Unnamed: 0
int64 0
192k
| title
stringlengths 1
200
| text
stringlengths 10
100k
| url
stringlengths 32
885
| authors
stringlengths 2
392
| timestamp
stringlengths 19
32
⌀ | tags
stringlengths 6
263
| info
stringlengths 45
90.4k
|
---|---|---|---|---|---|---|---|
187,905 |
Structure messaging guidelines for a design system
|
Messaging guidelines within a design system are one of the most important things which define how the system communicates with the user by showing updates, errors, feedbacks & warnings.
Design systems are not just for visual references and code snippets, they define how the system will communicate with the user and vice versa. They also define consistency and help users of the design system to pick the correct mode of communication.
In this article, we’ll take a look at some tips on how to write and present messaging guidelines to help users of the design system to pick the correct mode of communication.
Type of guidelines
Open-ended
Open-ended guidelines can be generic and universal when you don’t require guidelines to be very specific and to be used by users according to the scenario while maintaining basic rules.
Strict & thorough
This type of guideline should be very detailed and specific, constructing it will require time as compared to open-ended guidelines. It has to be made sure that the user doesn’t interpret the components according to the scenario, the user should be able to apply the specified component according to the scenario.
We’ll be talking about Strict Guidelines in this article.
Users
Identify your user, are they — designers, developers, quality analysts and keep them in mind while designing the guidelines as this will make a huge difference. Designers would be familiar with an interaction but developers won’t be, developers would be familiar with a certain technical error but designers won’t be. So make sure the guidelines are well defined and thought through.
Establish Principles
Source : Google Material Design
Let users know a high-level picture of the component’s functions and behavior, this gives a quick picture to users that if the component fits in the scenario before going through the whole guidelines for that component.
Explain user how these guidelines will help to choose correct messaging component
Users may not always know which component will fit the scenario or might get confused between two components. To mitigate this problem, different ways of representation can be used to help the user make a decision. It can be an infographic, a table, a high-level visual representation of all the components at once, or a combination of all of them. If making this is difficult, start making use cases for users, and then it will be easier to decide a way to explain.
Lighting Design System, visuals explaining how to choose a type of message
Lighting Design System, with the combination of the above visual representation and this table, user can choose a messaging component for the required scenario
States, types of messages
Users should be aware of all the types of messages within a message component. Each component comes with several states like error state, success state, informative state (do note that these individual states can be defined further like dismissable error or form error, we can talk about this in another article). States should have an urgency or priority queue with defined behavior so that users can choose when and what state to use based on urgency.
Source : Adobe Spectrum Design System
Each state has a specific use case which can be shown as an example, don’t assume the user to interpret on their own. Being specific helps the user to make a decision efficiently with less cognitive load.
Source : Carbon Design System
Messaging Components
There are different messaging components for each use case, few examples are Modal/Dialog, Toast, Popover, Inline message, and so on. These components should be well explained and defined, you can also add use cases/usage, behaviors for more detailed information.
Source : Carbon Design System
Placement
Where and how to place a component representation with context. The same type of message component can have different placements and have different use and meaning.
For example
A toast message placed on the top center means an informational and conformational toast that requires the user’s attention.
Source : Atlassian — Jira
A toast aligned near a field means a contextual toast which requires action.
Source : Gmail, when user send a mail this toast appears at a low priority position e.i bottom left
So, be very specific on details for placement guidelines and also include what that placement means.
Content
Components messaging must allow the users to understand what is going on. It should follow the writing styles and the defined messaging principles. Each type component requires a specific type of content. You can further write detailed content guidelines while defining states of messages and use cases.
Source : Lighting Design System, Inline messaging
Few Extra things
Apart from visual specifications and anatomy of component, you can include examples for
|
https://medium.com/@gauravrawatinfo/structure-messaging-guidelines-for-design-system-e2780e1d28f8
|
['Gaurav Rawat']
|
2021-03-30 16:07:26.360000+00:00
|
['Guidelines', 'Design Systems', 'Structure', 'Messaging', 'User Experience']
|
Title Structure messaging guideline design systemContent Messaging guideline within design system one important thing define system communicates user showing update error feedback warning Design system visual reference code snippet define system communicate user vice versa also define consistency help user design system pick correct mode communication article we’ll take look tip write present messaging guideline help user design system pick correct mode communication Type guideline Openended Openended guideline generic universal don’t require guideline specific used user according scenario maintaining basic rule Strict thorough type guideline detailed specific constructing require time compared openended guideline made sure user doesn’t interpret component according scenario user able apply specified component according scenario We’ll talking Strict Guidelines article Users Identify user — designer developer quality analyst keep mind designing guideline make huge difference Designers would familiar interaction developer won’t developer would familiar certain technical error designer won’t make sure guideline well defined thought Establish Principles Source Google Material Design Let user know highlevel picture component’s function behavior give quick picture user component fit scenario going whole guideline component Explain user guideline help choose correct messaging component Users may always know component fit scenario might get confused two component mitigate problem different way representation used help user make decision infographic table highlevel visual representation component combination making difficult start making use case user easier decide way explain Lighting Design System visuals explaining choose type message Lighting Design System combination visual representation table user choose messaging component required scenario States type message Users aware type message within message component component come several state like error state success state informative state note individual state defined like dismissable error form error talk another article States urgency priority queue defined behavior user choose state use based urgency Source Adobe Spectrum Design System state specific use case shown example don’t assume user interpret specific help user make decision efficiently le cognitive load Source Carbon Design System Messaging Components different messaging component use case example ModalDialog Toast Popover Inline message component well explained defined also add use casesusage behavior detailed information Source Carbon Design System Placement place component representation context type message component different placement different use meaning example toast message placed top center mean informational conformational toast requires user’s attention Source Atlassian — Jira toast aligned near field mean contextual toast requires action Source Gmail user send mail toast appears low priority position ei bottom left specific detail placement guideline also include placement mean Content Components messaging must allow user understand going follow writing style defined messaging principle type component requires specific type content write detailed content guideline defining state message use case Source Lighting Design System Inline messaging Extra thing Apart visual specification anatomy component include example forTags Guidelines Design Systems Structure Messaging User Experience
|
187,906 |
Top Insurance Agencies | Claims procedure Works
|
How automobile assurance Claims procedure Works
assurance is a time period we apprehend just about each day. From lifestyles assurance to health and shuttle, basically every thing we do this present day is insured, which suggests we now have a security net if anything untoward happens.
the continuing communicable has above all shown us how important it is to be organized for the surprising and how coverage works in safeguarding us and our backing, including our cars. That makes shiny the nitty-gritties of our motor protection a need to. right here’s a checklist of belongings you should understand while making assurance claims in your motor vehicle.
A complete motor vehicle coverage cowl offers you massive advantages and is extremely essential if you happen to trust complete financial health and wellbeing. first and most beneficial, you cannot buy a vehicle and force it inside India with out some kind of motor assurance.
As per the Motor motors Act of , it s obligatory for all vehicles in India to accept third-birthday celebration coverage. additional, in its place of deciding to buy just the minimum quantity of coverage or picking the cheapest coverage accessible, it could be a good suggestion to put money into a complete car assurance cowl which in reality protects you from all concerns together with all man-made and natural calamities. Secondly, car insurance helps you get well from untoward incidents in a number of methods. These consist of:
providing cover against capabilities court cases, including the legal prices, in case of legal court cases afterward an accident.
providing insurance on expenses touching on vehicle aliment afterward damage caused with the aid of accidents.
providing insurance in case of every other natural or synthetic calamities inflicting harm to the vehicle.
car assurance additionally makes it possible for customers to avail top class coupon codes for theft.
owning multiple policies with the identical insurance provider additionally offers big top class coupon codes.
complete motor vehicle insurance guidelines also allow you to prolong insurance to other individuals driving your automobile with your permission, accordingly conserving you even for those who are not in the back of the caster.
if you do not elevate any claims at the conclusion of your policy or administration, you may be acceptable for a no claim bonus on renewals, as long as you meet definite agreed terms and stipulations.
The leading purpose of paying for an insurance policy is to ensure that in your second of need, the assurance funds can help you meet the associated charges. From that point of view, when it involves insurance, the ‘moment of certainty’ is defined by means of the benefit of the claims and settlement method.
once you decide to purchase a vehicle and subscribe to a finished insurance cowl, you may be troubled about a way to go concerning the claims procedure in case of an accident or another untoward adventure. right here is an in depth analysis of all of the stuff you need to take into account back it comes to the vehicle assurance claims technique.
firstly, an assurance declare is an professional request, from the policyholder to the insurance issuer, stressful compensation for the hurt or loss incurred. once the claim is processed and validated, the insurance issuer offers compensation which is in accordance with the coverage assured to the consumer, below the assurance settlement.
You could make the declare in two ways — cashless components or repayment formula. after an accident, in case you get your vehicle repaired at a accomplice garage, then your coverage declare is acclimatized in a cashless manner. assurance businesses accept tie-united stateswith garage chains, so it s most fulfilling to analyze about which garages are partnered along with your insurance company, for top-quality and quickest claim resolutions.
during this scenario, the coverage provider makes absolute payments to the accomplice garage, making it extra convenient. if you get your vehicle repaired at a storage which isn t partnered together with your insurance issuer, you re going to need to accomplish the payments and get the bills.
once this is done, you could get the restoration expenses reimbursed through the assurance provider. repayment claims can also be filed in case you have third party claims in opposition t you. in case you pay the third party without delay, you could get a compensation from your assurance provider, reckoning on the phrases and conditions mentioned in the coverage. listed here are a collection of questions that appear up in the event you are filing a vehicle insurance declare.
based on the character of your declare, you could be appropriate to publish all or a few of here files:
you re going to ought to observe these steps whereas filing a claim for amercement to your personal motor vehicle:
first, you need to be certain that you acquaint your business in boost before sending your automobile to the storage for aliment. once you do that, the company will ship a surveyor to examine and check the amercement, making it less demanding to get the claims reimbursed. You and your insurance company will both get hold of copies of the examiner’s file, offering proof of the harm brought about and an evaluation of the extent of amercement.
second, you must fill and put up the exact claim kind to your assurance provider. This can be accomplished both on-line and offline. despite the fact, you must ensure that you do not pass over any critical particulars.
Third, together with the form, you must submit the requested documents which usually include a copy of your riding authorization and motor vehicle allotment certificate. in the case of theft or toll road accidents, you must also post a duplicate of the FIR filed with the badge.
as soon as the automobile is repaired and you acquire the bill, you should post a copy of the bill to complement your declare.
following the examination and analysis of the entire documents, the assurance enterprise will procedure the declare and reimburse you for the amercement incurred.
if in case you have been part of an blow that has brought about injury to rd-birthday celebration or harm to rd-celebration acreage, you could observe these accomplish to book the declare:
<iframe src=”https://www.facebook.com/plugins/post.php?href=https%3A%2F%2Fwww.facebook.com%2Fsaktiutamaperkasa%2Fposts%2F10158341523701175&show_text=true&width=500" width=”500" height=”590" style=”border:none;overflow:hidden” scrolling=”no” frameborder=”0" allowfullscreen=”true” allow=”autoplay; clipboard-write; encrypted-media; picture-in-picture; web-share”></iframe>
acquaint your insurance company as quickly as you acquire the declare note. along with this, additionally put up the registration certificate of your motor vehicle, your driving license, and the FIR filed with the police.
The insurer will provide you with the features of a attorney as soon as the documents are confirmed.
once the case goes to court, if you re found vulnerable to pay damages, your insurer will accomplish the price on your account, based on the sum insured.
if your automobile has been baseborn, which you could choose right here accomplish to book a declare with your assurance provider:
first, as quickly as feasible, lodge a badge criticism and book an FIR. as soon as here is accomplished, send a duplicate of the FIR to your assurance enterprise. together with this, also send a duplicate of the final police report along with the allotment certificate.
as soon as the files are confirmed, and all the formalities are accomplished, the assurance company will reimburse you for the sum insured.
Accidents are unexpected and they tend to abash us. when you are in an accident, these items can aid you carry a claim extra with ease:
immediately investigate your self and your vehicle for damages. in keeping with your situation, make a decision even if you crave scientific counsel or now not.
try to note the details of the different birthday party, in case an extra automobile is concerned in the accident. this can assist establish the different celebration eventually.
If possible, lift bottomward the contact details of witnesses within the vicinity as they can approve your chronicle.
if in case you have entry to a companion garage, that you would be able to now choose the cashless claims alternative to affluence the procedure.
most insurers require claims to be aloft inside hours of the blow, so be sure that you do not prolong this.
preserve all the required files easy to make certain that your declare receives candy as soon as feasible.
possessing a vehicle is a amusement, but it surely is additionally a responsibility. it is crucial to be absolutely organized in case of an accident, and complete automobile insurance is the only option to be properly prepared. additionally, it is additionally essential to be well versed with the claims method as, again and again, we get worried and forget essential details after entering into an blow.
remember, it is optimum to make the procedure easier on your assurance business to balance your claims, so capture all possible steps to make certain that which you can file a successful claim following an adverse incident. As they say, it is all the time enhanced to be protected than apologetic.
|
https://medium.com/@taxrental/top-insurance-agencies-claims-procedure-works-968bd5b263a1
|
['Samny Shakti']
|
2021-12-25 08:20:22.311000+00:00
|
['Lawyers', 'Insurance', 'Cars', 'Claims', 'Taxi Service']
|
Title Top Insurance Agencies Claims procedure WorksContent automobile assurance Claims procedure Works assurance time period apprehend day lifestyle assurance health shuttle basically every thing present day insured suggests security net anything untoward happens continuing communicable shown u important organized surprising coverage work safeguarding u backing including car make shiny nittygritties motor protection need right here’s checklist belonging understand making assurance claim motor vehicle complete motor vehicle coverage cowl offer massive advantage extremely essential happen trust complete financial health wellbeing first beneficial cannot buy vehicle force inside India kind motor assurance per Motor motor Act obligatory vehicle India accept thirdbirthday celebration coverage additional place deciding buy minimum quantity coverage picking cheapest coverage accessible could good suggestion put money complete car assurance cowl reality protects concern together manmade natural calamity Secondly car insurance help get well untoward incident number method consist providing cover capability court case including legal price case legal court case afterward accident providing insurance expense touching vehicle aliment afterward damage caused aid accident providing insurance case every natural synthetic calamity inflicting harm vehicle car assurance additionally make possible customer avail top class coupon code theft owning multiple policy identical insurance provider additionally offer big top class coupon code complete motor vehicle insurance guideline also allow prolong insurance individual driving automobile permission accordingly conserving even back caster elevate claim conclusion policy administration may acceptable claim bonus renewal long meet definite agreed term stipulation leading purpose paying insurance policy ensure second need assurance fund help meet associated charge point view involves insurance ‘moment certainty’ defined mean benefit claim settlement method decide purchase vehicle subscribe finished insurance cowl may troubled way go concerning claim procedure case accident another untoward adventure right depth analysis stuff need take account back come vehicle assurance claim technique firstly assurance declare professional request policyholder insurance issuer stressful compensation hurt loss incurred claim processed validated insurance issuer offer compensation accordance coverage assured consumer assurance settlement could make declare two way — cashless component repayment formula accident case get vehicle repaired accomplice garage coverage declare acclimatized cashless manner assurance business accept tieunited stateswith garage chain fulfilling analyze garage partnered along insurance company topquality quickest claim resolution scenario coverage provider make absolute payment accomplice garage making extra convenient get vehicle repaired storage partnered together insurance issuer going need accomplish payment get bill done could get restoration expense reimbursed assurance provider repayment claim also filed case third party claim opposition case pay third party without delay could get compensation assurance provider reckoning phrase condition mentioned coverage listed collection question appear event filing vehicle insurance declare based character declare could appropriate publish file going ought observe step whereas filing claim amercement personal motor vehicle first need certain acquaint business boost sending automobile storage aliment company ship surveyor examine check amercement making le demanding get claim reimbursed insurance company get hold copy examiner’s file offering proof harm brought evaluation extent amercement second must fill put exact claim kind assurance provider accomplished online offline despite fact must ensure pas critical particular Third together form must submit requested document usually include copy riding authorization motor vehicle allotment certificate case theft toll road accident must also post duplicate FIR filed badge soon automobile repaired acquire bill post copy bill complement declare following examination analysis entire document assurance enterprise procedure declare reimburse amercement incurred case part blow brought injury rdbirthday celebration harm rdcelebration acreage could observe accomplish book declare iframe src”httpswwwfacebookcompluginspostphphrefhttps3A2F2Fwwwfacebookcom2Fsaktiutamaperkasa2Fposts2F10158341523701175showtexttruewidth500 width”500 height”590 style”bordernoneoverflowhidden” scrolling”no” frameborder”0 allowfullscreen”true” allow”autoplay clipboardwrite encryptedmedia pictureinpicture webshare”iframe acquaint insurance company quickly acquire declare note along additionally put registration certificate motor vehicle driving license FIR filed police insurer provide feature attorney soon document confirmed case go court found vulnerable pay damage insurer accomplish price account based sum insured automobile baseborn could choose right accomplish book declare assurance provider first quickly feasible lodge badge criticism book FIR soon accomplished send duplicate FIR assurance enterprise together also send duplicate final police report along allotment certificate soon file confirmed formality accomplished assurance company reimburse sum insured Accidents unexpected tend abash u accident item aid carry claim extra ease immediately investigate self vehicle damage keeping situation make decision even crave scientific counsel try note detail different birthday party case extra automobile concerned accident assist establish different celebration eventually possible lift bottomward contact detail witness within vicinity approve chronicle case entry companion garage would able choose cashless claim alternative affluence procedure insurer require claim aloft inside hour blow sure prolong preserve required file easy make certain declare receives candy soon feasible possessing vehicle amusement surely additionally responsibility crucial absolutely organized case accident complete automobile insurance option properly prepared additionally additionally essential well versed claim method get worried forget essential detail entering blow remember optimum make procedure easier assurance business balance claim capture possible step make certain file successful claim following adverse incident say time enhanced protected apologeticTags Lawyers Insurance Cars Claims Taxi Service
|
187,907 |
Why Become A Healthcare Lawyer Has Been So Popular Till Now?
|
Manziel Law Offices
Healthcare laws are used to regulate the healthcare system. The laws bridge the gap between medical practitioners and patients. The laws are intricately written to be understood by healthcare lawyers. If you need the services of healthcare lawyers, you need to go to law offices like Manziel Law Offices. There, you’ll meet healthcare lawyers like Lisa Manziel. Lisa Manziel has worked as a healthcare lawyer for thirty years plus. She works at Manziel law offices where she attends to her various clients.
Why Do We Need Healthcare Lawyers?
Healthcare lawyers have the option of working in only one field or work in several fields.
Adherence to Healthcare Laws:
Some health care providers do not obey the law governing medicine. Hence, there is a need to have enforcers enforce the rules with penalties given to rule breakers. For example, medical workers need to follow the HIPAA or risk being punished. The rules are written to protect the rights of providers and patients.
Representation of Clients in Court:
Healthcare lawyers represent providers that are sued by patients or patients that are sued by providers in court. They have the legal responsibility to represent their clients to the best of their abilities.
Why You Should Choose Healthcare Law as A Career
If your future goal is to be a healthcare lawyer, then you’ve chosen the right field. This profession is high in demand right now and requires competent workers due to its complex nature. You have to be hardworking, smart, think on your feet, and be devoted.
One of the duties of healthcare legal practitioners is to resolve any healthcare conflicts. They meet up with their clients and third-party. They make legal documentation and legal research when they want to handle cases.
Healthcare lawyers can work in private or government law offices and pharmacies. Some work with non-governmental organizations and healthcare policymakers.
Here are the reasons why you should consider healthcare lawyer as a career:
Work Independently:
As a healthcare lawyer, you won’t be restricted to one workplace. If you’ve worked for a long time and have a good reputation, you can establish your firm. You can become a CEO, employ other lawyers and earn profits. You can follow the legal trends and integrate them into your firm and get more money.
You Can Practice Anywhere:
Unlike other professionals where you have limitations, lawyers can practice anywhere. You may be in the UK and still practice in Germany. The only thing is that you have to write the bar exams and other qualifications of those places. Then you’d be legally qualified to practice there. You can also take online classes designed by those places to familiarise yourself with their rules.
Increased Need for Healthcare Lawyers:
Many healthcare organizations, providers, and private individuals are soliciting the services of a healthcare lawyer. This may be because they want affordable and excellent healthcare services. It may also be because many people are going for medical treatments now that they can afford them. There is much respect and care given to these lawyers due to their competency.
Contribute to The Society:
The majority of health care lawyers are dedicated and enthusiastic about their works. They want to help those who have been treated unfairly in the medical community. In a nutshell, they use their skills to contribute positively to society. Some help poor people and minority groups who have suffered medical injustice. They help them get compensation for the unfair treatment.
