transformed ligand coordinates after applying the predicted
rotation and translation.
"""
receptor = data['receptor']['pos']
ligand = data['ligand']['pos']
receptor_edge_index = data['receptor']['edge_index']
ligand_edge_index = data['ligand']['edge_index']
rotation_matrix, translation_vector = self.naive_single(receptor, ligand,receptor_edge_index , ligand_edge_index)
# for i in range(len(ligands)):
# ligands[i] = ligands[i] @ rotation_matrix[i] + translation_vector[i]
ligands = data['ligand']['pos'] @ rotation_matrix + translation_vector
return ligands
class FinalMPNNModelight(pl.LightningModule):
def __init__(self, num_layers=4, emb_dim=32, in_dim=3, num_heads=1, lr=1e-4):
super().__init__()
self.lin_in = nn.Linear(in_dim, emb_dim)
self.convs = nn.ModuleList([EquivariantMPNNLayer(emb_dim, aggr='add') for _ in range(num_layers)])
self.cross_attention = nn.MultiheadAttention(emb_dim, num_heads, batch_first=True)
self.fc_rotation = nn.Linear(emb_dim, 9)
self.fc_translation = nn.Linear(emb_dim, 3)
self.lr = lr
def naive_single(self, receptor, ligand, receptor_edge_index, ligand_edge_index):
h_receptor = self.lin_in(receptor)
h_ligand = self.lin_in(ligand)
pos_receptor, pos_ligand = receptor, ligand
for layer in self.convs:
h_receptor, pos_receptor = layer(h_receptor, pos_receptor, receptor_edge_index)
h_ligand, pos_ligand = layer(h_ligand, pos_ligand, ligand_edge_index)
attn_output, _ = self.cross_attention(h_receptor, h_ligand, h_ligand)
rotation_matrix = self.fc_rotation(attn_output.mean(dim=0)).view(-1, 3, 3)
translation_vector = self.fc_translation(attn_output.mean(dim=0))
return rotation_matrix, translation_vector
def forward(self, data):
device = torch.device('cuda:0' if torch.cuda.is_available() else 'cpu')
receptor = data['receptor']['pos'].to(device)
ligand = data['ligand']['pos'].to(device)
receptor_edge_index = data['receptor', 'receptor']['edge_index'].to(device)
ligand_edge_index = data['ligand', 'ligand']['edge_index'].to(device)
rotation_matrix, translation_vector = self.naive_single(receptor, ligand, receptor_edge_index, ligand_edge_index)
# transformed_ligand = torch.matmul(ligand ,rotation_matrix) + translation_vector
return rotation_matrix, translation_vector
def training_step(self, batch, batch_idx):
ligand_pred = self(batch)
ligand_true = batch['ligand']['y']
loss = F.mse_loss(ligand_pred.squeeze(0), ligand_true)
self.log('train_loss', loss, batch_size=8)
return loss
def validation_step(self, batch, batch_idx):
ligand_pred = self(batch)
ligand_true = batch['ligand']['y']
loss = F.l1_loss(ligand_pred.squeeze(0), ligand_true)
self.log('val_loss', loss, prog_bar=True, batch_size=8)
return loss
def test_step(self, batch, batch_idx):
ligand_pred = self(batch)
ligand_true = batch['ligand']['y']
loss = F.l1_loss(ligand_pred.squeeze(0), ligand_true)
self.log('test_loss', loss, prog_bar=True, batch_size=8)
return loss
def configure_optimizers(self):
optimizer = torch.optim.Adam(self.parameters(), lr=self.lr)
scheduler = torch.optim.lr_scheduler.ReduceLROnPlateau(
optimizer, mode="min", factor=0.1, patience=5
)
return {
"optimizer": optimizer,
"lr_scheduler": {
"scheduler": scheduler,
"monitor": "val_loss", # Monitor validation loss to adjust the learning rate
},
}
model_path = "./EquiMPNN-epoch=413-val_loss=9.25-val_acc=0.00.ckpt"
model = FinalMPNNModelight.load_from_checkpoint(model_path)
trainer = pl.Trainer(
fast_dev_run=False,
accelerator="gpu" if torch.cuda.is_available() else "cpu",
precision="bf16-mixed",
devices=1,
)
model.eval()
def predict (input_seq_1, input_msa_1, input_protein_1, input_seq_2,input_msa_2, input_protein_2):
start_time = time.time()
device = torch.device("cuda" if torch.cuda.is_available() else "cpu")
data = create_graph(input_protein_1, input_protein_2, k=10)
with torch.no_grad():
mat, vect = model(data)
mat = mat.to(device)
vect = vect.to(device)
ligand1 = torch.tensor(extract_coordinates_from_pdb(input_protein_1),dtype=torch.float).to(device)
# receptor1 = torch.tensor(extract_coordinates_from_pdb(input_protein_2),dtype=torch.float).to(device)
transformed_ligand = torch.matmul(ligand1, mat) + vect
# transformed_receptor = torch.matmul(receptor1, mat) + vect
file1 = update_pdb_coordinates_from_tensor(input_protein_1, "holo_ligand.pdb", transformed_ligand)
# file2 = update_pdb_coordinates_from_tensor(input_protein_2, "holo_receptor.pdb", transformed_receptor)
out_pdb = merge_pdb_files(file1,input_protein_2,"output.pdb")
# return an output pdb file with the protein and two chains A and B.
# also return a JSON with any metrics you want to report
metrics = {"mean_plddt": 80, "binding_affinity": 2}
end_time = time.time()
run_time = end_time - start_time
return out_pdb,json.dumps(metrics), run_time
with gr.Blocks() as app:
gr.Markdown("# Template for inference")
gr.Markdown("EquiMPNN MOdel")
with gr.Row():
with gr.Column():
input_seq_1 = gr.Textbox(lines=3, label="Input Protein 1 sequence (FASTA)")
input_msa_1 = gr.File(label="Input MSA Protein 1 (A3M)")
input_protein_1 = gr.File(label="Input Protein 2 monomer (PDB)")
with gr.Column():
input_seq_2 = gr.Textbox(lines=3, label="Input Protein 2 sequence (FASTA)")
input_msa_2 = gr.File(label="Input MSA Protein 2 (A3M)")
input_protein_2 = gr.File(label="Input Protein 2 structure (PDB)")
# define any options here
# for automated inference the default options are used
# slider_option = gr.Slider(0,10, label="Slider Option")
# checkbox_option = gr.Checkbox(label="Checkbox Option")
# dropdown_option = gr.Dropdown(["Option 1", "Option 2", "Option 3"], label="Radio Option")
btn = gr.Button("Run Inference")
gr.Examples(
[
[
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
"3v1c_A.pdb",
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
"3v1c_B.pdb",
],
],
[input_seq_1, input_protein_1, input_seq_2, input_protein_2],
)
reps = [
{
"model": 0,
"style": "cartoon",
"chain": "A",
"color": "whiteCarbon",
},
{
"model": 0,
"style": "cartoon",
"chain": "B",
"color": "greenCarbon",
},
{
"model": 0,
"chain": "A",
"style": "stick",
"sidechain": True,
"color": "whiteCarbon",
},
{
"model": 0,
"chain": "B",
"style": "stick",
"sidechain": True,
"color": "greenCarbon"
}
]
# outputs
out = Molecule3D(reps=reps)
metrics = gr.JSON(label="Metrics")
run_time = gr.Textbox(label="Runtime")
btn.click(predict, inputs=[input_seq_1, input_msa_1, input_protein_1, input_seq_2, input_msa_2, input_protein_2], outputs=[out, metrics, run_time])
app.launch()