Uphold Medical Ethics:
Lawyers in the healthcare system ensure that providers adhere strictly to the rules. They want healthcare services to be efficiently and fairly delivered. If patients or providers are being exploited, it’s the lawyers’ job to use medical ethics to get justice. Illegal providers, bad healthcare facilities, and unprofessionalism are many issues healthcare lawyers deal with. Their influence can’t be overemphasized because of the positive changes they bring to the medical community.
The Job is Secured:
The profession is one of the highest-paying jobs with high demands out there. 80% of healthcare law graduates secured good jobs after graduation compared to other jobs. There are thousands of employment opportunities for medical law graduates. This is expected to increase by 7% in the next five years. As a lawyer, it’s better to specialize in the medical field and avail yourself of the numerous job openings.
High Income Rate:
As stated earlier, medical law practitioners are one of the highest-paid in the industry. The income is probably double the amount other professionals receive. The more work experience you have the more you get paid. Although, your wage is determined by the place or area you work.
Conclusion
Being a medical lawyer like Lisa Manziel is fulfilling especially if you work in reputable companies like Manziel Law offices. You get to do what you love, help out people, and earn money in the process.
|
https://medium.com/@newsknol/why-become-a-healthcare-lawyer-has-been-so-popular-till-now-c7e0d49369b
|
['News Knol']
|
2022-01-18 11:04:37.978000+00:00
|
['Lawyer', 'Law', 'Healthcare Laws', 'Lisa Manziel', 'Manziel Law Offices']
|
Title Become Healthcare Lawyer Popular Till NowContent Manziel Law Offices Healthcare law used regulate healthcare system law bridge gap medical practitioner patient law intricately written understood healthcare lawyer need service healthcare lawyer need go law office like Manziel Law Offices you’ll meet healthcare lawyer like Lisa Manziel Lisa Manziel worked healthcare lawyer thirty year plus work Manziel law office attends various client Need Healthcare Lawyers Healthcare lawyer option working one field work several field Adherence Healthcare Laws health care provider obey law governing medicine Hence need enforcer enforce rule penalty given rule breaker example medical worker need follow HIPAA risk punished rule written protect right provider patient Representation Clients Court Healthcare lawyer represent provider sued patient patient sued provider court legal responsibility represent client best ability Choose Healthcare Law Career future goal healthcare lawyer you’ve chosen right field profession high demand right requires competent worker due complex nature hardworking smart think foot devoted One duty healthcare legal practitioner resolve healthcare conflict meet client thirdparty make legal documentation legal research want handle case Healthcare lawyer work private government law office pharmacy work nongovernmental organization healthcare policymakers reason consider healthcare lawyer career Work Independently healthcare lawyer won’t restricted one workplace you’ve worked long time good reputation establish firm become CEO employ lawyer earn profit follow legal trend integrate firm get money Practice Anywhere Unlike professional limitation lawyer practice anywhere may UK still practice Germany thing write bar exam qualification place you’d legally qualified practice also take online class designed place familiarise rule Increased Need Healthcare Lawyers Many healthcare organization provider private individual soliciting service healthcare lawyer may want affordable excellent healthcare service may also many people going medical treatment afford much respect care given lawyer due competency Contribute Society majority health care lawyer dedicated enthusiastic work want help treated unfairly medical community nutshell use skill contribute positively society help poor people minority group suffered medical injustice help get compensation unfair treatment Uphold Medical Ethics Lawyers healthcare system ensure provider adhere strictly rule want healthcare service efficiently fairly delivered patient provider exploited it’s lawyers’ job use medical ethic get justice Illegal provider bad healthcare facility unprofessionalism many issue healthcare lawyer deal influence can’t overemphasized positive change bring medical community Job Secured profession one highestpaying job high demand 80 healthcare law graduate secured good job graduation compared job thousand employment opportunity medical law graduate expected increase 7 next five year lawyer it’s better specialize medical field avail numerous job opening High Income Rate stated earlier medical law practitioner one highestpaid industry income probably double amount professional receive work experience get paid Although wage determined place area work Conclusion medical lawyer like Lisa Manziel fulfilling especially work reputable company like Manziel Law office get love help people earn money processTags Lawyer Law Healthcare Laws Lisa Manziel Manziel Law Offices
|
187,908 |
5 Types of Damages in Motorcycle Accidents
|
There are over eight million motorcycles on America’s roads today, which means that accidents are not uncommon. Riders are more exposed to injury than drivers are since their body does not benefit from much protection from their vehicles.
Being involved in a motorcycle crash can have vast financial repercussions. However, victims can receive different types of damages to cover the financial losses they suffered due to the accident. The five main types of damages are medical expenses, property damage, pain and suffering, lost wages, and punitive damage.
Motorcycle Accidents Can Be Severe
The National Highway Traffic Safety Administration states that in 2019, the latest year with complete data, a total of 5,014 motorcyclists were killed, and an estimated 84,000 were injured. Around three-fourths of motorcycle accidents involve another vehicle, which explains why many have serious consequences.
One can easily see how a motorcycle weighing anywhere from 300 to 700 pounds would fare in a collision with a more than 3,000-pound passenger vehicle. Motorcyclists, if they survive a crash, may find themselves dealing with the effects of:
Head injuries
Neck and spine injuries
Broken limbs and ribs
Disfiguring injuries
It is crucial to seek immediate medical attention after a crash, even if you feel fine. Being involved in an accident is registered as a traumatic event by your body. Thus you might experience feeling physically and emotionally numb, not noticing some underlying injuries. The sooner you are diagnosed and receive treatment, the sooner you will recover.
Seeking Damages After a Motorcycle Accident
Perhaps you were recently involved in a motorcycle accident, incurred losses that your insurance policy can’t cover, and believe that the other party is responsible for the crash. In this case, you may pursue a personal injury claim against the at-fault party. A motorcycle injury lawyer can offer further legal guidance based on the specifics of your case.
1. Past and Future Medical Expenses
If a passenger vehicle collided with you, chances are that your injuries were severe, requiring surgery and other immediate, extensive treatments. Medical expenses that are compensable include:
Medical tests
Treatment
Medication
Physiotherapy
Hospitalization
In addition, you could seek reimbursement for any future medical expenses, such as the cost of pain medications or rehabilitative care that helps restore your cognitive and motor skills.
2. Property Damage
Your motorcycle, if still salvageable, likely needs repairs, and if you weren’t at fault, you don’t deserve to be saddled with that expense. This also falls under the damages you can seek in a personal injury claim. If the motorcycle was totaled, you could ask for an appropriate amount that would cover the cost of a replacement.
Let’s say that your motorcycle is your primary means of transportation and it had to undergo repairs; you may be eligible for loss of use compensation. This applies mostly in cases where injured drivers can’t get a rental car when their vehicle is in the shop. Otherwise, you are entitled to compensation for the cost of a rental.
3. Pain and Suffering
Besides the physical and material losses in an accident, which the experts can more or less quantify in terms of dollars, there is also the subjective harm that one experiences. Some motorcycle injuries can leave one with:
Lingering physical pain
Mental anguish
Anxiety
Traumatic brain injuries, arguably the most common injuries in motorcycle accidents, are known to cause chronic symptoms. Persistent post-concussive symptoms, as they’re called, can include headaches, seizures, and infections around the brain.
It is not unusual for motorcycle accident victims to suffer from post-traumatic stress disorder. Insomnia and a phobia of being out on the road may result as well.
Besides these, a successful claim could cover the loss of enjoyment of life that one incurs from, for instance, paralysis or the amputation of a limb. A more specific type of loss is called loss of consortium, where injuries affect the relationship between spouses. A claim could also take into account the emotional distress caused by facial scars and other kinds of disfigurement.
4. Lost Wages
Coping with your injuries and the temporary loss of transportation has probably led to you missing work. By filing a claim, you could seek out the wages you would have earned in the interim if the accident had never happened.
That is not all because many accident victims, even after recovery, find that they can’t work at the same capacity as before. Perhaps they lose their current job and are forced to enter another less strenuous field. This is referred to as loss of earning capacity. Professionals can estimate a good dollar amount for the loss based on your previous line of work, the sort of jobs you are limited to now, and how many more years you can be expected to work.
5. Punitive Damages
In some cases, especially road rage incidents, drivers may injure motorcyclists out of malice. Other times, drivers may cause a motorcycle accident due to reckless behavior, such as driving under the influence of drugs or alcohol.
When such harmful behavior is evident in an accident, victims have the possibility of suing for punitive damages. These are damages that go beyond compensation, being sought out to punish the defendant. One can seek punitive damages regardless of whether the defendant faces any corresponding criminal charge.
What a Motorcycle Injury Lawyer Can Do
While these are the main types of damages you could pursue in a personal injury lawsuit, not all of them might apply to your case. Moreover, even if they do apply, the amount you are eligible to receive may be curbed because of some fault on your part.
Many motorcycle accidents exhibit some degree of contributory negligence. For example, riding while under the influence or making reckless maneuvers could harm your claim. However, this is highly dependent on how your state handles liability.
These and other factors should convince any motorcycle accident victim not to pursue a claim alone. Consult with a lawyer, and you may get the professional opinion you need to determine if a personal injury claim is worthwhile.
|
https://medium.com/@sevenishlaw/5-types-of-damages-in-motorcycle-accidents-1df2c9634955
|
['Sevenish Law']
|
2021-12-31 09:34:42.076000+00:00
|
['Motorcycle', 'Attorney', 'Motorcycle Accident', 'Lawyers']
|
Title 5 Types Damages Motorcycle AccidentsContent eight million motorcycle America’s road today mean accident uncommon Riders exposed injury driver since body benefit much protection vehicle involved motorcycle crash vast financial repercussion However victim receive different type damage cover financial loss suffered due accident five main type damage medical expense property damage pain suffering lost wage punitive damage Motorcycle Accidents Severe National Highway Traffic Safety Administration state 2019 latest year complete data total 5014 motorcyclist killed estimated 84000 injured Around threefourths motorcycle accident involve another vehicle explains many serious consequence One easily see motorcycle weighing anywhere 300 700 pound would fare collision 3000pound passenger vehicle Motorcyclists survive crash may find dealing effect Head injury Neck spine injury Broken limb rib Disfiguring injury crucial seek immediate medical attention crash even feel fine involved accident registered traumatic event body Thus might experience feeling physically emotionally numb noticing underlying injury sooner diagnosed receive treatment sooner recover Seeking Damages Motorcycle Accident Perhaps recently involved motorcycle accident incurred loss insurance policy can’t cover believe party responsible crash case may pursue personal injury claim atfault party motorcycle injury lawyer offer legal guidance based specific case 1 Past Future Medical Expenses passenger vehicle collided chance injury severe requiring surgery immediate extensive treatment Medical expense compensable include Medical test Treatment Medication Physiotherapy Hospitalization addition could seek reimbursement future medical expense cost pain medication rehabilitative care help restore cognitive motor skill 2 Property Damage motorcycle still salvageable likely need repair weren’t fault don’t deserve saddled expense also fall damage seek personal injury claim motorcycle totaled could ask appropriate amount would cover cost replacement Let’s say motorcycle primary mean transportation undergo repair may eligible loss use compensation applies mostly case injured driver can’t get rental car vehicle shop Otherwise entitled compensation cost rental 3 Pain Suffering Besides physical material loss accident expert le quantify term dollar also subjective harm one experience motorcycle injury leave one Lingering physical pain Mental anguish Anxiety Traumatic brain injury arguably common injury motorcycle accident known cause chronic symptom Persistent postconcussive symptom they’re called include headache seizure infection around brain unusual motorcycle accident victim suffer posttraumatic stress disorder Insomnia phobia road may result well Besides successful claim could cover loss enjoyment life one incurs instance paralysis amputation limb specific type loss called loss consortium injury affect relationship spouse claim could also take account emotional distress caused facial scar kind disfigurement 4 Lost Wages Coping injury temporary loss transportation probably led missing work filing claim could seek wage would earned interim accident never happened many accident victim even recovery find can’t work capacity Perhaps lose current job forced enter another le strenuous field referred loss earning capacity Professionals estimate good dollar amount loss based previous line work sort job limited many year expected work 5 Punitive Damages case especially road rage incident driver may injure motorcyclist malice time driver may cause motorcycle accident due reckless behavior driving influence drug alcohol harmful behavior evident accident victim possibility suing punitive damage damage go beyond compensation sought punish defendant One seek punitive damage regardless whether defendant face corresponding criminal charge Motorcycle Injury Lawyer main type damage could pursue personal injury lawsuit might apply case Moreover even apply amount eligible receive may curbed fault part Many motorcycle accident exhibit degree contributory negligence example riding influence making reckless maneuver could harm claim However highly dependent state handle liability factor convince motorcycle accident victim pursue claim alone Consult lawyer may get professional opinion need determine personal injury claim worthwhileTags Motorcycle Attorney Motorcycle Accident Lawyers
|
187,909 |
Does it matter what a judge had for breakfast?
|
It’s eye-catching, isn’t it?
It’s hard not to do a double-take when encountering such a question. It’s even harder not to take a stab at an answer, even subconsciously.
So, why have I chosen this as the title of my latest blog post?
Firstly, to get your attention — this probably worked, since you are reading this sentence.
Secondly, and more importantly, to use it as an example of how to answer open-ended essay questions.
Please keep in mind that the exact same question was included in the general paper of the 2014 All Souls Examination Fellowship. Thought to be “the hardest exam in the world”, according to the Guardian, this exam has been … tormenting the brightest Oxford graduates for almost a century now.
So, how would one go about answering this question?
To begin with, the actual answer (yes or no, it matters or it doesn’t) is of no real significance, in the sense that your final answer per se doesn’t tell the examiner much about your analytical ability and your clarity of thought and expression. What matters is how you answer the question, i.e. how you break it down, identify its keywords, unravel its assumptions and construct a compelling argument.
So, here is the question again: does it matter what a judge had for breakfast?
Firstly, a bit of context. It is noteworthy that this is not a normative question. There is no “should it matter”, but simply “does it matter”. It is more of a descriptive/evaluative question. This question is actually based on an old adage that “justice is what the judge had for breakfast”, used mostly as a way of criticizing the legal realists’ school of thought. According to this school, the quality of judicial decision-making does not depend heavily on legal factors (case law, knowledge of the law, proper representation), but on non-legal factors, such as…judges’ postprandial mood.
Regardless of whether this is accurate or not, one must endeavour to answer it without any recourse to relevant research you might be unaware of (and yes, it exists), since, for the purposes of this exercise we are assuming that this is a closed-book exam and we are more interested in your way of arguing rather than your arguments per se.
So, what are the keywords in the essay question? I would assert that there are three: “matter”, “judge”, and “breakfast”. The keywords need to be defined by the examinee, in a reasonable manner. For instance, “does it matter” could be translated into “does it have an impact on judicial decision making”. A “judge” can reasonably limited to “normal” judges, i.e. members of the judiciary in a State, arbitrators and other individuals passing judgment being excluded. Finally, “breakfast” isn’t literally… breakfast but could (obviously) be lunch, if we are referring to an afternoon court session, and anything else that is non-legal and could arguably affect a judge’s disposition before entering the courtroom (e.g. a car accident, heavy traffic, arguing with their spouse etc.).
Moving on, following the essay-writing strategy I have detailed in my free PDF guide (you can get it by simply subscribing to this blog), you need to Paraphrase and Argue (PA). Paraphrase what? The question! How do you do that? By using synonyms to restate the question and show the reader you comprehend its meaning. A good attempt to paraphrase “does it matter what a judge had for breakfast?” could be: “The essay question invites us to consider whether non-legal factors such as postprandial mood affect a judge’s decision-making ability and/or the quality of her decisions”.
Then, you need to state your essay thesis. For instance, assuming you think it does matter, you can say: “In this essay, it is asserted that this does, in fact, matter”.
Paraphrase and Argue. That’s it. This is all you need for a succinct and complete introduction. The examiner/reader now knows two key things: she is going to read an essay that is not off topic (since you have shown that you have understood the question) and she knows where the essay is going, i.e. that you will be arguing in a particular direction.
There is a piece of advice that I received as a student in Oxford and which I will never forget: essays are not mystery novels! We don’t want to have to wait till the end to find out what’s going on. You are not Agatha Christie (although that would be cool, right?). State your argument from the beginning, so that the reader knows where this is going and can more easily follow…the plot.
Then, what is left is the main body of your essay and the conclusion. The purpose of your essay’s main body is to justify and substantiate the claim you made in your introduction. Why is it that you have taken this particular approach? What primary and secondary sources are you engaging with in order to make your case?
As for the conclusion, its purpose is to come full circle and complete what the introduction started. For instance, you can say: in this essay, it has been argued that non-legal factors such as postprandial mood do affect a judge’s decision-making ability and/or the quality of her decisions.
That’s it! Click submit and…enjoy your First Class mark J
On a more serious note, the purpose of this blog post was to demonstrate one of the many ways in which one can tackle open-ended essay questions. I hope it was interesting and fun.
Best wishes for the festive period to all readers and subscribers!
|
https://medium.com/@lawprof_6059/does-it-matter-what-a-judge-had-for-breakfast-9ae4b8550d71
|
['The Law Prof']
|
2021-12-24 14:26:53.794000+00:00
|
['Lawyers', 'Justice', 'Law', 'Law Student', 'Essay Writing']
|
Title matter judge breakfastContent It’s eyecatching isn’t It’s hard doubletake encountering question It’s even harder take stab answer even subconsciously chosen title latest blog post Firstly get attention — probably worked since reading sentence Secondly importantly use example answer openended essay question Please keep mind exact question included general paper 2014 Souls Examination Fellowship Thought “the hardest exam world” according Guardian exam … tormenting brightest Oxford graduate almost century would one go answering question begin actual answer yes matter doesn’t real significance sense final answer per se doesn’t tell examiner much analytical ability clarity thought expression matter answer question ie break identify keywords unravel assumption construct compelling argument question matter judge breakfast Firstly bit context noteworthy normative question “should matter” simply “does matter” descriptiveevaluative question question actually based old adage “justice judge breakfast” used mostly way criticizing legal realists’ school thought According school quality judicial decisionmaking depend heavily legal factor case law knowledge law proper representation nonlegal factor as…judges’ postprandial mood Regardless whether accurate one must endeavour answer without recourse relevant research might unaware yes exists since purpose exercise assuming closedbook exam interested way arguing rather argument per se keywords essay question would assert three “matter” “judge” “breakfast” keywords need defined examinee reasonable manner instance “does matter” could translated “does impact judicial decision making” “judge” reasonably limited “normal” judge ie member judiciary State arbitrator individual passing judgment excluded Finally “breakfast” isn’t literally… breakfast could obviously lunch referring afternoon court session anything else nonlegal could arguably affect judge’s disposition entering courtroom eg car accident heavy traffic arguing spouse etc Moving following essaywriting strategy detailed free PDF guide get simply subscribing blog need Paraphrase Argue PA Paraphrase question using synonym restate question show reader comprehend meaning good attempt paraphrase “does matter judge breakfast” could “The essay question invite u consider whether nonlegal factor postprandial mood affect judge’s decisionmaking ability andor quality decisions” need state essay thesis instance assuming think matter say “In essay asserted fact matter” Paraphrase Argue That’s need succinct complete introduction examinerreader know two key thing going read essay topic since shown understood question know essay going ie arguing particular direction piece advice received student Oxford never forget essay mystery novel don’t want wait till end find what’s going Agatha Christie although would cool right State argument beginning reader know going easily follow…the plot left main body essay conclusion purpose essay’s main body justify substantiate claim made introduction taken particular approach primary secondary source engaging order make case conclusion purpose come full circle complete introduction started instance say essay argued nonlegal factor postprandial mood affect judge’s decisionmaking ability andor quality decision That’s Click submit and…enjoy First Class mark J serious note purpose blog post demonstrate one many way one tackle openended essay question hope interesting fun Best wish festive period reader subscribersTags Lawyers Justice Law Law Student Essay Writing
|
187,910 |
How to Find a Good Lawyer in Toronto?
|
When it comes to finding a lawyer, you have options. If you have a court case looming on the horizon or if you’re trying to file for divorce, then the lawyer may be your best bet. On the other hand, if you just need some legal advice due to a contract dispute with a friend or family member, then the lawyer may not be the best option. In that case, hiring a solicitor might be more appropriate as they tend to work with smaller and less complicated cases than lawyers would.
The Complexity of the Case
Regardless of whether a lawyer or solicitor is better suited to represent your legal interests depends on what kind of issue it is and how complex it is. But there are certain things that will hold true no matter what — like both lawyer and solicitor must complete law degrees and pass professional examinations in order to be certified by the Law Society of Ontario. That is, they both must have a lawyer’s license.
In either case, it is always best to find a lawyer who specializes in your type of legal matter. For instance, if you need help with an injury claim then the lawyer will probably be able to provide better insight and more efficient services than a lawyer would since solicitors tend to deal with smaller legal matters that are less complex and require less specialization. However, if you’re going through a difficult divorce, a lawyer may be a better bet since they can handle more complicated cases involving children and large amounts of property division issues.
The Legal Needs
If you aren’t sure whether a lawyer or solicitor is right for your specific legal needs, the lawyer may be a better bet. As mentioned before, lawyers tend to work with a large range of different legal problems and have the experience that is necessary for dealing with complicated cases. If you need help with real estate law or if you’re going through bankruptcy proceedings, the lawyer would probably be able to offer more assistance than a solicitor would.
Real Estate Lawyers in Toronto
Finding the right real estate lawyer is like finding a needle in a haystack. The problem becomes worse when you’re looking for one that has an approach based on your needs and not just what their advertising says.
Toronto is filled with lawyers that deal in almost the majority of the properties. But, sometimes they are not who they are advertised as. It’s either the services that are problematic, the not-so transparent fee structure, or piling files on the desk, which might include yours.
All you need to find is a real estate law firm that has a client-centered philosophy that will make sure to take care of all aspects. It can be related to buying or selling property; including seeking legal advice if needed before signing any documents without hesitation.
Since real estate lawyer Toronto is trained in handling numerous types of cases, he/she will know all the different pitfalls that can come up during legal proceedings and will be well equipped to deal with them as they arise.
With a real estate lawyer, the rate of success varies depending on how promising your case seems to be. If the lawyer thinks that there’s little chance of winning the case, then they may decide not to take on the job.
If the lawyer decides to accept your case, the lawyer, who is also an attorney will represent you in court and may work closely with other legal professionals such as legal secretaries or paralegals who do most of the actual legwork of researching laws, collecting evidence, and filing motions with the court.
|
https://medium.com/@minigross85/how-to-find-a-good-lawyer-in-toronto-6b0d73b7c484
|
['Courtney Miller']
|
2021-12-28 10:59:02.076000+00:00
|
['Lawyers In Toronto', 'Types Of Lawyers', 'Law Firms In Toronto', 'Lawyer']
|
Title Find Good Lawyer TorontoContent come finding lawyer option court case looming horizon you’re trying file divorce lawyer may best bet hand need legal advice due contract dispute friend family member lawyer may best option case hiring solicitor might appropriate tend work smaller le complicated case lawyer would Complexity Case Regardless whether lawyer solicitor better suited represent legal interest depends kind issue complex certain thing hold true matter — like lawyer solicitor must complete law degree pas professional examination order certified Law Society Ontario must lawyer’s license either case always best find lawyer specializes type legal matter instance need help injury claim lawyer probably able provide better insight efficient service lawyer would since solicitor tend deal smaller legal matter le complex require le specialization However you’re going difficult divorce lawyer may better bet since handle complicated case involving child large amount property division issue Legal Needs aren’t sure whether lawyer solicitor right specific legal need lawyer may better bet mentioned lawyer tend work large range different legal problem experience necessary dealing complicated case need help real estate law you’re going bankruptcy proceeding lawyer would probably able offer assistance solicitor would Real Estate Lawyers Toronto Finding right real estate lawyer like finding needle haystack problem becomes worse you’re looking one approach based need advertising say Toronto filled lawyer deal almost majority property sometimes advertised It’s either service problematic notso transparent fee structure piling file desk might include need find real estate law firm clientcentered philosophy make sure take care aspect related buying selling property including seeking legal advice needed signing document without hesitation Since real estate lawyer Toronto trained handling numerous type case heshe know different pitfall come legal proceeding well equipped deal arise real estate lawyer rate success varies depending promising case seems lawyer think there’s little chance winning case may decide take job lawyer decides accept case lawyer also attorney represent court may work closely legal professional legal secretary paralegal actual legwork researching law collecting evidence filing motion courtTags Lawyers Toronto Types Lawyers Law Firms Toronto Lawyer
|
187,911 |
HyperDraft Hopes for 2022
|
2021 was a big year for HyperDraft. We onboarded users working within in-house legal departments, small and midsize law firms, and Big Law firms in various practice areas. We heard from our users how HyperDraft allowed them to produce their personal best output while allowing them to have a more flexible work schedule. We connected with hundreds of legal professionals and discussed current issues in the legal community during our continuing Fishbowl Live series. Lastly, our interactions with tired, hard-working attorneys during another busy year inspired us to continue to push forward on our mission to supply legal professionals with the modern tools they deserve.
We are excited about the changes we are starting to see within the legal industry. The modernization of law is happening now, and we cannot wait to see how it continues to evolve in the year to come.
Here are our hopes for what hopefully will be an innovative 2022.
Attorneys Realize that Legal Tech and the Billable Hour are Not Enemies
A common myth that can be a roadblock to Legal Tech adoption is the idea that the billable hour and Legal Tech are enemies. When talking to people about HyperDraft, we are often asked by attorneys if Legal Tech will make them so efficient that they will not be able to meet their billable hour requirement. Our answer always surprises them because they are so used to inefficiency in their day-to-day workflow that it is difficult for them to imagine anything else.
Legal Tech is not the enemy of the billable hour, in fact, when used correctly, it can lead to more billable work being done. Attorneys are so accustomed to working harder for the sake of working harder that they do not realize how routine, low-value work ruins their momentum, negatively impacts their work product, and increases their desire to procrastinate. By focusing on high-value work that is more rewarding, attorneys are more likely to maintain productivity, bill more, and scream at their computer screen less (yeah, we’ve done it too).
Legal Tech aims to automate low-value, routine tasks so technology can keep up with attorneys instead of attorneys having to slow down their process to accommodate out-of-date technology or manual tasks. When not slowed down by technology, attorneys can be more productive, provide more value to their clients, and have more energy and time to professionally develop.
Small and Mid-Size Law Firms Use Technology to Battle Big Law
Increasing costs, geographic flexibility inspired by the pandemic, and various other factors are leading in-house counsel and other clients to look at new options when looking for counsel. Greater client service and more affordable rates make small and mid-size firms look more attractive than ever as legal service providers.
With the evolution of Legal Tech, all attorneys now have access to modern tools that can help them do their work more efficiently and, in some cases, do the work of a larger team with fewer people. Legal Tech gives small and midsize firms the ability to level up their practice to battle Big Law and provide greater overall value to clients.
Hiring and retaining top legal talent is more difficult than ever and more attorneys are looking for work-life balance. The right combination of Legal Tech and lower billable hour requirements has the potential to make mid-size and smaller law firms ideal targets for overworked, talented associates and partners who are looking for a change once their bonuses hit their accounts in early Q1.
While the legal press mainly focuses on Big Law, small and midsize law firms are the unsung heroes of the legal profession. Most legal services in the U.S. are provided by them and their attention and quality of service makes a significant impact on the local economies and communities they serve. It is time for them to shine and receive the growth and recognition they deserve.
More Life is Lived Outside of the Billable Hour
Unfortunately for most attorneys, other than those lucky ducks in-house, the billable hour is a reality they must face head-on. However, the pandemic and the upswing in deals in 2021 has spotlighted the impact of burnout and the importance of mental health in the legal industry. Living a fuller life, inside and outside of work, has never been more important. That is why we are on a mission to bring modern tools to lawyers that can empower them to have a more flexible work schedule or just a lifeline when they are swamped and do not want to cancel plans … again
Life experience makes lawyers better counselors and problem solvers for their clients. It also inspires lawyers to develop and contribute to their communities. We hope that more attorneys will focus on working smarter and not harder so that they can be the best attorneys and humans they can be. Imagine a world full of happier, more productive attorneys? How fun would that be!
Bring on 2022!
HyperDraft is growing and we are just getting started. If you’d like to see HyperDraft in action, schedule a quick demo here. If you have any other questions about HyperDraft or Legal Tech, feel free to reach out to us at [email protected]. Chatting with legal professionals is one of our favorite things to do so don’t be shy! 🤗
This article is brought to you by HyperDraft. Our team of lawyers and engineers have developed tools that enable lawyers and other professionals to maximize their time and deliver greater value to their clients.
Click here to request access and learn more.
|
https://medium.com/@HyperDraftAI/hyperdraft-hopes-for-2022-24ab43f1b1f5
|
['Hyperdraft Ai']
|
2021-12-30 20:24:33.032000+00:00
|
['Lawyers', 'Legaltech', 'Law', 'Legal', 'Legal Services']
|
Title HyperDraft Hopes 2022Content 2021 big year HyperDraft onboarded user working within inhouse legal department small midsize law firm Big Law firm various practice area heard user HyperDraft allowed produce personal best output allowing flexible work schedule connected hundred legal professional discussed current issue legal community continuing Fishbowl Live series Lastly interaction tired hardworking attorney another busy year inspired u continue push forward mission supply legal professional modern tool deserve excited change starting see within legal industry modernization law happening cannot wait see continues evolve year come hope hopefully innovative 2022 Attorneys Realize Legal Tech Billable Hour Enemies common myth roadblock Legal Tech adoption idea billable hour Legal Tech enemy talking people HyperDraft often asked attorney Legal Tech make efficient able meet billable hour requirement answer always surprise used inefficiency daytoday workflow difficult imagine anything else Legal Tech enemy billable hour fact used correctly lead billable work done Attorneys accustomed working harder sake working harder realize routine lowvalue work ruin momentum negatively impact work product increase desire procrastinate focusing highvalue work rewarding attorney likely maintain productivity bill scream computer screen le yeah we’ve done Legal Tech aim automate lowvalue routine task technology keep attorney instead attorney slow process accommodate outofdate technology manual task slowed technology attorney productive provide value client energy time professionally develop Small MidSize Law Firms Use Technology Battle Big Law Increasing cost geographic flexibility inspired pandemic various factor leading inhouse counsel client look new option looking counsel Greater client service affordable rate make small midsize firm look attractive ever legal service provider evolution Legal Tech attorney access modern tool help work efficiently case work larger team fewer people Legal Tech give small midsize firm ability level practice battle Big Law provide greater overall value client Hiring retaining top legal talent difficult ever attorney looking worklife balance right combination Legal Tech lower billable hour requirement potential make midsize smaller law firm ideal target overworked talented associate partner looking change bonus hit account early Q1 legal press mainly focus Big Law small midsize law firm unsung hero legal profession legal service US provided attention quality service make significant impact local economy community serve time shine receive growth recognition deserve Life Lived Outside Billable Hour Unfortunately attorney lucky duck inhouse billable hour reality must face headon However pandemic upswing deal 2021 spotlighted impact burnout importance mental health legal industry Living fuller life inside outside work never important mission bring modern tool lawyer empower flexible work schedule lifeline swamped want cancel plan … Life experience make lawyer better counselor problem solver client also inspires lawyer develop contribute community hope attorney focus working smarter harder best attorney human Imagine world full happier productive attorney fun would Bring 2022 HyperDraft growing getting started you’d like see HyperDraft action schedule quick demo question HyperDraft Legal Tech feel free reach u infohyperdraftai Chatting legal professional one favorite thing don’t shy 🤗 article brought HyperDraft team lawyer engineer developed tool enable lawyer professional maximize time deliver greater value client Click request access learn moreTags Lawyers Legaltech Law Legal Legal Services
|
187,912 |
What Steps Should You Take After a Car Accident?
|
Accidents happen to the best of drivers. Even the most cautious of us can find ourselves in a car accident at some point or another. There are many different things to think about after a car accident. For example, did you know there is a time limit on reporting your accident? This article gives you an overview of what steps you need to take after a car accident. We also discuss your options if your car is totaled in the crash and how to get back on the road with the best coverage for your needs.
After the Crash
Whether or not you are at fault for the accident, there are some steps you should take right after the crash.
● Call 911. The first thing you should do is call 911. Call 911 first and then call your insurance company after receiving medical attention if someone is injured.
● Exchange information with the other driver(s). Get their names, phone numbers, license plate numbers, addresses, and insurance information before leaving the scene of an accident.
● Check for injury. If anyone gets hurt in the accident, check to see if they need help right away. Do not leave them unattended if they have been injured.
● Call your insurance company from a safe location only if it’s been less than 24 hours since the accident happened or if someone has been injured or killed in the crash. You can also file a claim online through your mobile device at any time of day or night following an auto accident.
Waiting at the scene of the accident
If you’re in an accident, it’s essential to stay at the scene for a few reasons. First, it’s the law. Second, if there are injuries involved, you’ll need to ensure they get help as soon as possible. It might seem like common sense, but you’d be surprised at how many people flee the scene of an accident. If someone is seriously injured or killed in an accident, call 911 and report it immediately.
Reporting the accident
If you are involved in a car accident, it’s essential to report the accident to the police as soon as possible. This is called reporting the incident to law enforcement.
According to state laws, this needs to be done within 10 days of the incident. If you don’t report the incident before both 10 days have passed and one year has gone by since the incident, then it becomes too late.
Some police departments might not take your report unless you go into the station in person. Be sure to ask them about this if they don’t seem keen on coming out to your location.
You should also note that some states require drivers involved in an accident to provide their driver’s license number, vehicle registration number, license plate number, or current address of residence. You may also need this information about your insurance coverage after an accident.
Gather all of your information
The first thing you need to do after an accident is to take care of yourself. This includes getting medical attention if necessary.
However, before you go, you must gather all the information that you’ll need to file a claim. You’ll want to get the other driver’s name and address to start. You may also enjoy their license plate number.
Additionally, be sure to take pictures of your damages and any injuries sustained at the time of the crash. If possible, get contact information for any witnesses or bystanders who may be able to attest to what happened.
Once you’ve gathered this data, it’s time to get out of the car and call for help if necessary. After that, call your insurance company — they will walk you through what needs to happen next!
What to do if your car is totaled?
After a car accident, one of the first things you’ll need is to determine your vehicle’s condition.
If your car has been totaled in the crash, you’ll have two options. You can either have your insurance company total your car or purchase a salvage title and fix it yourself.
If you decide to buy a salvage title, you’ll need to pay for repairs out-of-pocket. However, if you choose to have your insurance company total it, they will pay for the cost of repairing the damage done to the vehicle in exchange for giving them ownership of it.
Regardless of how you decide to go, you must take care of any outstanding debt on your vehicle and protect yourself with proper coverage after an accident.
Getting back on the road with the best coverage for your needs
The first thing to do after an accident is to stop. It’s essential to take time to evaluate your injuries and the damages on both sides of the crash. If you’re not injured, you mustn’t walk away from the scene of the crash.
If you are injured, then you must call emergency services for help. It would be best if you also were sure to get all of your personal information out on the table so that first responders can know who they’re helping at the scene.
Then, it’s time to contact your insurance company or agent right away if your car was in a collision. This will help determine if everything will be covered under your insurance policy and what steps to take next.
Conclusion
When it comes to car accidents, it’s easy to panic and not know what to do. But by following this guide and getting all the right coverage, you’ll be well-prepared to handle any incident that comes your way or you can consult a Houston car accident attorney.
|
https://medium.com/@dmillerlaw/what-steps-should-you-take-after-a-car-accident-c8beceb1d101
|
['D. Miller', 'Associates']
|
2021-12-30 22:30:56.897000+00:00
|
['Lawyers', 'Attorney', 'Car Accident Lawyer']
|
Title Steps Take Car AccidentContent Accidents happen best driver Even cautious u find car accident point another many different thing think car accident example know time limit reporting accident article give overview step need take car accident also discus option car totaled crash get back road best coverage need Crash Whether fault accident step take right crash ● Call 911 first thing call 911 Call 911 first call insurance company receiving medical attention someone injured ● Exchange information driver Get name phone number license plate number address insurance information leaving scene accident ● Check injury anyone get hurt accident check see need help right away leave unattended injured ● Call insurance company safe location it’s le 24 hour since accident happened someone injured killed crash also file claim online mobile device time day night following auto accident Waiting scene accident you’re accident it’s essential stay scene reason First it’s law Second injury involved you’ll need ensure get help soon possible might seem like common sense you’d surprised many people flee scene accident someone seriously injured killed accident call 911 report immediately Reporting accident involved car accident it’s essential report accident police soon possible called reporting incident law enforcement According state law need done within 10 day incident don’t report incident 10 day passed one year gone since incident becomes late police department might take report unless go station person sure ask don’t seem keen coming location also note state require driver involved accident provide driver’s license number vehicle registration number license plate number current address residence may also need information insurance coverage accident Gather information first thing need accident take care includes getting medical attention necessary However go must gather information you’ll need file claim You’ll want get driver’s name address start may also enjoy license plate number Additionally sure take picture damage injury sustained time crash possible get contact information witness bystander may able attest happened you’ve gathered data it’s time get car call help necessary call insurance company — walk need happen next car totaled car accident one first thing you’ll need determine vehicle’s condition car totaled crash you’ll two option either insurance company total car purchase salvage title fix decide buy salvage title you’ll need pay repair outofpocket However choose insurance company total pay cost repairing damage done vehicle exchange giving ownership Regardless decide go must take care outstanding debt vehicle protect proper coverage accident Getting back road best coverage need first thing accident stop It’s essential take time evaluate injury damage side crash you’re injured mustn’t walk away scene crash injured must call emergency service help would best also sure get personal information table first responder know they’re helping scene it’s time contact insurance company agent right away car collision help determine everything covered insurance policy step take next Conclusion come car accident it’s easy panic know following guide getting right coverage you’ll wellprepared handle incident come way consult Houston car accident attorneyTags Lawyers Attorney Car Accident Lawyer
|
187,913 |
When Should You Talk to a Lawyer After a Boat Accident?
|
If you were injured in a boating accident, familiarizing yourself with your rights and options is essential. Victims of accidents involving motorized boats or watercraft such as jet skis must know when they should contact a personal injury attorney after a boat accident. The initial idea of speaking to an attorney can be intimidating, so let’s see what you should consider before calling one. In this article, we’ll look at some reasons you should contact a lawyer after a boating accident and what to expect from the legal process.
1. You Were Injured
The obvious reason to call an attorney after a boat accident is if you suffered pain, injury, or disability. Any of these symptoms require evaluation by a medical professional. They will also be needed for court later on in the process.
2. You Think A Liable Party Is Responsible For Your Injury
If someone else caused your injuries through boating negligence, you must contact a lawyer as soon as possible. Presenting evidence of the defendant’s fault will be essential for building your case against them. Law enforcement officers are usually tasked with writing reports about accidents resulting from negligent behavior on boats, making their testimony important during trial proceedings. Once you can identify the liable party, dealing with insurance companies and filing a lawsuit becomes part of the next steps.
3. You Know Who The Defendant Is
When you know who is to blame for your injuries, it’s time to identify them and their insurance coverage. This can be done independently or by hiring a lawyer whose job will be to ensure that all information regarding the defendant and their insurance coverage is available to you. However, lawyers can sometimes do this legwork for you during free consultations, depending on the circumstances and other factors.
4. You Need Legal Assistance To Get Compensation For Your Injuries And Damages
Most people injured in boating accidents won’t need long-term legal representation, such as court procedures and negotiations with insurance companies (although your lawyer will need to be there if your case is taken to court). However, if you don’t know how to get compensation for your injuries or damages because the insurance company isn’t open to your demands, a boating accident attorney may help.
5. You Need Help Preparing For Trial Proceedings And Negotiations With Insurance Companies
If negotiations with the defendant’s insurance company end up in trial and if this is something that you can’t deal with on your own because of lack of knowledge and experience about such proceedings, then hiring a personal injury attorney becomes necessary. Your attorney will also be able to counsel and guide you through any legal process associated with being compensated for pain and suffering as well as medical bills from a defective product or boat design/maintenance issue.
6. You Need Legal Assistance Getting Your Medical Expenses Covered By Insurance Companies
Personal injury lawyers often will secure financial help for their client’s medical bills. Even if you don’t think you need legal assistance with your medical expenses, it’s always better to ask. With the right attorney on your side, you’re likely to get more reimbursement for expenses related to treatment and medication resulting from the accident. Personal injury lawyers are also skilled at representing people in court who need compensation for lost wages or disability that results from boating accidents.
7. You Were Threatened Or Harassed After The Accident
If someone threatened or harassed you after the boat accident, they must be held accountable for their actions. This is another instance in which legal help would be necessary.
8. Unclear Circumstances Are Surrounding The Accident
If any unclear circumstances surround the boat accident, it’s best to contact a lawyer. This may include seeking legal assistance if you were unable to take pictures of the scene, did not get the names and contact information of witnesses, or have any other evidence that could be helpful later on. A lawyer will also advise you on whether or not you should speak with insurance companies and what kind of statement you should or shouldn’t make.
9. You’re Worried About How To Handle All Of The Paperwork Alone
Even if you don’t think your case is serious, it’s important to keep all the paperwork. This includes medical records, bills, and other documents that will help your injury attorney build a case. Even if you’re not sure what you should do with these documents, it’s best to hand them over to a skilled attorney — they’ll know how to handle everything from start to finish.
10. You Want To Make Sure All Evidence Is Preserved And Not Lost
Personal injury attorneys are experienced in securing evidence that could be crucial for your case during the discovery phase. It may include preserving physical evidence such as skid marks on the boat surface or taking pictures of injuries. Personal injury lawyers also have lots of experience interviewing witnesses, so they can testify on your behalf in court if necessary.
11. You’re Ready To Take Your Case To Court
If you want to take your case to court, hiring a personal injury attorney is probably the best way to go. The last thing you want is your case to get thrown out because of some minor mistake that could have been prevented by an experienced lawyer who knows how these proceedings work. Just keep in mind that if you decide this route without legal support, it may be up to you to secure evidence and testimony from witnesses — which can become quite difficult without professional help.
12. You’ve Been Injured And Can’t Work
If you’ve been injured in a boat accident and can’t work, hiring a personal injury lawyer is the best way to ensure that you receive the financial support you need. This includes getting reimbursed for lost wages and securing funds for disability. Your attorney will also be able to help you if you need to take legal action against the person or company responsible for your injuries.
13. The Other Person Involved In The Accident Has A Lawyer
If the other person involved in the boat accident has a lawyer, it’s important to have one too. This is because the other side will likely try to negotiate a settlement out of court — something that may not be in your best interest. If you hire a lawyer, they can negotiate an agreement on your behalf that’s more likely to favor you.
14. You Want To Make Sure That The Other Party Doesn’t Try To Defraud Your Insurance Company
It’s not uncommon for people to try and defraud insurance companies by claiming more damages than they sustained in boat accidents. This is another reason why it’s important to have legal support — so something like this doesn’t occur during the settlement process. A lawyer will tell whether or not the other party is being truthful about their condition or trying to take advantage of the system.
Remember, these are not the only reasons to contact an attorney after a boating accident. The list provided is merely a guideline to help you decide whether or not you should seek legal assistance. If any other problems or concerns arise following your accident, it would be in your best interest to consult a maritime injury lawyer in Lafayette.
|
https://medium.com/@labordeearlesinjurylawyers/when-should-you-talk-to-a-lawyer-after-a-boat-accident-92da6d277736
|
['Laborde Earles Law Firm']
|
2021-12-30 22:43:22.505000+00:00
|
['Lawyers', 'Attorney', 'Boat Accident Attorney']
|
Title Talk Lawyer Boat AccidentContent injured boating accident familiarizing right option essential Victims accident involving motorized boat watercraft jet ski must know contact personal injury attorney boat accident initial idea speaking attorney intimidating let’s see consider calling one article we’ll look reason contact lawyer boating accident expect legal process 1 Injured obvious reason call attorney boat accident suffered pain injury disability symptom require evaluation medical professional also needed court later process 2 Think Liable Party Responsible Injury someone else caused injury boating negligence must contact lawyer soon possible Presenting evidence defendant’s fault essential building case Law enforcement officer usually tasked writing report accident resulting negligent behavior boat making testimony important trial proceeding identify liable party dealing insurance company filing lawsuit becomes part next step 3 Know Defendant know blame injury it’s time identify insurance coverage done independently hiring lawyer whose job ensure information regarding defendant insurance coverage available However lawyer sometimes legwork free consultation depending circumstance factor 4 Need Legal Assistance Get Compensation Injuries Damages people injured boating accident won’t need longterm legal representation court procedure negotiation insurance company although lawyer need case taken court However don’t know get compensation injury damage insurance company isn’t open demand boating accident attorney may help 5 Need Help Preparing Trial Proceedings Negotiations Insurance Companies negotiation defendant’s insurance company end trial something can’t deal lack knowledge experience proceeding hiring personal injury attorney becomes necessary attorney also able counsel guide legal process associated compensated pain suffering well medical bill defective product boat designmaintenance issue 6 Need Legal Assistance Getting Medical Expenses Covered Insurance Companies Personal injury lawyer often secure financial help client’s medical bill Even don’t think need legal assistance medical expense it’s always better ask right attorney side you’re likely get reimbursement expense related treatment medication resulting accident Personal injury lawyer also skilled representing people court need compensation lost wage disability result boating accident 7 Threatened Harassed Accident someone threatened harassed boat accident must held accountable action another instance legal help would necessary 8 Unclear Circumstances Surrounding Accident unclear circumstance surround boat accident it’s best contact lawyer may include seeking legal assistance unable take picture scene get name contact information witness evidence could helpful later lawyer also advise whether speak insurance company kind statement shouldn’t make 9 You’re Worried Handle Paperwork Alone Even don’t think case serious it’s important keep paperwork includes medical record bill document help injury attorney build case Even you’re sure document it’s best hand skilled attorney — they’ll know handle everything start finish 10 Want Make Sure Evidence Preserved Lost Personal injury attorney experienced securing evidence could crucial case discovery phase may include preserving physical evidence skid mark boat surface taking picture injury Personal injury lawyer also lot experience interviewing witness testify behalf court necessary 11 You’re Ready Take Case Court want take case court hiring personal injury attorney probably best way go last thing want case get thrown minor mistake could prevented experienced lawyer know proceeding work keep mind decide route without legal support may secure evidence testimony witness — become quite difficult without professional help 12 You’ve Injured Can’t Work you’ve injured boat accident can’t work hiring personal injury lawyer best way ensure receive financial support need includes getting reimbursed lost wage securing fund disability attorney also able help need take legal action person company responsible injury 13 Person Involved Accident Lawyer person involved boat accident lawyer it’s important one side likely try negotiate settlement court — something may best interest hire lawyer negotiate agreement behalf that’s likely favor 14 Want Make Sure Party Doesn’t Try Defraud Insurance Company It’s uncommon people try defraud insurance company claiming damage sustained boat accident another reason it’s important legal support — something like doesn’t occur settlement process lawyer tell whether party truthful condition trying take advantage system Remember reason contact attorney boating accident list provided merely guideline help decide whether seek legal assistance problem concern arise following accident would best interest consult maritime injury lawyer LafayetteTags Lawyers Attorney Boat Accident Attorney
|
187,914 |
What are the privileges of internal investigations in the UAE?
|
Senior administration, HR team, and consistent faculty of all enterprises and in a wide industry are approached against consistently with proof or charges of potential bad behavior at their organizations. These situations may extend from warning from the government for examination concerning claims of infringement of any government law by the partners or senior executives to a routine internal complaints of infringement of the worker policy or any other policies or rules established by the organization.
In many examples, the organization would be best served by directing some sort of inward examination concerning the charges. Be that as it may, choosing whether and how to direct an internal examination requires thought of an assortment of elements. Such factors regularly incorporate the nature of the organization, the particular lead or subject matter at issue, the material law, and, where suitable, the administration’s authorization needs. What’s more, in the occasion an inside examination is attempted, there are a number of choices that ought to be made at the beginning, including who should direct the examination, the objectives and parameters of the survey, and whether a report shall be composed or an oral warning shall be issued to the concerned.
Internal investigations are turning into an undeniably significant hazard management apparatus. While typically a reality discovering exercise, they likewise have a fundamental impact in an organization’s consistence with administrative commitments. Internal investigations are a decent method of building up to see potential dangers to the organization, regardless of whether they are moral or legitimate, and can uncover potential crook, common or administrative obligation. Therefore, Corporate Lawyers of Dubai have the urge to discuss the laws concerning internal investigations in UAE.
UAE law on Internal Investigations
In the event, the company is willing to conduct an internal investigations, Corporate Lawyers of Dubai suggest to consider several factors such as the following:
Whether conducting such investigation is a requisite of the law;
The severity of the violation or the misconduct;
Whether such violation leads to infringement of any legislation in the country;
Consequences of such investigation or benefits to the organization, if such investigation was conducted.
There is no specific law introduced by UAE and many other countries governing especially the subject of internal investigation as it majorly depend upon the type of misconduct and for that matter there are several provisions in different laws issued by the government in relation to the potential crimes that may be committed by the corporate organization or its employees. Having said that, UAE has issued Federal Law number 19 of 2016 (the Commercial Fraud Law) ensuring stricter penalties for natural or legal person attempted or actually committed corporate fraud. In addition, the country has issued Federal Law number 20 of 2018 (combatting money laundering and financial terrorism) as recently amended. Furthermore, to cover all other basic corporate crimes, the country has Federal Law number 2 of 1987 (the Penal Code) and Federal Law number 35 of 1992 (the Criminal Procedures Law).
Moreover, the country has certain specific free zones allowed to issue their tailor made corporate laws including DIFC and ADGM, however, the criminal laws are still applicable on the companies registered within these free-zones.
|
https://medium.com/@drhassanelhais/what-are-the-privileges-of-internal-investigations-in-the-uae-253f125b5c9c
|
['Dr Hassan Elhais']
|
2021-12-29 11:15:25.769000+00:00
|
['Lawyers', 'Lawyer In Dubai', 'Lawyers In Uae', 'Internal Investigation']
|
Title privilege internal investigation UAEContent Senior administration HR team consistent faculty enterprise wide industry approached consistently proof charge potential bad behavior organization situation may extend warning government examination concerning claim infringement government law partner senior executive routine internal complaint infringement worker policy policy rule established organization many example organization would best served directing sort inward examination concerning charge may choosing whether direct internal examination requires thought assortment element factor regularly incorporate nature organization particular lead subject matter issue material law suitable administration’s authorization need What’s occasion inside examination attempted number choice ought made beginning including direct examination objective parameter survey whether report shall composed oral warning shall issued concerned Internal investigation turning undeniably significant hazard management apparatus typically reality discovering exercise likewise fundamental impact organization’s consistence administrative commitment Internal investigation decent method building see potential danger organization regardless whether moral legitimate uncover potential crook common administrative obligation Therefore Corporate Lawyers Dubai urge discus law concerning internal investigation UAE UAE law Internal Investigations event company willing conduct internal investigation Corporate Lawyers Dubai suggest consider several factor following Whether conducting investigation requisite law severity violation misconduct Whether violation lead infringement legislation country Consequences investigation benefit organization investigation conducted specific law introduced UAE many country governing especially subject internal investigation majorly depend upon type misconduct matter several provision different law issued government relation potential crime may committed corporate organization employee said UAE issued Federal Law number 19 2016 Commercial Fraud Law ensuring stricter penalty natural legal person attempted actually committed corporate fraud addition country issued Federal Law number 20 2018 combatting money laundering financial terrorism recently amended Furthermore cover basic corporate crime country Federal Law number 2 1987 Penal Code Federal Law number 35 1992 Criminal Procedures Law Moreover country certain specific free zone allowed issue tailor made corporate law including DIFC ADGM however criminal law still applicable company registered within freezonesTags Lawyers Lawyer Dubai Lawyers Uae Internal Investigation
|
187,915 |
Why It’s Important to Talk to a Lawyer After an Accident
|
According to the National Highway Traffic Safety Administration, over two million people sustain injuries from vehicle injuries every year. If you are one of the two million victims, your first step should be to call the police and contact a personal injury attorney.
Insurance companies are rich, with the industry having assets worth trillions of dollars. In fact, they will do anything to avoid paying fair settlements to victims to make profits. You have a higher chance of getting the full settlement from the insurance company when you hire an attorney immediately after the accident. That is just one of the many advantages of working with a skilled car accident lawyer.
Meet Legal Deadlines
After an auto accident, there are several deadlines to meet. The main deadline is the state’s statute of limitations, which is typically two years for personal injury cases. However, it is important to note that this limit varies between states. Statute of limitations refers to the set time within which you should file a personal injury case in a trial court.
Furthermore, this deadline is subject to exceptions, and unless you know the law really well, the insurance company can use these exceptions to deny you a settlement. Make sure to consult your lawyer for an exact deadline.
Besides filing the case, some insurance policies require that you notify your insurer as soon as the accident occurs or immediately after. You will find such deadlines in inexpensive auto insurance policies.
If the accident involves a government entity, you have to send an “ante litem” notice (notice to the defendant that you intend to sue) before you can file a case. In most cases, the deadline is between six months and a year.
If you were severely injured, you may not have the physical ability to file the case or notice, and thus, you may not access compensation. Lawyers know which deadlines to meet, and they will help as you recover from the accident.
Preserve Evidence
It is easier to collect evidence immediately after the accident. For instance, surveillance footage from a business near the crash site may only be available for a few days or weeks. Your lawyer can obtain the video footage before the business deletes it, but you have to act fast.
You also need roadway evidence to prove who was at fault. The evidence includes car accident debris, skid marks, and wheel gauges. These marks can show what or who caused the accident. This evidence helps prove the driver who was on the wrong and can only be collected from the scene of the accident.
If the evidence is not recorded a day or a few days after the accident, weather and traffic can destroy it. You will need an accident reconstruction professional to recreate the scenario that led to the accident.
Accident reconstruction experts use vehicle 3D scans to recreate accident scenarios. Photos of the vehicles before repairs or crushing can also help determine who was at fault. If you wait for a few weeks, the at-fault driver could repair their car, and it will be more difficult for you to prove your case.
Get Immediate Medical Treatment
Do you have health insurance? If you do, it might be easy to get the medical attention you need after an accident. However, without medical insurance, the local emergency clinic may not offer the care you need. In that case, a personal injury lawyer serving in Fort Lauderdale will point you towards the best course of action.
Preserve Witness Accounts
It is easy to get witnesses who are willing to give an account of what happened immediately after an accident. However, a few days following the accident, some witnesses’ memories fade while others lose interest in testifying. An attorney can write a statement that preserves the memory of the witness.
Beat Insurance Company Tricks
Insurance companies are willing to resort to tricks to avoid paying high settlements to injured people. Remember that agents represent the agency’s interest and not that of the client. Some of the tricks they commonly employ include:
Delaying the settlement
Denying you a settlement after your health insurance or workers’ compensation policy covers the medical bills
Under-counting medical bills
Claiming that the car accident did not cause the injuries you have sustained (the causation defense)
Collect evidence to show that you are partly or fully at fault
Pressure you to talk to them before contacting an accident attorney
Request that you give a recorded account of the scenario that led to the accident
Pretend to be concerned about your health just to pay a cheap settlement
Dispute severity of the injuries from the accident
Claim your car insurance coverage is less than you have
Deny your claim settlement outright
Insurance companies make profits by denying people’s claims or reducing the value of the settlement. For instance, when they delay your settlement, they are hoping you will grow impatient and accept a lower amount than you deserve.
As the bills mount pressure on you, they will try convincing you to settle for a low amount. Again, the delays might see you lose the chance to file a case as the statute of limitations deadline catches up with you.
As you wait, an insurance agent may keep asking for medical documents for review, and they may even send you money to pay for the car repair. All the while, they will show you how willing they are to close your case to make you avoid hiring a lawyer.
Lawyers know the tricks used by these companies. If the insurance company agent tries talking you out of contacting an attorney, that should be reason enough to get one. They will know when the insurance company is spying on you and stop their tricks.
The Bottom Line
Most injury attorneys will not charge you for initial consultations. It is common practice to work on a contingency fee basis. This means that they only get paid after winning a case. The immense experience and the ability to see the insurance company’s tricks make attorneys a valuable asset in dealing with the aftermath of a traffic accident.
|
https://medium.com/@galepchilders/why-its-important-to-talk-to-a-lawyer-after-an-accident-523df7bb46de
|
['Chalik Law']
|
2021-12-30 22:26:20.356000+00:00
|
['Lawyers', 'Accident']
|
Title It’s Important Talk Lawyer AccidentContent According National Highway Traffic Safety Administration two million people sustain injury vehicle injury every year one two million victim first step call police contact personal injury attorney Insurance company rich industry asset worth trillion dollar fact anything avoid paying fair settlement victim make profit higher chance getting full settlement insurance company hire attorney immediately accident one many advantage working skilled car accident lawyer Meet Legal Deadlines auto accident several deadline meet main deadline state’s statute limitation typically two year personal injury case However important note limit varies state Statute limitation refers set time within file personal injury case trial court Furthermore deadline subject exception unless know law really well insurance company use exception deny settlement Make sure consult lawyer exact deadline Besides filing case insurance policy require notify insurer soon accident occurs immediately find deadline inexpensive auto insurance policy accident involves government entity send “ante litem” notice notice defendant intend sue file case case deadline six month year severely injured may physical ability file case notice thus may access compensation Lawyers know deadline meet help recover accident Preserve Evidence easier collect evidence immediately accident instance surveillance footage business near crash site may available day week lawyer obtain video footage business deletes act fast also need roadway evidence prove fault evidence includes car accident debris skid mark wheel gauge mark show caused accident evidence help prove driver wrong collected scene accident evidence recorded day day accident weather traffic destroy need accident reconstruction professional recreate scenario led accident Accident reconstruction expert use vehicle 3D scan recreate accident scenario Photos vehicle repair crushing also help determine fault wait week atfault driver could repair car difficult prove case Get Immediate Medical Treatment health insurance might easy get medical attention need accident However without medical insurance local emergency clinic may offer care need case personal injury lawyer serving Fort Lauderdale point towards best course action Preserve Witness Accounts easy get witness willing give account happened immediately accident However day following accident witnesses’ memory fade others lose interest testifying attorney write statement preserve memory witness Beat Insurance Company Tricks Insurance company willing resort trick avoid paying high settlement injured people Remember agent represent agency’s interest client trick commonly employ include Delaying settlement Denying settlement health insurance workers’ compensation policy cover medical bill Undercounting medical bill Claiming car accident cause injury sustained causation defense Collect evidence show partly fully fault Pressure talk contacting accident attorney Request give recorded account scenario led accident Pretend concerned health pay cheap settlement Dispute severity injury accident Claim car insurance coverage le Deny claim settlement outright Insurance company make profit denying people’s claim reducing value settlement instance delay settlement hoping grow impatient accept lower amount deserve bill mount pressure try convincing settle low amount delay might see lose chance file case statute limitation deadline catch wait insurance agent may keep asking medical document review may even send money pay car repair show willing close case make avoid hiring lawyer Lawyers know trick used company insurance company agent try talking contacting attorney reason enough get one know insurance company spying stop trick Bottom Line injury attorney charge initial consultation common practice work contingency fee basis mean get paid winning case immense experience ability see insurance company’s trick make attorney valuable asset dealing aftermath traffic accidentTags Lawyers Accident
|
187,916 |
Procedure to Change Your Lawyer In the Middle of a Case
|
Procedure to Change Your Lawyer In the Middle of a Case legalnow.org Follow Jul 26, 2016 · 3 min read
Lawyer Change
In any kind of civil case, the lawyer-client relationship is multi-dimensional: part business agreement, part exercise in teamwork, and part close relationship requiring the divulging and maintaining of sensitive confidential information.
In all of its aspects, this relationship is founded upon mutual trust, and when that trust is broken it is difficult (if not impossible) for the lawyer and client to continue to work together.
What are the important considerations while changing your lawyer?
The fact that a client is free to change lawyer mid-case does not necessarily mean that it is wise to do so. The client should think about the below mentioned questions before thinking of changing the lawyer:
whether the existing lawyer-client relationship can be repaired so as to allow continuing representation.
whether the new lawyer will require a retainer, and if so, how much that will cost
how much time and effort it will take the new lawyer to get up to speed in the case
How the lawsuit gets affected by this change?
In ordinary circumstances, the new lawyer will ask for a substantial retainer, which will add to the client’s overall legal fees which as a client one would not prefer adding up more and more fees payment towards lawyers on the other hand not getting any good results.
Since replacing a lawyer mid-case can be costly and stressful, you may want to do some soul searching to figure out why the relationship has deteriorated, and what, if any, steps can be taken to salvage it. Therefore it is better to improve the misunderstandings your lawyer by more discussions unless and until the reason for the abandonment is a major flaw in the lawyer. Nevertheless, below is the procedure to change your lawyer in the midst of a case.
Procedure to change your lawyer
At the initiation of a lawsuit, the pleader has to file to the Court a duly signed written document by the client, which is termed as a Vakalatnama.
At the very first instance after being dissatisfied with the lawyer, the client should try and resolve the issue amicably. If it is not resolved then he might ask for a No Objection Certificate (NOC) from the advocate on the Vakalatnama or on other documents related to the case.
There may be cases when the advocate does not agree to give a NOC, then the person can issue a notice of termination to the advocate and apply to the court for withdrawal of Vakalatnama.
O rder 3 of Civil Procedure Code gives aggrieved persons the right to choose one’s pleader. Therefore changing of pleader with the leave of the Court is possible. The new pleader should submit a duly signed Vakalatnama to the court. Hence it is possible to change one’s pleader. In a few cases problem arises with the case history. If the pleader fails to give it to the client, the client can apply for the order sheet by an application to the Court.
About the Author
This article has been authored by Rudraksh Durrani, Intern at LegalNow.
|
https://medium.com/legalnow/procedure-to-change-your-lawyer-in-the-middle-of-a-case-6e8aa3af4c19
|
[]
|
2016-07-28 11:55:45.204000+00:00
|
['Advocate', 'Lawyer', 'Legal', 'Attorney', 'Lawyer Change']
|
Title Procedure Change Lawyer Middle CaseContent Procedure Change Lawyer Middle Case legalnoworg Follow Jul 26 2016 · 3 min read Lawyer Change kind civil case lawyerclient relationship multidimensional part business agreement part exercise teamwork part close relationship requiring divulging maintaining sensitive confidential information aspect relationship founded upon mutual trust trust broken difficult impossible lawyer client continue work together important consideration changing lawyer fact client free change lawyer midcase necessarily mean wise client think mentioned question thinking changing lawyer whether existing lawyerclient relationship repaired allow continuing representation whether new lawyer require retainer much cost much time effort take new lawyer get speed case lawsuit get affected change ordinary circumstance new lawyer ask substantial retainer add client’s overall legal fee client one would prefer adding fee payment towards lawyer hand getting good result Since replacing lawyer midcase costly stressful may want soul searching figure relationship deteriorated step taken salvage Therefore better improve misunderstanding lawyer discussion unless reason abandonment major flaw lawyer Nevertheless procedure change lawyer midst case Procedure change lawyer initiation lawsuit pleader file Court duly signed written document client termed Vakalatnama first instance dissatisfied lawyer client try resolve issue amicably resolved might ask Objection Certificate NOC advocate Vakalatnama document related case may case advocate agree give NOC person issue notice termination advocate apply court withdrawal Vakalatnama rder 3 Civil Procedure Code give aggrieved person right choose one’s pleader Therefore changing pleader leave Court possible new pleader submit duly signed Vakalatnama court Hence possible change one’s pleader case problem arises case history pleader fails give client client apply order sheet application Court Author article authored Rudraksh Durrani Intern LegalNowTags Advocate Lawyer Legal Attorney Lawyer Change
|
187,917 |
Some Significant Reasons To Hire A Lawyer To Fight Your Speeding Ticket Charge
|
Like most of the people, even you might think that speeding or traffic tickets are minor nuisances that you can handle on your own. Well, hate to burst your bubble but the reality is a whole lot different. A speeding ticket has the tendency to have several negative consequences and if you admit to being guilty then it might even end up costing you way more money than hiring an aggressive defense lawyer to fight for you.
Now, there are various law firms that have attorneys available for all kinds of charges, and a speeding ticket charge is no exception. The professional speeding ticker lawyers in Missouri tend to help various drivers regularly avoid the expense and hassle that are involved with speeding tickets. Still, you might feel like you have got the situation under control and don’t need help from a lawyer. Well, the following are some of the reasons why you should hire a speeding ticket lawyer instead of admitting guilt for the charge.
· A speeding ticket might be more expensive:
If you admit guilt for speeding, you are likely to end up paying much more than just the fine. You can also expect to see your insurance premiums inflate for the next few years, and end up paying thousands of dollars more in total. If that’s not enough, you can even receive a much larger increase for a reckless driving ticket. So, the cost of hiring a lawyer is way more reasonable in comparison. However, not every other case requires a lawyer, so determine if your particular case warrants a lawyer’s help or not.
· You live in a different state:
If you don’t live in the state where you received your speeding ticket, then it can be quite the hassle to drive back and forth in order to appear in court. Think about the cost of gas you would have to pay, missed work, childcare expenses, and so on. Fortunately enough for you, if you hire a speeding ticket lawyer, they can appear in the court on your behalf in most of the cases, and you would not have to worry about driving back to that state.
· Get the best deal possible:
If you are facing a reckless driving case or other similar misdemeanors, then there is a chance that you can get it to plead down to a traffic citation. But, only a handful of people are skillful and knowledgeable enough to do this effectively. You should not expect the government to help you in such cases too. So, your best bet is to hire an experienced lawyer to help with your case.
Mentioned above were just some of the significant reasons you should hire a speeding ticket lawyer for your case. However, it is important that you find a reliable and experienced attorney to handle your speeding ticket charge if you want to get away with it.
|
https://medium.com/@joseph_jacob/some-significant-reasons-to-hire-a-lawyer-to-fight-your-speeding-ticket-charge-ce3cb6af9f48
|
['Attorney Joseph Jacob Esther']
|
2021-12-27 15:15:47.281000+00:00
|
['Lawyers', 'Attorneys']
|
Title Significant Reasons Hire Lawyer Fight Speeding Ticket ChargeContent Like people even might think speeding traffic ticket minor nuisance handle Well hate burst bubble reality whole lot different speeding ticket tendency several negative consequence admit guilty might even end costing way money hiring aggressive defense lawyer fight various law firm attorney available kind charge speeding ticket charge exception professional speeding ticker lawyer Missouri tend help various driver regularly avoid expense hassle involved speeding ticket Still might feel like got situation control don’t need help lawyer Well following reason hire speeding ticket lawyer instead admitting guilt charge · speeding ticket might expensive admit guilt speeding likely end paying much fine also expect see insurance premium inflate next year end paying thousand dollar total that’s enough even receive much larger increase reckless driving ticket cost hiring lawyer way reasonable comparison However every case requires lawyer determine particular case warrant lawyer’s help · live different state don’t live state received speeding ticket quite hassle drive back forth order appear court Think cost gas would pay missed work childcare expense Fortunately enough hire speeding ticket lawyer appear court behalf case would worry driving back state · Get best deal possible facing reckless driving case similar misdemeanor chance get plead traffic citation handful people skillful knowledgeable enough effectively expect government help case best bet hire experienced lawyer help case Mentioned significant reason hire speeding ticket lawyer case However important find reliable experienced attorney handle speeding ticket charge want get away itTags Lawyers Attorneys
|
187,918 |
Why Your Law Firm Needs to Invest in Social Media Marketing in 2022
|
In the last few years, social media marketing has matured and become a leading form of marketing for all different kinds of industries, especially law. Social media marketing is one of the most efficient and cost effective ways to market your firm. Social media will save your firm if you let it. Here’s how.
Attention
Social media is the biggest growing area of digital marketing and return on investment can be 100 times compared to other forms of marketing, even online marketing. Every day, you and many you love spend hours and hours deep in the social feeds. Engagement on social media is better than any other form of advertising. The feed is designed to pull you in and give you a dopamine rush every time someone likes, comments, or share something that you post.
Attention has shifted from television to social media. Instead of wasting money on TV ads, radio ads, and billboards, why not meet your consumers where they are — social media.
Easy and Cost Effective
One of the things that is great about social is that it is perhaps the lowest barrier to entry of all the digital marketing products. The platforms themselves are free. There are plenty of free resources to use to make your social marketing pop. You could spend as much or as little as you want on social media marketing, making it accessible to all, no matter what stage your firm is at, what your budget is, or what your needs are.
And because it is essentially talking to people that you already know, it is very natural to post things in your own voice. You don’t need to hire an expensive consultant or set aside hundreds or thousands of dollars to be able to compete in social media. And one of the things I like the best about social is that it can be accomplished in just a few minutes every day, not hours. You can literally post for about five minutes in the morning and then engage when you have some downtime or within five minutes at night and slowly build up your existing network to think of you first when they or someone they know has a legal problem that you can solve.
Data
One of the amazing things about social media is the unbelievably detailed data they have on you. Everything you do online is tracked, and this means you can identify the people you want to target and build relationships with them so that you are that top-of-mind lawyer. Think of anything that is unique to your target audience and you can find them and their cohort on social. And by engaging with them and giving them the type of content that they like, you can be the competent lawyer that they know, like, and trust.
What Makes Social Media So Great?
For lawyers reluctant to jump into digital marketing because they have been burned before by unscrupulous salesmen preying on their naiveté, social media marketing truly is most like the traditional methods of marketing employed by lawyers over the last century or more. The role of lawyers has always been to connect with people and offer knowledge and guidance. It is natural to look to lawyers as social connectors, and they do it every day with cross-referrals to other lawyers in other concentrations. If you think about your best clients and your best cases, I would hazard to bet that your absolute best cases have come by way of a personal relationship of some kind.
The wonderful thing about social media is that by using it, you can become the person who people know, like, and trust. People will want to send business to you. And that’s the goal of all of us every day who want to be the best at our craft. We want people to know us, to like us, and to trust us because you might be the best lawyer, but if nobody knows you, you starve.
Branding is the way of the future, and branding is easy with social media. Brands give a person confidence, brands give a searcher solace, brands allow people to feel like they are making the right decision because of the social proof others accord them since other people buy into the same brand. And if you don’t like the word brand, think reputation. This is the one reason online reviews are so vitally important in the modern legal economy.
The reality is in that situation where you have a limited time to make a decision and limited resources to do so, the brand or reputation you have becomes the safest choice for people to make.
At the end of the day, with every marketing tactic, you should heed this message because by doing so, you put yourself in a position to always be remembered. How many times have you run into someone you know and haven’t seen in a while and been told, “oh, darn, I forgot you were a lawyer, my so-and-so needed a lawyer for almost exactly what you do and we didn’t know where to send her, so she just Googled someone”? By having a strong social presence and connecting with your network, you can avoid this terrible thing from happening to you ever again.
These are a few of the many advantages that a social media presence has for lawyers. By working with your community in a space that already has their attention and utilizing platforms that do not require a lot of time or money, you can influence and compete in your community in a new way. For help with implementing a social media marketing plan, check out www.getfirmflex.com.
|
https://medium.com/@getfirmflex/why-your-law-firm-needs-to-invest-in-social-media-marketing-in-2022-f804e00101ee
|
['Jen Sanfilippo']
|
2021-12-23 20:32:58.127000+00:00
|
['Lawyers', 'Social Media Marketing', 'Marketing', 'Law', 'Social Media']
|
Title Law Firm Needs Invest Social Media Marketing 2022Content last year social medium marketing matured become leading form marketing different kind industry especially law Social medium marketing one efficient cost effective way market firm Social medium save firm let Here’s Attention Social medium biggest growing area digital marketing return investment 100 time compared form marketing even online marketing Every day many love spend hour hour deep social feed Engagement social medium better form advertising feed designed pull give dopamine rush every time someone like comment share something post Attention shifted television social medium Instead wasting money TV ad radio ad billboard meet consumer — social medium Easy Cost Effective One thing great social perhaps lowest barrier entry digital marketing product platform free plenty free resource use make social marketing pop could spend much little want social medium marketing making accessible matter stage firm budget need essentially talking people already know natural post thing voice don’t need hire expensive consultant set aside hundred thousand dollar able compete social medium one thing like best social accomplished minute every day hour literally post five minute morning engage downtime within five minute night slowly build existing network think first someone know legal problem solve Data One amazing thing social medium unbelievably detailed data Everything online tracked mean identify people want target build relationship topofmind lawyer Think anything unique target audience find cohort social engaging giving type content like competent lawyer know like trust Makes Social Media Great lawyer reluctant jump digital marketing burned unscrupulous salesman preying naiveté social medium marketing truly like traditional method marketing employed lawyer last century role lawyer always connect people offer knowledge guidance natural look lawyer social connector every day crossreferrals lawyer concentration think best client best case would hazard bet absolute best case come way personal relationship kind wonderful thing social medium using become person people know like trust People want send business that’s goal u every day want best craft want people know u like u trust u might best lawyer nobody know starve Branding way future branding easy social medium Brands give person confidence brand give searcher solace brand allow people feel like making right decision social proof others accord since people buy brand don’t like word brand think reputation one reason online review vitally important modern legal economy reality situation limited time make decision limited resource brand reputation becomes safest choice people make end day every marketing tactic heed message put position always remembered many time run someone know haven’t seen told “oh darn forgot lawyer soandso needed lawyer almost exactly didn’t know send Googled someone” strong social presence connecting network avoid terrible thing happening ever many advantage social medium presence lawyer working community space already attention utilizing platform require lot time money influence compete community new way help implementing social medium marketing plan check wwwgetfirmflexcomTags Lawyers Social Media Marketing Marketing Law Social Media
|
187,919 |
Misconceptions About Divorce in Brampton
|
Most people do not expect to get divorced while getting married and therefore never verify the myths regarding divorces. Following are some of the top misconceptions about divorces in Brampton.
Mother Gets Custody Always
People always assume child custody will naturally go to mothers in the event of a divorce. But this is not true. In a lot of cases, mothers do win the right to child custody. But this has nothing to do with being a mother, rather it is because the mother has been the primary caregiver to the child. Therefore fathers could also get full or joint custody.
You Could Speed Up the Process
You can do a lot of things to fasten up the divorce process with some help from a good family lawyer and if you and your partner can come to an agreement regarding the arrangements of the divorce. But this is not a guarantee. Since there is a high chance of disagreement when it comes to details of these arrangements, especially in financial arrangements after the divorce. Therefore things could slow down.
Lawyers Make Everything Complicated
Lawyers could make things more complicated. But this is not always true. If it happens it’s just an unintentional side effect. When you are getting a divorce in Brampton, family lawyers are your greatest aid. They can guide you through the divorce. Therefore you are better off with a lawyer right from the beginning of the separation. You can avoid any unwanted delay in the process with their counsel.
Common Law Relationships and Traditional Marriages are Same Under Law
One might think the law doesn’t distinguish between a traditional marriage and a common law relationship. But this couldn’t be more wrong. The law clearly distinguishes between these two and therefore has a different approach to divorce cases in both these matters. The rights of partners in common law relationships are limited when compared to the couples who got married traditionally. Therefore they aren’t the same under the law.
A Cheated Spouse Will Be Favored
People might think that in cases where a partner was cheated, the one who got cheated would be favored and the one who cheated would not be favored when it comes to divorce. This is another misconception. It has nothing to do with divorce laws even though adultery is considered a valid reason for seeking a divorce. Consulting a family lawyer in Brampton could give more clarity on this.
It is always a good idea to get your facts right. Making the mistake of taking decisions based on any one of these misconceptions could cost your time and money.
|
https://medium.com/@sachdevamilne/misconceptions-about-divorce-in-brampton-5adf06d94b3b
|
['Sachdeva Milne Law Group']
|
2021-12-28 15:41:36.837000+00:00
|
['Lawyers', 'Divorce', 'Divorce Lawyer', 'Family Lawyer', 'Family Law']
|
Title Misconceptions Divorce BramptonContent people expect get divorced getting married therefore never verify myth regarding divorce Following top misconception divorce Brampton Mother Gets Custody Always People always assume child custody naturally go mother event divorce true lot case mother win right child custody nothing mother rather mother primary caregiver child Therefore father could also get full joint custody Could Speed Process lot thing fasten divorce process help good family lawyer partner come agreement regarding arrangement divorce guarantee Since high chance disagreement come detail arrangement especially financial arrangement divorce Therefore thing could slow Lawyers Make Everything Complicated Lawyers could make thing complicated always true happens it’s unintentional side effect getting divorce Brampton family lawyer greatest aid guide divorce Therefore better lawyer right beginning separation avoid unwanted delay process counsel Common Law Relationships Traditional Marriages Law One might think law doesn’t distinguish traditional marriage common law relationship couldn’t wrong law clearly distinguishes two therefore different approach divorce case matter right partner common law relationship limited compared couple got married traditionally Therefore aren’t law Cheated Spouse Favored People might think case partner cheated one got cheated would favored one cheated would favored come divorce another misconception nothing divorce law even though adultery considered valid reason seeking divorce Consulting family lawyer Brampton could give clarity always good idea get fact right Making mistake taking decision based one misconception could cost time moneyTags Lawyers Divorce Divorce Lawyer Family Lawyer Family Law
|
187,920 |
Do this to make your thought-leadership content fun while remaining informative
|
Bottom line: 87% of buyers of B2B services say your thought-leadership content can be fun and informative at the same time. Make it so.
Can your thought-leadership marketing and business development content be entertaining and informative at the same time?
Yes, and perhaps it should.
The line between our work lives and our personal lives
We live in a world where there is still a line between our work lives and our personal lives, a line between what we would consider “professional” and what we would consider “personal.”
We’re not going to post on LinkedIn the same things we might post on Facebook.
We’re probably not going to talk at a work event about the same things we might talk to our family and friends about at personal social events.
And even with COVID, where we have been virtually invited into other people’s homes with video calls, there’s still a line between our work lives and our personal lives.
Traditionally, legal thought-leadership marketing and business development content has adhered to that line. It is rare that you’re going to see a lawyer, law firm, or a legal tech company present an article, a blog post, or a client alert in a way that’s informal and that rivals something you might read from a newspaper columnist, an online lifestyle publication, or your favorite blogger or newsletter author.
This kind of thought-leadership content tends to be formal, buttoned up, and stuffy. Must it be? Is there room for more fun and more entertainment in the thought-leadership marketing content that lawyers, law firms, and legal tech companies publish?
Yes, there is. Lots of room.
Three ways to safely erase the line between professional and personal in our thought-leadership content
The Edelman public relations firm and LinkedIn recently released their 2021 B2B Thought Leadership Impact Study. There are many interesting findings in it. But for our purposes, a notable finding is that 87% of the global business executives interviewed said that “thought leadership content can be both intellectually rigorous and fun to consume at the same time.”
That’s an invitation for all of us to think about how we can make our thought-leadership marketing content more entertaining to the people who consume it. But how can we infuse entertainment into our thought-leadership content without coming across as too jokey, or offending the consumers of it, or undermining our perceived authority?
Try these three strategies.
Observe the “Dad Joke Rule”
We all know what “dad jokes” are. They are the corny, cheesy jokes our dads make that might get a laugh while causing an eye-roll. However, they are not offensive and they’re not going to rub anybody the wrong way.
If you observe the Dad Joke Rule, you commit to telling non-offensive jokes that do not make anyone (except maybe yourself) the butt of any jokes. These jokes are rated “G” as opposed to “PG-13” or “R.” They are meant to warm up the relationship between you and your audience by making them smile while they gain insights as they read your content.
Discuss shared experiences
If you know the demographics, including the socio-economic demographics, of the audience you are talking to, you can make entertaining references to pop culture that you know are likely to resonate with that audience given your shared life experiences, normally in the form of analogies, metaphors, and similes.
If you are talking to people around your age, you can make references to the shows you were watching in your teenage years or your experiences at college. If you know you’re talking to people who have kids or own a home, you can make references to things kids do or issues that arise when you are a homeowner.
By making light of shared experiences, you entertain the consumers of your content while also establishing a bond built upon you and them experiencing the same things in life. Combine this bond with the authority-building nature of thought-leadership content, and you may be able to create both an emotional case and a rational case for the consumers of your content trusting you and giving you their business.
Use an informal style
If you are uncomfortable going the dad joke route or the shared experiences route, that’s ok. You can take baby steps before you start walking.
You can simply write your content in a less formal style. You can write it more conversationally than what tends to be the norm for thought-leadership marketing and business content.
But when I say “less formal,” I’m not suggesting you write your thought-leadership content the same way teenagers write their text messages. I’m thinking more like the style and tone you would use in a conversation you might have with a colleague over lunch or with a friend over drinks or coffee.
Don’t try too hard to be entertaining
While I’m suggesting you incorporate fun into your thought-leadership marketing and business development content to see if you can make it more entertaining than the standard fare, you must remember that we’re still talking about a professional marketing tool.
This content is not the forum for you to try out a stand-up comedy routine. This is not where you should spend a thousand words reciting a monologue about something your spouse or your children did.
This is not an invitation go “blue” and use expletives, or crack sexual jokes. This is not an invitation to make jokes at the expense of people—whether individuals or large groups.
Rather, focus on making little quips in your content that people smile at. As I mentioned above, make analogies, use metaphors, and try other attempts at humor that are non-offensive and that flow within the larger piece of content you’re writing.
Informative + Entertaining = A formidable content strategy
Remember, the whole point of thought-leadership marketing and business development content is to position yourself as an authority in the minds of your target audience. You want to position yourself as someone who knows about the issues your clients, or your referral sources’ clients, are struggling with and as someone who can help them overcome those issues.
But guess what? It wouldn’t hurt if the target audience of your thought-leadership content enjoyed being entertained by your content while they were consuming it and (hopefully) learning from it.
In addition to showing them that you have the intellectual chops to help them with their legal and business problems, when your thought-leadership marketing and business development content entertains your target audience, you begin to build a rapport with them that can make them that much more likely to want to work with you.
And that, my friend, is no joke.
Bottom line: 87% of buyers of B2B services say your thought-leadership content can be fun and informative at the same time. Make it so.
Wayne Pollock, a former Am Law 50 senior litigation associate, is the founder of Copo Strategies, a legal services and communications firm, and the Law Firm Editorial Service, a content strategy and ghostwriting service for lawyers and their law firms. The Law Firm Editorial Service sets free the knowledge and wisdom trapped inside Big Law and boutique law firm partners by collaborating with them to strategize and ethically ghostwrite book-of-business-building marketing and business development content.
Like what you read? Click here to sign up for the Copo Strategies + Law Firm Editorial Service email newsletter. When you do, we will immediately send you a download link to our Attorney Thought-Leadership Scorecard. You can use the scorecard to determine how well your thought-leadership marketing content follows the Six Habits of Highly Effective Thought-Leadership Content.
|
https://copocetic.com/do-this-to-make-your-thought-leadership-content-fun-while-remaining-informative-81e08343086b
|
['Wayne Pollock']
|
2021-12-30 14:33:01.774000+00:00
|
['Lawyers', 'Legal Marketing', 'Content Marketing', 'Thought Leadership', 'Law Firm']
|
Title make thoughtleadership content fun remaining informativeContent Bottom line 87 buyer B2B service say thoughtleadership content fun informative time Make thoughtleadership marketing business development content entertaining informative time Yes perhaps line work life personal life live world still line work life personal life line would consider “professional” would consider “personal” We’re going post LinkedIn thing might post Facebook We’re probably going talk work event thing might talk family friend personal social event even COVID virtually invited people’s home video call there’s still line work life personal life Traditionally legal thoughtleadership marketing business development content adhered line rare you’re going see lawyer law firm legal tech company present article blog post client alert way that’s informal rival something might read newspaper columnist online lifestyle publication favorite blogger newsletter author kind thoughtleadership content tends formal buttoned stuffy Must room fun entertainment thoughtleadership marketing content lawyer law firm legal tech company publish Yes Lots room Three way safely erase line professional personal thoughtleadership content Edelman public relation firm LinkedIn recently released 2021 B2B Thought Leadership Impact Study many interesting finding purpose notable finding 87 global business executive interviewed said “thought leadership content intellectually rigorous fun consume time” That’s invitation u think make thoughtleadership marketing content entertaining people consume infuse entertainment thoughtleadership content without coming across jokey offending consumer undermining perceived authority Try three strategy Observe “Dad Joke Rule” know “dad jokes” corny cheesy joke dad make might get laugh causing eyeroll However offensive they’re going rub anybody wrong way observe Dad Joke Rule commit telling nonoffensive joke make anyone except maybe butt joke joke rated “G” opposed “PG13” “R” meant warm relationship audience making smile gain insight read content Discuss shared experience know demographic including socioeconomic demographic audience talking make entertaining reference pop culture know likely resonate audience given shared life experience normally form analogy metaphor simile talking people around age make reference show watching teenage year experience college know you’re talking people kid home make reference thing kid issue arise homeowner making light shared experience entertain consumer content also establishing bond built upon experiencing thing life Combine bond authoritybuilding nature thoughtleadership content may able create emotional case rational case consumer content trusting giving business Use informal style uncomfortable going dad joke route shared experience route that’s ok take baby step start walking simply write content le formal style write conversationally tends norm thoughtleadership marketing business content say “less formal” I’m suggesting write thoughtleadership content way teenager write text message I’m thinking like style tone would use conversation might colleague lunch friend drink coffee Don’t try hard entertaining I’m suggesting incorporate fun thoughtleadership marketing business development content see make entertaining standard fare must remember we’re still talking professional marketing tool content forum try standup comedy routine spend thousand word reciting monologue something spouse child invitation go “blue” use expletive crack sexual joke invitation make joke expense people—whether individual large group Rather focus making little quip content people smile mentioned make analogy use metaphor try attempt humor nonoffensive flow within larger piece content you’re writing Informative Entertaining formidable content strategy Remember whole point thoughtleadership marketing business development content position authority mind target audience want position someone know issue client referral sources’ client struggling someone help overcome issue guess wouldn’t hurt target audience thoughtleadership content enjoyed entertained content consuming hopefully learning addition showing intellectual chop help legal business problem thoughtleadership marketing business development content entertains target audience begin build rapport make much likely want work friend joke Bottom line 87 buyer B2B service say thoughtleadership content fun informative time Make Wayne Pollock former Law 50 senior litigation associate founder Copo Strategies legal service communication firm Law Firm Editorial Service content strategy ghostwriting service lawyer law firm Law Firm Editorial Service set free knowledge wisdom trapped inside Big Law boutique law firm partner collaborating strategize ethically ghostwrite bookofbusinessbuilding marketing business development content Like read Click sign Copo Strategies Law Firm Editorial Service email newsletter immediately send download link Attorney ThoughtLeadership Scorecard use scorecard determine well thoughtleadership marketing content follows Six Habits Highly Effective ThoughtLeadership ContentTags Lawyers Legal Marketing Content Marketing Thought Leadership Law Firm
|
187,921 |
What to Do After You’ve Been in an Accident That’s Not Your Fault
|
When you become involved in an accident that you did not cause, you will either need to go to court over the matter or you will need to go through the at-fault individual’s insurance company. When you aren’t at fault, you’ll need to provide paperwork and proof that the other individual caused the accident, so their policy will pay for your medical costs, time away from work, and repairs or replacement of your damaged vehicle.
It can be tough to know what to do in the moment of a car accident. Your body likely goes into shock which makes it tough to keep things straight. For that reason, most insurance companies and most personal injury attorneys recommend that you keep a checklist in your vehicle that you can quickly see or access so you can remember what steps to take. This helps make sure you don’t miss anything, and you provide the best possible information to your car accident attorney in Augusta.
1. After a car accident that you did not cause, your first task is to remain calm. You need to think as clearly as possible. Pull out this checklist if you can. If you feel significant pain, you should not attempt to move.
2. Call 911. If your vehicle has onboard navigation and an emergency system like On-Star, the service will likely monitor the crash impact and contact you using the in-auto system. While it may seem strange to hear this seemingly disembodied voice in your vehicle, if you can respond to them, they can help you document what happened and provide a recording of the call. They can also provide the crash impact data. If you cannot move to use your cell to phone help, they can phone you. Even in cases where you could call, they typically do so for you. If you cannot respond because you were knocked out, the service phones help you automatically. If you do not have this type of service, phone 911 using your cellphone.
3. Check on your passengers if you have any in the vehicle with you. Once you know that everyone is okay, you can proceed with other steps in documenting the accident. If anyone gets knocked unconscious or says their neck or back hurts, advise them not to move at all. Convey this information to the 911 operator. Also, note if any other individuals involved in the accident seem injured. Let 911 know of this as well.
4. Wait for the authorities and remain at the accident scene until the police tell you that you can leave. Even if you have not been injured and simply traded information with the other driver, you should wait for the police. The responding officer will provide you with permission to leave the scene. They will tell you if you’ll need a tow truck for your vehicle or if it would be legal for you to drive the damaged vehicle home.
5. Document your recollection of the events as they occurred. You can record this using the audio recorder on your cellphone or, if you have On-Star or a similar service, you can tell the operator who contacts you what occurred. Provide succinct details.
6. Turn on your hazard lights. If you can get out of the vehicle without harming yourself, you can do so to assess your vehicle’s damage. Using your cellphone, take pictures of the vehicle damage. Write down or note using speech to text any vehicle damage. Also, take pictures of the accident from various angles. If you can safely cross the street to take photos from that view, do so.
7. Get back into your vehicle. Move your vehicle off of the road if you can drive it. Drive it onto the furthest shoulder of the road. This moves it away from oncoming traffic while keeping it right next to the scene of the accident.
8. When the police and other emergency workers arrive, meet with them as needed. The police will measure the skid marks, photograph the scene, interview witnesses, and talk to any people directly involved in the accident that remain conscious. They will document all aspects of the accident and may contact various nearby businesses for security camera video to determine the at-fault party. If a traffic camera recorded the accident, they will note the camera and later access the information. You should obtain a copy of the police report after it is complete. This can provide vital evidence in the insurance company’s determination of liability. You can also use it to negotiate with the insurance company.
9. Provide the responding police officer with your name, street address, phone number, and insurance information. They gather this information as a part of their standard procedure.
10. You also need to obtain the name and contact information of each individual involved in the accident, but especially the person you believe to be at fault for the accident. You will also need their insurance information. Make the exchange of contact information your only contact with the other involved party.
11. Never mention the fault of the accident at the scene. Do not accept or assign blame.
12. Document what any witnesses present saw. You need to obtain their names, phone numbers, and addresses, too. This lets your insurance agency or attorney easily contact them for more information. Also, use the audio recorder on your cellphone to have each witness individually describe what they saw. Make sure you have each person self-identify on the recording. Make notes, too, if possible. Your attorney can use this information to improve the settlement you receive so long as everything points to the fault genuinely belonging to the other driver.
13. Each month nearly 3,500 people are critically injured in speed-related crashes in Georgia. Contact a personal injury attorney in Augusta who specializes in car accidents. Retaining an attorney should not cost you any money upfront. Most personal injury attorneys work on a contingency basis. They will pull their service fees from your settlement. This lets you obtain good quality legal counsel to get the best possible settlement from the accident.
14. Confer with your attorney before accepting any settlement offer from the at-fault driver’s insurance company. The first offer typically comes a few days after the accident. Confer with your attorney before accepting this. You may want to direct the other driver’s insurance company to send all contact through the attorney to avoid these issues. Your attorney will tell you when the insurance company has made a good offer and when you should counter-offer.
Whenever you become involved in a car accident, phone a lawyer who specializes in car accidents and personal injury in Augusta. This can provide you with the best results possible.
|
https://medium.com/@foyandassociateslaw/what-to-do-after-youve-been-in-an-accident-that-s-not-your-fault-f089e81a3fad
|
['John Foy']
|
2021-12-30 22:40:34.022000+00:00
|
['Lawyers', 'Attorney', 'Car Accident Lawyer']
|
Title You’ve Accident That’s FaultContent become involved accident cause either need go court matter need go atfault individual’s insurance company aren’t fault you’ll need provide paperwork proof individual caused accident policy pay medical cost time away work repair replacement damaged vehicle tough know moment car accident body likely go shock make tough keep thing straight reason insurance company personal injury attorney recommend keep checklist vehicle quickly see access remember step take help make sure don’t miss anything provide best possible information car accident attorney Augusta 1 car accident cause first task remain calm need think clearly possible Pull checklist feel significant pain attempt move 2 Call 911 vehicle onboard navigation emergency system like OnStar service likely monitor crash impact contact using inauto system may seem strange hear seemingly disembodied voice vehicle respond help document happened provide recording call also provide crash impact data cannot move use cell phone help phone Even case could call typically cannot respond knocked service phone help automatically type service phone 911 using cellphone 3 Check passenger vehicle know everyone okay proceed step documenting accident anyone get knocked unconscious say neck back hurt advise move Convey information 911 operator Also note individual involved accident seem injured Let 911 know well 4 Wait authority remain accident scene police tell leave Even injured simply traded information driver wait police responding officer provide permission leave scene tell you’ll need tow truck vehicle would legal drive damaged vehicle home 5 Document recollection event occurred record using audio recorder cellphone OnStar similar service tell operator contact occurred Provide succinct detail 6 Turn hazard light get vehicle without harming ass vehicle’s damage Using cellphone take picture vehicle damage Write note using speech text vehicle damage Also take picture accident various angle safely cross street take photo view 7 Get back vehicle Move vehicle road drive Drive onto furthest shoulder road move away oncoming traffic keeping right next scene accident 8 police emergency worker arrive meet needed police measure skid mark photograph scene interview witness talk people directly involved accident remain conscious document aspect accident may contact various nearby business security camera video determine atfault party traffic camera recorded accident note camera later access information obtain copy police report complete provide vital evidence insurance company’s determination liability also use negotiate insurance company 9 Provide responding police officer name street address phone number insurance information gather information part standard procedure 10 also need obtain name contact information individual involved accident especially person believe fault accident also need insurance information Make exchange contact information contact involved party 11 Never mention fault accident scene accept assign blame 12 Document witness present saw need obtain name phone number address let insurance agency attorney easily contact information Also use audio recorder cellphone witness individually describe saw Make sure person selfidentify recording Make note possible attorney use information improve settlement receive long everything point fault genuinely belonging driver 13 month nearly 3500 people critically injured speedrelated crash Georgia Contact personal injury attorney Augusta specializes car accident Retaining attorney cost money upfront personal injury attorney work contingency basis pull service fee settlement let obtain good quality legal counsel get best possible settlement accident 14 Confer attorney accepting settlement offer atfault driver’s insurance company first offer typically come day accident Confer attorney accepting may want direct driver’s insurance company send contact attorney avoid issue attorney tell insurance company made good offer counteroffer Whenever become involved car accident phone lawyer specializes car accident personal injury Augusta provide best result possibleTags Lawyers Attorney Car Accident Lawyer
|
187,922 |
Can You End Up Paying More Money Than the Lawsuit Loan You Took in a Settlement?
|
If you have a lawsuit settlement, can you end up paying more money than your lawsuit loan amount? Unfortunately, the answer is yes, and it’s a big problem. In this post, we’ll be going over why it happens and how to avoid getting into that situation.
Before you commit to a lawsuit loan, make sure that you explore other financing options as well. No matter what your final decision will be, consider both advantages and disadvantages of each alternative.
Considerations When Taking a Lawsuit Loan
When you take out a lawsuit loan, the lender expects to be paid back with interest. That’s how they make their money. However, if you happen to win your case and receive a larger settlement than what you took out in loans, the lender can come after you for that extra money.
It is essential to carefully consider all of your options before taking out a lawsuit loan. Make sure to explore all financing revenues, such as personal loans or credit cards. If you decide to take out a lawsuit loan, be sure to shop around for the best rates and terms.
The Pros and Cons of Lawsuit Loans
When considering whether or not to take out a lawsuit loan, it’s important to weigh the pros and cons carefully. For personalized advice, talk directly to a provider like High Rise Financial, LLC. Here are some pros and cons to keep in mind:
Lawsuit Loans Can Be a Welcomed Financial Safety Net
A lawsuit loan can offer the financial safety net you need to cover expenses that are weighing you down. This can include medical bills, living expenses, and your other obligations while your lawsuit is pending.
You Can Have More Time for Legal Strategies
As lawsuit loans can help ease the immediate financial strain that is weighing you down during the lawsuit, you will not be as tempted to accept the first settlement option. As with negotiations, in general, it is not wise to accept the first offer, as this tends to be lower than what you are entitled to get.
Lawsuit Loans Can Be Expensive
Lawsuit loans are typically expensive and come with high-interest rates. This means that you can end up paying more for the loan than if you had taken out a traditional loan from a bank or other lending institution.
It Can Take a Long Time to Repay a Lawsuit Loan
The amount of time it will take you to pay off the loan can be quite long, especially if the case takes longer than expected to resolve. This can mean that you will be paying interest on the loan for many months or even years.
Not Every Case Qualifies for a Lawsuit Loan
Offering you a loan is considered a risk for the lending company since they only profit if you settle or win your case. You will not have to pay the money back if you lose your case. Therefore, loan providers often hold out and accept to work only with surefire cases. Furthermore, if the amount you are awarded for your case ends up being smaller than the amount you have borrowed, you may have to pay them back less.
If the first lending company turns your case down, do not get discouraged. There are many available firms from which you can choose. Some people end up going to five different providers until they finally get the green light.
Reasons Why You Can Overpay in a Lawsuit Loan
When you take out a lawsuit loan, you may be tempted to overpay to get the money you need as quickly as possible. However, this is not a wise decision. There are several reasons why you can overpay.
To begin, you could face a prolonged lawsuit. If your lawsuit drags out, you will be paying your periodical interest rate for a longer time. Also, you might receive a cheaper option through one of the traditional financing options. However, taking a loan from a bank, for example, will have its own disadvantages. Make sure you have all the information you need to make an informed decision.
If you overpay on your lawsuit loan, you may not have enough money left to cover other costs associated with the lawsuit. This could negatively impact your case and create some major problems.
Lawsuit Loans Are Typically Unregulated
One of the main problems with lawsuit loans is that they are typically not regulated by government laws. Instead, some states have stepped up and set regulations in place. If you are not sure what is the case for your state, consult with your lawyer or a trustworthy representative from a lending company.
If you are wondering how this industry could avoid government scrutiny, the answer is quite simple. Representatives of the lawsuit lending industry claimed that lawsuit lending is, in fact, not a loan. Thus, it stands to reason that the same rules and regulations should not apply.
The narrative of industry representatives is that lawsuit lending is nonrecourse. In other words, clients do not have to repay the money unless they settle or win the case. A small hit to take to have a free rule over fees and other expenses regarding the loans.
While some stated and specific courts exert some regulatory power over the industry, this power is very limited. The restrictions only apply to service standards regarding disclosure and transparency, sometimes the amount they can charge for services rendered.
This being said, the offers you receive from different companies can vary greatly. Before choosing a provider, conduct in-depth research into what several firms offer. Study these offers and see which one would be more convenient for you.
How You Can Avoid Paying More Money Than You Have Loaned
There are a few things you can do to avoid this problem. Start by talking to your lawyer before taking out any lawsuit loans. Research different lenders before choosing one. Finally, only take out as much money as you need.
|
https://medium.com/@highriselegalfunding/can-you-end-up-paying-more-money-than-the-lawsuit-loan-you-took-in-a-settlement-7b81cb138caf
|
['High Rise Legal Funding']
|
2021-12-28 10:24:11.729000+00:00
|
['Lawyers', 'Money', 'Legal', 'Settlements', 'Funding']
|
Title End Paying Money Lawsuit Loan Took SettlementContent lawsuit settlement end paying money lawsuit loan amount Unfortunately answer yes it’s big problem post we’ll going happens avoid getting situation commit lawsuit loan make sure explore financing option well matter final decision consider advantage disadvantage alternative Considerations Taking Lawsuit Loan take lawsuit loan lender expects paid back interest That’s make money However happen win case receive larger settlement took loan lender come extra money essential carefully consider option taking lawsuit loan Make sure explore financing revenue personal loan credit card decide take lawsuit loan sure shop around best rate term Pros Cons Lawsuit Loans considering whether take lawsuit loan it’s important weigh pro con carefully personalized advice talk directly provider like High Rise Financial LLC pro con keep mind Lawsuit Loans Welcomed Financial Safety Net lawsuit loan offer financial safety net need cover expense weighing include medical bill living expense obligation lawsuit pending Time Legal Strategies lawsuit loan help ease immediate financial strain weighing lawsuit tempted accept first settlement option negotiation general wise accept first offer tends lower entitled get Lawsuit Loans Expensive Lawsuit loan typically expensive come highinterest rate mean end paying loan taken traditional loan bank lending institution Take Long Time Repay Lawsuit Loan amount time take pay loan quite long especially case take longer expected resolve mean paying interest loan many month even year Every Case Qualifies Lawsuit Loan Offering loan considered risk lending company since profit settle win case pay money back lose case Therefore loan provider often hold accept work surefire case Furthermore amount awarded case end smaller amount borrowed may pay back le first lending company turn case get discouraged many available firm choose people end going five different provider finally get green light Reasons Overpay Lawsuit Loan take lawsuit loan may tempted overpay get money need quickly possible However wise decision several reason overpay begin could face prolonged lawsuit lawsuit drag paying periodical interest rate longer time Also might receive cheaper option one traditional financing option However taking loan bank example disadvantage Make sure information need make informed decision overpay lawsuit loan may enough money left cover cost associated lawsuit could negatively impact case create major problem Lawsuit Loans Typically Unregulated One main problem lawsuit loan typically regulated government law Instead state stepped set regulation place sure case state consult lawyer trustworthy representative lending company wondering industry could avoid government scrutiny answer quite simple Representatives lawsuit lending industry claimed lawsuit lending fact loan Thus stand reason rule regulation apply narrative industry representative lawsuit lending nonrecourse word client repay money unless settle win case small hit take free rule fee expense regarding loan stated specific court exert regulatory power industry power limited restriction apply service standard regarding disclosure transparency sometimes amount charge service rendered said offer receive different company vary greatly choosing provider conduct indepth research several firm offer Study offer see one would convenient Avoid Paying Money Loaned thing avoid problem Start talking lawyer taking lawsuit loan Research different lender choosing one Finally take much money needTags Lawyers Money Legal Settlements Funding
|
187,923 |
Dedicated And Skilled Divorce Lawyer in Delhi, India
|
If there is a conflict of ideas, personalities, ego disruption, etc., institutions such as marriage can suffer catastrophe. Separation or divorce is the biggest catastrophe for it. Such incidents are never happy, but they may help alleviate the current stressed condition. In a nation like India, where the Rule of Law Index indicates that rules are respected, it looks like politicians got down one fine day in Parliament to write laws on marriage and divorce to assure a peaceful resolution and its aftermath. When it comes to resolving serious difficulties, divorce is nothing short of a sense of relief. You’ll need to find someone who specializes in civil suits, particularly those involving marital and family issues, for this. Connect with Naveen Mann Law Firm, the best divorce lawyer in Delhi, if you believe your marriage will not last any longer and need a quick solution.
What are the rules in India that govern divorce?
The second wave of feminism consolidated women’s rights. This massive wave began when India gained freedom, and our leaders met to draught our Constitution. They worked on the Hindu Marriage Act in 1955 after formulating their ideas. Section 13 of this law gave women the freedom to file for divorce without their husband’s approval. Apart from that, we can observe that the government took a giant stride a few years ago by enacting legislation on Triple Talaq to safeguard Muslim women. If you wonder why these rules are required, the simple response is that they ensure that no one, especially women, feels deprived of their rights. Since the later Vedic eras, Indian history has presented countless examples of women being bullied. Years of repression allowed our leaders to guarantee that women in independent India felt the same way.
Divorce cases can be brought under the following laws:
· Hindu Marriage Act
· Special Marriage Act
· Muslim Women Protection Act
· Foreign Marriage Act
If you want to file a case in Delhi, you’ll need someone who is highly professional and knows everything there is to know about the laws described above after that, and only then may you choose a divorce lawyer in Delhi, India.
What are the various types of divorces?
In a nutshell, divorces in India are categorized into three parts: consensual, contentious, and invalid marriages. When it comes to a mutual agreement, both the husband and wife have conducted extensive research and concluded that ending the marriage is not harmful if there is harmony in separation. If the divorce is challenged, there must be a compelling cause on either party’s side, such as cruelty, infectious disease, religious conversion, adulteration, and so on. However, in a contested divorce, both parties must show that they have been living separately for the last year. In a contentious case, there is a great deal of cross-examination. As a result, you will want the services of the top divorce lawyer in India. Any marriage is automatically void if there is any form of bigamy involved.
Is divorce a horrible experience?
Yes, to some extent, given the frequency it occurs in India. Divorce filing rates have risen in recent years, particularly during pandemics with substantial evidence of domestic abuse (several reasons behind it). A break from marital relationships appears to be a source of peace of mind for some couples. Divorce is caused by various factors, including frequent disagreements in mental processes, extramarital affairs, dowry, undercover polygamy, unemployment, and so on. But, in these legal circumstances, what happens? When a marriage is on the verge of falling apart, the battle for child custody, property, alimony and other issues begin.
How is alimony determined?
Alimony is something that every woman is entitled to if she tries to rebuild her life after a divorce. There is no upper or lower limit on the amount of alimony that should be paid. It is entirely dependent on the judge’s discretion in announcing the decree by assessing and checking the following features:
· Financial condition
· Age
· Health profile
In conclusion, alimony might be substantial if it is recognized that the deserted wife would experience difficulties following the divorce. Moreover, alimony may be increased if she obtains custody of the kid. To seize such opportunities, your legal counsel should be your gold mine, as they will be able to supply all of the information that will persuade courts to award more considerable alimony. As a result, finding a qualified divorce lawyer in Delhi is essential.
Conclusion
Naveen Mann Law Firm is a ray of hope for individuals who believe they have been deceived in a religious institution such as marriage and desire a clean exit to live a tranquil life in the future. Once you’ve contacted him, you should relax and see how the top divorce lawyer in Delhi, India, guarantees that the case has a favourable influence on you and keeps you out of trouble.
|
https://medium.com/@satish-prajapati/divorce-lawyer-in-delhi-india-7496a0b5562e
|
['Satish Prajapati']
|
2021-12-30 20:01:26.341000+00:00
|
['Lawyers', 'Advocate', 'Divorce', 'Delhi', 'Courts']
|
Title Dedicated Skilled Divorce Lawyer Delhi IndiaContent conflict idea personality ego disruption etc institution marriage suffer catastrophe Separation divorce biggest catastrophe incident never happy may help alleviate current stressed condition nation like India Rule Law Index indicates rule respected look like politician got one fine day Parliament write law marriage divorce assure peaceful resolution aftermath come resolving serious difficulty divorce nothing short sense relief You’ll need find someone specializes civil suit particularly involving marital family issue Connect Naveen Mann Law Firm best divorce lawyer Delhi believe marriage last longer need quick solution rule India govern divorce second wave feminism consolidated women’s right massive wave began India gained freedom leader met draught Constitution worked Hindu Marriage Act 1955 formulating idea Section 13 law gave woman freedom file divorce without husband’s approval Apart observe government took giant stride year ago enacting legislation Triple Talaq safeguard Muslim woman wonder rule required simple response ensure one especially woman feel deprived right Since later Vedic era Indian history presented countless example woman bullied Years repression allowed leader guarantee woman independent India felt way Divorce case brought following law · Hindu Marriage Act · Special Marriage Act · Muslim Women Protection Act · Foreign Marriage Act want file case Delhi you’ll need someone highly professional know everything know law described may choose divorce lawyer Delhi India various type divorce nutshell divorce India categorized three part consensual contentious invalid marriage come mutual agreement husband wife conducted extensive research concluded ending marriage harmful harmony separation divorce challenged must compelling cause either party’s side cruelty infectious disease religious conversion adulteration However contested divorce party must show living separately last year contentious case great deal crossexamination result want service top divorce lawyer India marriage automatically void form bigamy involved divorce horrible experience Yes extent given frequency occurs India Divorce filing rate risen recent year particularly pandemic substantial evidence domestic abuse several reason behind break marital relationship appears source peace mind couple Divorce caused various factor including frequent disagreement mental process extramarital affair dowry undercover polygamy unemployment legal circumstance happens marriage verge falling apart battle child custody property alimony issue begin alimony determined Alimony something every woman entitled try rebuild life divorce upper lower limit amount alimony paid entirely dependent judge’s discretion announcing decree assessing checking following feature · Financial condition · Age · Health profile conclusion alimony might substantial recognized deserted wife would experience difficulty following divorce Moreover alimony may increased obtains custody kid seize opportunity legal counsel gold mine able supply information persuade court award considerable alimony result finding qualified divorce lawyer Delhi essential Conclusion Naveen Mann Law Firm ray hope individual believe deceived religious institution marriage desire clean exit live tranquil life future you’ve contacted relax see top divorce lawyer Delhi India guarantee case favourable influence keep troubleTags Lawyers Advocate Divorce Delhi Courts
|
187,924 |
Do You Need A Divorce Lawyer?
|
Still, and both parties feel that it’s time to get a divorce, you don’t inescapably need divorce counsel to handle your case If your marriage has ended. You can file for a divorce yourself using numerous of the do-it-yourself divorce accouterments if there are no children involved, and if the connubial property can be divided as both parties would like. However, if one or the other demurrers the divorce, or if you have a lot of property to divide, If you have children. Divorce lawyer Hilton head sc.
A divorce counsel will file the proper paperwork to ensure that you get your fair share in the divorce. This is especially true if your partner is against the divorce or disagrees with certain aspects of the bifurcation, like guardianship of children or division of the connubial property.
To save money, you and your partner should sit down and bandy the areas of concern before hiring a divorce lawyer. However, or better yet, all aspects of the divorce, If you both can come to an agreement on some aspects of the divorce.
Still, but can not decide on how to resolve the value of your home, you’ll save plutocrat when you cover only the concern with your divorce counsel of how to divide your home If you both can agree on guardianship. There will be no need to waste time agitating the guardianship issue if it’s resolved, which will save legal freights. A divorce counsel charges by the hour and if you can save 30 twinkles of talking, you could save yourself further than a hundred bones. Thus, always bandy aspects of the divorce collectively before bringing your enterprises before the divorce counsel. Divorce lawyer Greenville SC.
Still, also your divorce counsel will know how stylish to deal with him or her If you don’t feel that your partner can bandy the case rationally without wrathfulness.
When opting for a divorce counsel, you’ll want to detect one that isn’t only good, but that’s also compassionate. Going through a divorce can be veritably stressful for both parties and any children involved, so you should make sure that your divorce counsel has a compassionate and caring station not only towards you and your children but towards your partner as well. There is no reason to have an angry and stressful divorce no matter what you and your partner’s differences are, and your divorce counsel should be understanding of this.
Still, don’t vacillate firing him or her, If you hire a divorce counsel and if you aren’t happy with his or her services. You’re paying for legal services and if you aren’t happy with the way your divorce counsel is handling your case, you’re always free to find someone who’ll handle your divorce in a manner that you see fit.
Of course, there are certain laws each party must abide by. Guardianship issues, visits, and child support are some effects your divorce counsel can not change. The liberal visit is handed for the one who doesn’t have physical guardianship, and child support is fairly required. However, this is a commodity that you can’t change and you shouldn’t get worried with your divorce counsel about a commodity like this, If your divorce counsel states that you must let your partner see his or her child every other weekend. Divorce lawyer Bluffton sc.
But if your divorce counsel states that he or she’s going to draft the papers to grant further than is needed by law, and if you’re unhappy about this, ask the divorce counsel to make changes or find yourself another divorce counsel.
|
https://medium.com/@johnsmithdigitalworld/do-you-need-a-divorce-lawyer-e3129628a4af
|
[]
|
2021-12-30 09:45:05.221000+00:00
|
['Lawyers', 'Lawyer Hilton Head Sc', 'Divorce Lawyer', 'Divorce']
|
Title Need Divorce LawyerContent Still party feel it’s time get divorce don’t inescapably need divorce counsel handle case marriage ended file divorce using numerous doityourself divorce accouterment child involved connubial property divided party would like However one demurrer divorce lot property divide child Divorce lawyer Hilton head sc divorce counsel file proper paperwork ensure get fair share divorce especially true partner divorce disagrees certain aspect bifurcation like guardianship child division connubial property save money partner sit bandy area concern hiring divorce lawyer However better yet aspect divorce come agreement aspect divorce Still decide resolve value home you’ll save plutocrat cover concern divorce counsel divide home agree guardianship need waste time agitating guardianship issue it’s resolved save legal freight divorce counsel charge hour save 30 twinkle talking could save hundred bone Thus always bandy aspect divorce collectively bringing enterprise divorce counsel Divorce lawyer Greenville SC Still also divorce counsel know stylish deal don’t feel partner bandy case rationally without wrathfulness opting divorce counsel you’ll want detect one isn’t good that’s also compassionate Going divorce veritably stressful party child involved make sure divorce counsel compassionate caring station towards child towards partner well reason angry stressful divorce matter partner’s difference divorce counsel understanding Still don’t vacillate firing hire divorce counsel aren’t happy service You’re paying legal service aren’t happy way divorce counsel handling case you’re always free find someone who’ll handle divorce manner see fit course certain law party must abide Guardianship issue visit child support effect divorce counsel change liberal visit handed one doesn’t physical guardianship child support fairly required However commodity can’t change shouldn’t get worried divorce counsel commodity like divorce counsel state must let partner see child every weekend Divorce lawyer Bluffton sc divorce counsel state she’s going draft paper grant needed law you’re unhappy ask divorce counsel make change find another divorce counselTags Lawyers Lawyer Hilton Head Sc Divorce Lawyer Divorce
|
187,925 |
What Is Medical Malpractice?
|
When a healthcare provider gives therapy that deviates from established medical standards of care, causing damage to a patient, this is referred to as medical malpractice. If a doctor, surgeon, hospital, or other person was negligent in their medical care, they might be held accountable for any damages that resulted. Medical negligence is defined as a careless act or omission that causes damage to a patient, such as removing the incorrect organ or leaving a surgical tool in the body. If the sufferer can show that the negligent conduct caused their harm directly, they may be entitled to monetary compensation, which can be easily availed with the help of a medical malpractice lawyer.
How medical malpractice case is determined?
Every doctor swears to “never knowingly injure somebody.” You place your confidence in physicians, nurses, and other medical professionals when you or someone you care about need medical care. These medical professionals have spent years preparing to serve you and your loved ones with high-quality, professional treatment. Thousands of individuals are hurt every year in the United States as a result of preventable errors and substandard care by healthcare practitioners.
Medical Malpractice Lawyer
So, when it comes to proving a medical malpractice claim, there are a lot of variables to consider. These are some of them:
Doctors must carry out their responsibilities in accordance with acknowledged medical standards of care.
Breach of duty — In order for medical malpractice to be considered, a medical practitioner must have breached their duty of care by failing to respond in a way that other doctors would have handled the case.
Causation — Simply put, this indicates that the healthcare professional caused personal injury as a result of a medical error or poor medical care.
Damages — A successful medical malpractice claim must show that the personal harm resulted in monetary or non-monetary losses. Medical bills, lost pay, loss of earning ability, pain and suffering, and loss of consortium are all possible losses.
When to contact a medical malpractice attorney?
If you believe that you have been the victim of medical negligence, you should seek medical help as soon as possible. You must acquire an accurate diagnosis and begin therapy as soon as possible for your health and to help protect your legal rights.
A medical malpractice lawyer provides legal counsel for victims of medical negligence, and handles complaints against hospitals, clinics, doctor’s offices, and other healthcare providers across the local region.
A medical malpractice lawyer assists you in:
· Assessing whether or not you have a claim
· Assisting you in gathering the proof and medical documents you’ll need for your case and analyzing the claim’s potential worth
· Identifying the persons that might be held accountable interrogating expert witnesses
· Assisting you in understanding the applicable laws and your rights assisting you with the intricate process of making a claim and, if necessary, taking it to court
This is known as “discovery,” a formal evidence-gathering process. A court order may be required in some cases to compel the opposing party to comply with a discovery request. The length of time it takes to resolve your claim will also be determined by whether or not the medical practitioner involved in your case is prepared to acknowledge responsibility and agree to a complete and fair compensation.
A dispute can be settled without the necessity for a trial. If a malpractice settlement cannot be reached, your attorney can be well prepared to take your case to trial.
The focus of a trial may be on determining the medical professional’s legal responsibility, or “liability,” as well as the amount of damages you should be awarded. In rare cases, the blame may be accepted, and the trial may be limited to damages alone. Settlement negotiations may last until the end of the trial or even after the verdict has been rendered. Your lawyer will work quickly to address any claims that may be linked to your recovery, account for your legal fees and case costs after your case has achieved a settlement or judgement.
Ask an Expert Online 24/7
|
https://medium.com/@infogain/what-is-medical-malpractice-44d5a7e4d898
|
[]
|
2021-12-27 14:56:09.773000+00:00
|
['Lawyers', 'Medical Malpractice Claim', 'Attorney', 'Medical Malpracticelawyer', 'Medical Malpractice']
|
Title Medical MalpracticeContent healthcare provider give therapy deviate established medical standard care causing damage patient referred medical malpractice doctor surgeon hospital person negligent medical care might held accountable damage resulted Medical negligence defined careless act omission cause damage patient removing incorrect organ leaving surgical tool body sufferer show negligent conduct caused harm directly may entitled monetary compensation easily availed help medical malpractice lawyer medical malpractice case determined Every doctor swears “never knowingly injure somebody” place confidence physician nurse medical professional someone care need medical care medical professional spent year preparing serve loved one highquality professional treatment Thousands individual hurt every year United States result preventable error substandard care healthcare practitioner Medical Malpractice Lawyer come proving medical malpractice claim lot variable consider Doctors must carry responsibility accordance acknowledged medical standard care Breach duty — order medical malpractice considered medical practitioner must breached duty care failing respond way doctor would handled case Causation — Simply put indicates healthcare professional caused personal injury result medical error poor medical care Damages — successful medical malpractice claim must show personal harm resulted monetary nonmonetary loss Medical bill lost pay loss earning ability pain suffering loss consortium possible loss contact medical malpractice attorney believe victim medical negligence seek medical help soon possible must acquire accurate diagnosis begin therapy soon possible health help protect legal right medical malpractice lawyer provides legal counsel victim medical negligence handle complaint hospital clinic doctor’s office healthcare provider across local region medical malpractice lawyer assist · Assessing whether claim · Assisting gathering proof medical document you’ll need case analyzing claim’s potential worth · Identifying person might held accountable interrogating expert witness · Assisting understanding applicable law right assisting intricate process making claim necessary taking court known “discovery” formal evidencegathering process court order may required case compel opposing party comply discovery request length time take resolve claim also determined whether medical practitioner involved case prepared acknowledge responsibility agree complete fair compensation dispute settled without necessity trial malpractice settlement cannot reached attorney well prepared take case trial focus trial may determining medical professional’s legal responsibility “liability” well amount damage awarded rare case blame may accepted trial may limited damage alone Settlement negotiation may last end trial even verdict rendered lawyer work quickly address claim may linked recovery account legal fee case cost case achieved settlement judgement Ask Expert Online 247Tags Lawyers Medical Malpractice Claim Attorney Medical Malpracticelawyer Medical Malpractice
|
187,926 |
Is Your Basement Flooded Following a Natural Disaster? How to Work It Out
|
If you have been affected by a natural disaster and your basement is flooded, there are some things you can do to solve the problem. The most important thing to always keep in mind is that safety comes first.
Make sure that there are no electrical hazards in your house before you start cleaning. Next, you must inform your insurance agent and proceed to clean the space. Gather all your belongings and sort through them, separating what can be salvaged from what is beyond repair. Remove the water and dry your basement.
Safety First
Before doing anything, make sure it is safe to enter the basement. Pay special attention to any electrical hazards. If water is still standing, do not enter the basement, just wait for the water to recede. Other potential dangers you should look out for include snakes or other wild animals that may have taken refuge in your home during the disaster.
Inform Your Insurance Agent
You should inform your insurance agent as soon as possible and be sure to have an exit strategy in place. If you are not able to work it out yourself, a contractor may help you with the work involved.
Some things aren’t covered by traditional homeowner’s or renter’s insurance policies, such as moving costs and temporary housing expenses. These will require additional coverage, which you should inquire about from your insurer before beginning any cleaning efforts.
Turn Off the Power
The next thing to do is turn off your electrical appliances and cut any active electrical sources, such as a plugged-in refrigerator. This will prevent accidents from occurring during clean-up. Electricity can be dangerous if it comes into contact with water, so make sure everything is turned off before going further. Additionally, you can consider contacting emergency water removal services for more help with your flooded basement.
Turning off the power means cutting active electric sources like a plugged-in fridge or lamps that are still on. Also, try not to use things that give out sparks. This includes lighters or matches, which could create fires easily since there’s already flood damage from natural disasters.
Collect Any Ruined Valuables
Before beginning clean-up, make sure to gather up all your belongings that are water damaged. This includes clothes, furniture, and anything else you may have in the basement. You can also use this time to find important documents like birth certificates or social security cards which could be washed away with the flooding.
Move everything out of affected areas into dryer places within the house. After this is complete, begin the clean-up process. The next steps include mopping floors, cleaning walls and ceilings, fixing furniture, etc. Also, check if there’s still electricity running, so it doesn’t cause a short circuit when completing the following tasks.
Collect items lost during floods after safety measures have been taken. Sort what can be saved and what needs to be thrown away. It’s best not to use any light near water-damaged areas to prevent electrical hazards during clean-up.
Documents are essential and you will need many of them in the aftermath of a natural disaster. Therefore, you should prioritize these. Next, you can start collecting any ruined valuables, clothes, and furniture as well.
Remove the Water
Now that you have gathered your belongings and turned off the power, it is time to remove the water. You can do this by using a bucket or mop to soak up as much of the water as possible. Additionally, you can use a wet/dry vacuum to suck up any standing water.
Water needs to be removed as soon as possible after natural disasters occur. If you leave the water there for a longer time, it will only cause more destruction. Using a bucket or mop to soak up as much water is ideal, and using an industrial wet or dry vacuum will help get rid of puddles on the floor. Be sure not to move furniture too much, so it does not get ruined even more from flood damage.
Dry Your Basement
Now that you have removed the water, it is time to dry your basement. You can do this by using a dehumidifier or air compressor. Additionally, you can use fans to circulate the air and speed up the drying process.
Drying out the basement with machines like dehumidifiers and air compressors will help decrease the amount of work needed for clean-up afterward, plus get rid of the musty smell. If there is furniture in the basement, be sure not to move it around too much, so it does not get ruined even more from flood damage.
How Do I Prevent My Basement From Flooding?
It is always best to take preventive measures. Even if a natural disaster strikes and your house will not be spared from nature’s rage, at least the damage will be diminished.
You can prevent your basement from flooding by keeping gutters and downspouts clean, installing a backwater valve in the sewer line to keep sewage away from entering the home’s foundation. If there is any standing water, you need to pump it out.
Final Thoughts
Surviving a natural disaster can be a traumatic experience. Nevertheless, dealing with the aftermath is a difficult process as well. If you feel alone or overwhelmed, remember that you are not alone. Seek refuge in your friends and family, local community, and capable experts.
In times of need, we should reach out for help but at the same time offer a helping hand to others. Once you have ensured your safety, you can help out others in your neighborhood. You can offer to help with the labor, share your knowledge, and experiences. If you have had a good experience with a specialist helping you recover, do not hesitate to recommend them.
After completing all these tasks after a natural disaster, be sure to follow additional safety steps before settling. These include checking for active electrical outlets, moving everything into dry places inside the house first, and then gathering your belongings. After these steps are completed, you can start rebuilding your life.
|
https://medium.com/@rmiemergencyservices/is-your-basement-flooded-following-a-natural-disaster-how-to-work-it-out-d0050fd7614c
|
['Rmi Emergency Services']
|
2021-12-31 09:45:24.709000+00:00
|
['Lawyers', 'Attorney', 'Flooding']
|
Title Basement Flooded Following Natural Disaster Work OutContent affected natural disaster basement flooded thing solve problem important thing always keep mind safety come first Make sure electrical hazard house start cleaning Next must inform insurance agent proceed clean space Gather belonging sort separating salvaged beyond repair Remove water dry basement Safety First anything make sure safe enter basement Pay special attention electrical hazard water still standing enter basement wait water recede potential danger look include snake wild animal may taken refuge home disaster Inform Insurance Agent inform insurance agent soon possible sure exit strategy place able work contractor may help work involved thing aren’t covered traditional homeowner’s renter’s insurance policy moving cost temporary housing expense require additional coverage inquire insurer beginning cleaning effort Turn Power next thing turn electrical appliance cut active electrical source pluggedin refrigerator prevent accident occurring cleanup Electricity dangerous come contact water make sure everything turned going Additionally consider contacting emergency water removal service help flooded basement Turning power mean cutting active electric source like pluggedin fridge lamp still Also try use thing give spark includes lighter match could create fire easily since there’s already flood damage natural disaster Collect Ruined Valuables beginning cleanup make sure gather belonging water damaged includes clothes furniture anything else may basement also use time find important document like birth certificate social security card could washed away flooding Move everything affected area dryer place within house complete begin cleanup process next step include mopping floor cleaning wall ceiling fixing furniture etc Also check there’s still electricity running doesn’t cause short circuit completing following task Collect item lost flood safety measure taken Sort saved need thrown away It’s best use light near waterdamaged area prevent electrical hazard cleanup Documents essential need many aftermath natural disaster Therefore prioritize Next start collecting ruined valuable clothes furniture well Remove Water gathered belonging turned power time remove water using bucket mop soak much water possible Additionally use wetdry vacuum suck standing water Water need removed soon possible natural disaster occur leave water longer time cause destruction Using bucket mop soak much water ideal using industrial wet dry vacuum help get rid puddle floor sure move furniture much get ruined even flood damage Dry Basement removed water time dry basement using dehumidifier air compressor Additionally use fan circulate air speed drying process Drying basement machine like dehumidifiers air compressor help decrease amount work needed cleanup afterward plus get rid musty smell furniture basement sure move around much get ruined even flood damage Prevent Basement Flooding always best take preventive measure Even natural disaster strike house spared nature’s rage least damage diminished prevent basement flooding keeping gutter downspouts clean installing backwater valve sewer line keep sewage away entering home’s foundation standing water need pump Final Thoughts Surviving natural disaster traumatic experience Nevertheless dealing aftermath difficult process well feel alone overwhelmed remember alone Seek refuge friend family local community capable expert time need reach help time offer helping hand others ensured safety help others neighborhood offer help labor share knowledge experience good experience specialist helping recover hesitate recommend completing task natural disaster sure follow additional safety step settling include checking active electrical outlet moving everything dry place inside house first gathering belonging step completed start rebuilding lifeTags Lawyers Attorney Flooding
|
187,927 |
Food in the spotlight — “So, it begins…”
|
I am starting this newsletter, generously acknowledging the fact that LinkedIn allows me to do so, in exchange for my users’ attention. This is the usual trade-off you have to face with online platforms and social media: and you need to live with that, together with the fact that if they change the rules, you have to adapt your strategy.
Truth to be told, this platform proved to be also an amazing source of information, enriching networking and brilliant ideas over the years: used correctly, it is by far the most useful social media around, together with YouTube. So, I’ll decide to give this a shot.
Since 2013 we offer you valuable information for free via foodlawlatest.com, and we always will. Hopefully from a new and improved web platform, once ready.
The last 2 years have been almost as challenging as fulfilling. Our company grew in staff as well in revenues, but if 2020 — despite COVID — was a smooth ride, in 2021 we were literally building the rocket while going to the moon. Therefore, this is a good occasion to both cheer for that and beg your forgiveness for every mail I answered late. We heavily invested in IT tools, education, and young talents to try to structure ourselves, and we are now riping the fruits of such efforts.
I guess this year you all had the chance to work with part of my amazing team: without them, I won’t be here. In the last months, they really doubled their efforts to raise the bar and keep our services’ quality excellent as usual.
From time to time, I’d like to share in this newsletter also interesting books, ideas, or tools that made my life and business better. Entrepreneurship — also if on a relatively small scale — is a never-ending learning process; and even if I have no ambition to bring you the “truth”, I am sure that sharing part of my fortunes (and most of all my misfortunes), might be very useful to younger readers.
That said, let me share some of the topics we are facing recently:
China: overseas manufacturing facility registration took a good share of my sleep. GACC Decree 248 and 249 are meant to be in force by the start of the new year. If you export to China and your manufacturing facility is not registered yet, is definitely the moment to be worried. You can find more info on the Malaysian authority’s website (in English) or on the USDA GAIN database, typing “overseas manufacturing registration” in the research field and selecting “China” as the country of interest. Once you understand what to do…guess what? the portal is fully in Chinese!
Italy: we are very active regarding the environment recently. From 1st Jan 2022, all packaging material marketed in Italy (and of course the food products wrapped with it) shall bear on the label, or provide via QR Code or other electronic means — suggesting on the label that such info are available online — two elements: the identification code of the material under EC Decision 129/97 and, in case the pack is destined to consumers, the sorting information (e.g. Plastic waste, Paper waste), to allow proper disposal. At the same time, we finally implemented in Italy the so-called “SUP” Directive (Single-Use Plastic) but exempted from the field of application biodegradable and compostable plastics in an open clash with the EU Commission and the Directive text. Typical Italian!
In the meantime, I saw and shared an interesting video about seaweed production and booming demand:
and started to move forward with our relatively new YouTube channel, publishing a snippet about accreditation, standards, and trust, taken from a recent webinar organized with our best friends Bert Popping and Francois Bourdichon:
That’s all, for now!
Cesare
|
https://medium.com/@foodlawlatest/food-in-the-spotlight-so-it-begins-e50f8a9ba71d
|
['Cesare Varallo']
|
2021-12-27 16:02:45.777000+00:00
|
['Lawyers', 'Food', 'Food And Drink', 'Foodies', 'Food And Beverage']
|
Title Food spotlight — “So begins…”Content starting newsletter generously acknowledging fact LinkedIn allows exchange users’ attention usual tradeoff face online platform social medium need live together fact change rule adapt strategy Truth told platform proved also amazing source information enriching networking brilliant idea year used correctly far useful social medium around together YouTube I’ll decide give shot Since 2013 offer valuable information free via foodlawlatestcom always Hopefully new improved web platform ready last 2 year almost challenging fulfilling company grew staff well revenue 2020 — despite COVID — smooth ride 2021 literally building rocket going moon Therefore good occasion cheer beg forgiveness every mail answered late heavily invested tool education young talent try structure riping fruit effort guess year chance work part amazing team without won’t last month really doubled effort raise bar keep services’ quality excellent usual time time I’d like share newsletter also interesting book idea tool made life business better Entrepreneurship — also relatively small scale — neverending learning process even ambition bring “truth” sure sharing part fortune misfortune might useful younger reader said let share topic facing recently China overseas manufacturing facility registration took good share sleep GACC Decree 248 249 meant force start new year export China manufacturing facility registered yet definitely moment worried find info Malaysian authority’s website English USDA GAIN database typing “overseas manufacturing registration” research field selecting “China” country interest understand do…guess portal fully Chinese Italy active regarding environment recently 1st Jan 2022 packaging material marketed Italy course food product wrapped shall bear label provide via QR Code electronic mean — suggesting label info available online — two element identification code material EC Decision 12997 case pack destined consumer sorting information eg Plastic waste Paper waste allow proper disposal time finally implemented Italy socalled “SUP” Directive SingleUse Plastic exempted field application biodegradable compostable plastic open clash EU Commission Directive text Typical Italian meantime saw shared interesting video seaweed production booming demand started move forward relatively new YouTube channel publishing snippet accreditation standard trust taken recent webinar organized best friend Bert Popping Francois Bourdichon That’s CesareTags Lawyers Food Food Drink Foodies Food Beverage
|
187,928 |
newest lengthy-term care insurance Claims statistics Can assist buyers due to the fact that insurance
|
compare Medicare advantage affairs and quote side-by using-facet to get the optimal expense right here.
Photo by Scott Graham on Unsplash
experts will tell you that if you are living a long existence, it’s reasonably probably that you simply’ll want what’s known as long-time period affliction. The time period frequently refers to non-clinical look after people who want advice with primary daily actions comparable to bathrobe, bathing and using the bathroom. long-time period care will also be supplied at home or in facilities that encompass nursing buildings and assisted living.
should you anytime want this category of suggestions, it s important to keep in mind that little of the cost is lined by Medicare or any deepest insurance. you will both pay out of your own discounts or, as most people do, count on members of the family and pals to provide mandatory care.
The different alternative purchasable is procuring a personal lengthy-term affliction protection. Some million americans at present accept some kind of this insurance plan that will pay for qualifying care. functions could encompass in-home care, nursing domestic care, hospice care or qualifying care in assisted residing amenities. Homemaker and personal care functions in addition to alike domestic modifications can be coated.
The charge for an insurance plan can fluctuate vastly in line with the long-term care assurance cost index. The anniversary analysis via the American affiliation for lengthy-term affliction insurance AALTCI mentioned that a couple both age fifty five could generally predict to pay amid $, and $, combined yearly reckoning on the advantages and options protected with the coverage.
|
https://medium.com/@taxrental/newest-lengthy-term-care-insurance-claims-statistics-can-assist-buyers-due-to-the-fact-that-872054658c51
|
['Samny Shakti']
|
2021-12-25 08:32:20.381000+00:00
|
['Loans', 'Lawyer', 'Tax Returns', 'Insurance', 'Attorney']
|
Title newest lengthyterm care insurance Claims statistic assist buyer due fact insuranceContent compare Medicare advantage affair quote sideby usingfacet get optimal expense right Photo Scott Graham Unsplash expert tell living long existence it’s reasonably probably simply’ll want what’s known longtime period affliction time period frequently refers nonclinical look people want advice primary daily action comparable bathrobe bathing using bathroom longtime period care also supplied home facility encompass nursing building assisted living anytime want category suggestion important keep mind little cost lined Medicare deepest insurance pay discount people count member family pal provide mandatory care different alternative purchasable procuring personal lengthyterm affliction protection million american present accept kind insurance plan pay qualifying care function could encompass inhome care nursing domestic care hospice care qualifying care assisted residing amenity Homemaker personal care function addition alike domestic modification coated charge insurance plan fluctuate vastly line longterm care assurance cost index anniversary analysis via American affiliation lengthyterm affliction insurance AALTCI mentioned couple age fifty five could generally predict pay amid combined yearly reckoning advantage option protected coverageTags Loans Lawyer Tax Returns Insurance Attorney
|
187,929 |
Should You Create a power of legal professional? Rodney Diggs Attorney at Law
|
There are a few exceptions as the right to get married or vote. As an individual and fundamental you may supply unlimited energy called a fashionable power of attorney.
The lawyer-in-truth commonly can simplest carry out an action if the character and fundamental can exercise the same electricity. This stops the attorney-in-reality from appearing whilst the essential is incapacitated.
According to Attorney Rodney Diggs, a character is not able to signal an agreement the lawyer-in-reality is also not able to sign a contract for the most important. But when you have durable electricity of lawyer the lawyer-in-truth is authorized to execute the powers granted using the predominant even after the principal turns into unwell.
On the Time of loss of life A strength of attorney Ends
Whether you have a long-lasting strength of attorney or you do not, at the time of death all energy of attorney ends. If the character and principal have granted lawyer-in-fact rights to carry out certain obligations, upon loss of life all those rights are terminated.
How A power of attorney is Revoked
As long as you’re alive you have got the strength to revoke the power of a lawyer. To revoke the electricity of a lawyer you have to contact your legal professional-in-truth that the strength of attorney has been revoked. You may additionally detail at what date the power of the lawyer will expire.
Springing power of lawyer
The electricity of a lawyer may be designed to spring into effect if you come to be disabled or at a few predetermined times or occasions. That is a springing power of a lawyer. The springing electricity of a lawyer prevents your legal professional-in-fact from the use of the powers whilst you’re able to attend to them yourself.
The attorney-in-fact must prove that the character wherein your powers are involved is in reality disabled and cannot perform the duties needed. You may want a written file from the medical doctor or hospital that you are incapacitated.
It ought to be a cutting-edge record and now not several days antique or it can be wondered as to whether you’re nevertheless sick or disabled. So that you can shop yourself, deliver turmoil, and be required to supply a greater cutting-edge document take care of it the equal day.
On the spot energy of lawyer
Your powers of legal professional can emerge as effective without delay, as quickly as it’s far signed, this is the sort of power of attorney humans use when they’ll be in a foreign country for a long period and will not be available to deal with such matters. It’s miles commonly durable energy of lawyer on the way to expire in twelve months.
You can also have provisions built into the powers of a lawyer will you may volume it. In case you grow to be incompetent or sick whilst the power of lawyer expires, and you’re attorney-in-truth or agent, will need to head earlier than the court docket to get approval to keep.
Scientific choices
If you have long-lasting energy of attorney it may be used to allow your legal professional-in-reality the energy to make medical decisions in case you come to be incapacitated.
Most individuals have separate strengths of lawyers for clinical and economic affairs. Now and again the equal person handles both powers of legal professionals.
How to pick out your attorney- In-fact
Considering that is one of the maximum vital documents of your life it is going without announcing it needs to be the maximum trusted of human beings with impeccable credentials who recognize your needs And a way to cope with your commercial enterprise.
A different element to undergo in thoughts is whilst you supply a person this energy they have the potential to do as they desire, and won’t follow your instructions. It is why you have to be very careful. In terms of money occasionally humans do things for their very own interest. Your legal professional-in-reality is a fiduciary said “Rodney Diggs Esq”.
This means that that they may be there to manage your property that will help you, and no longer themselves. The character you pick might be known as under difficult situations. So normally it will likely be a family member or a close friend and on occasion a lawyer you agree with and respect. If you do not have an energy of attorney in an area it’s going to fall to the laws of the country.
|
https://medium.com/@rodneydiggsattorney/should-you-create-a-power-of-legal-professional-rodney-diggs-attorney-at-law-468085de253d
|
['Rodney Diggs Attorney']
|
2021-12-23 10:04:16.272000+00:00
|
['Justice', 'Lawyer', 'Law', 'Attorney', 'Court']
|
Title Create power legal professional Rodney Diggs Attorney LawContent exception right get married vote individual fundamental may supply unlimited energy called fashionable power attorney lawyerintruth commonly simplest carry action character fundamental exercise electricity stop attorneyinreality appearing whilst essential incapacitated According Attorney Rodney Diggs character able signal agreement lawyerinreality also able sign contract important durable electricity lawyer lawyerintruth authorized execute power granted using predominant even principal turn unwell Time loss life strength attorney Ends Whether longlasting strength attorney time death energy attorney end character principal granted lawyerinfact right carry certain obligation upon loss life right terminated power attorney Revoked long you’re alive got strength revoke power lawyer revoke electricity lawyer contact legal professionalintruth strength attorney revoked may additionally detail date power lawyer expire Springing power lawyer electricity lawyer may designed spring effect come disabled predetermined time occasion springing power lawyer springing electricity lawyer prevents legal professionalinfact use power whilst you’re able attend attorneyinfact must prove character wherein power involved reality disabled cannot perform duty needed may want written file medical doctor hospital incapacitated ought cuttingedge record several day antique wondered whether you’re nevertheless sick disabled shop deliver turmoil required supply greater cuttingedge document take care equal day spot energy lawyer power legal professional emerge effective without delay quickly it’s far signed sort power attorney human use they’ll foreign country long period available deal matter It’s mile commonly durable energy lawyer way expire twelve month also provision built power lawyer may volume case grow incompetent sick whilst power lawyer expires you’re attorneyintruth agent need head earlier court docket get approval keep Scientific choice longlasting energy attorney may used allow legal professionalinreality energy make medical decision case come incapacitated individual separate strength lawyer clinical economic affair equal person handle power legal professional pick attorney Infact Considering one maximum vital document life going without announcing need maximum trusted human being impeccable credential recognize need way cope commercial enterprise different element undergo thought whilst supply person energy potential desire won’t follow instruction careful term money occasionally human thing interest legal professionalinreality fiduciary said “Rodney Diggs Esq” mean may manage property help longer character pick might known difficult situation normally likely family member close friend occasion lawyer agree respect energy attorney area it’s going fall law countryTags Justice Lawyer Law Attorney Court
|
187,930 |
Constitution of Pakistan
|
Book Review
The constitution of the Islamic republic of Pakistan, ( آئین پاکستان) which is also known as the 1973 constitution, is the supreme law of Pakistan. It was drafted by the government of Shaheed Zulfiqar Ali Bhutto with the assistance of the opposition parties of the country. It was approved by the Parliament on 10th April and ratified on 12th April, 1973 by the President of Pakistan. The constitution is intended to guide the Pakistan’s law, its political culture, and system. It identifies the physical existence and its borders, people and their fundamental rights, constitutional laws and orders of the state, and also the constitutional structure and establishment of the institutions and the country’s armed forces. The first three chapters establish the rules, mandate, and separate powers of the three branches of the government: a bicameral legislature; an executive branch governed by the Prime Minister as chief executive; and an apex federal judiciary headed by the Supreme court.
The 1973 constitution contains 280 articles and 7 schedules, and establishes a centralized federal system. The first six articles of the constitution outline the political system as federal parliamentary republic system; as well as Islam as its state religion. The Constitution also encapsulates provisions stipulating the legal system’s compliance with Islamic injunctions contained in the Quran and Sunnah. The Parliament cannot make any laws which may be repugnant or contrary to the Constitution, however the Constitution itself may be amended by a two-thirds majority in both the houses of the bicameral Parliament. Articles 1–6 are known as the introductory part of the constitution, in which State territories and other basic information is discussed. The Objective Resolution is also the substantive part of constitution written in Article 2A. Articles 7–28 comprises the Fundamental Rights related articles, in which all aspects of Rights are covered. Articles 29–40 are related to the Principles of Policy which covered policy of State regards all aspects of life and citizens. Articles 41–100 are related to the Federation of Pakistan which covers the office of President, Prime Minister and Federal cabinet, both the National assembly and Senate, and the rules and regulation for both of the houses. Articles 101–140A are related to the Provinces of Pakistan and duties and rights of the provincial governments. Articles 141–159 are related to the relation and responsibilities between the State and the Provinces. The responsibilities of federal and provincial government and their unity on the affairs of the State. Articles 160–159 are related to matters of Finance, Property, Contracts and Suits. Articles 175–212 are related to the role, responsibilities, the Jurisdiction, and the hierarchy of the courts. Articles 213–226 are related to Election process and about the role and responsibilities of the Election Commission of Pakistan. Articles 227–231 are related to the Islamic provisions. Articles 232–237 are related to the Emergency situation of the country. Articles 238–239 are related to the Amendment of Constitution, which explains the process to amend the constitution. Articles 240–280 are miscellaneous which explains different things which need to be answered.
|
https://medium.com/@ak9yyz/constitution-of-pakistan-199860b86c
|
['Abid Khan']
|
2021-12-31 17:38:07.076000+00:00
|
['Lawyers', 'Constitution', 'Law']
|
Title Constitution PakistanContent Book Review constitution Islamic republic Pakistan آئین پاکستان also known 1973 constitution supreme law Pakistan drafted government Shaheed Zulfiqar Ali Bhutto assistance opposition party country approved Parliament 10th April ratified 12th April 1973 President Pakistan constitution intended guide Pakistan’s law political culture system identifies physical existence border people fundamental right constitutional law order state also constitutional structure establishment institution country’s armed force first three chapter establish rule mandate separate power three branch government bicameral legislature executive branch governed Prime Minister chief executive apex federal judiciary headed Supreme court 1973 constitution contains 280 article 7 schedule establishes centralized federal system first six article constitution outline political system federal parliamentary republic system well Islam state religion Constitution also encapsulates provision stipulating legal system’s compliance Islamic injunction contained Quran Sunnah Parliament cannot make law may repugnant contrary Constitution however Constitution may amended twothirds majority house bicameral Parliament Articles 1–6 known introductory part constitution State territory basic information discussed Objective Resolution also substantive part constitution written Article 2A Articles 7–28 comprises Fundamental Rights related article aspect Rights covered Articles 29–40 related Principles Policy covered policy State regard aspect life citizen Articles 41–100 related Federation Pakistan cover office President Prime Minister Federal cabinet National assembly Senate rule regulation house Articles 101–140A related Provinces Pakistan duty right provincial government Articles 141–159 related relation responsibility State Provinces responsibility federal provincial government unity affair State Articles 160–159 related matter Finance Property Contracts Suits Articles 175–212 related role responsibility Jurisdiction hierarchy court Articles 213–226 related Election process role responsibility Election Commission Pakistan Articles 227–231 related Islamic provision Articles 232–237 related Emergency situation country Articles 238–239 related Amendment Constitution explains process amend constitution Articles 240–280 miscellaneous explains different thing need answeredTags Lawyers Constitution Law
|
187,931 |
What Should Look In A Lawyer?
|
If you face a dispute or file a lawsuit against an individual or a party, the decision is always in the hand of the most critical person in the situation. So naturally, many of you think about the Judge. But the answer in this regard is no! The most valuable person, in any case, is the lawyer. Therefore, below are some of the essential qualities you should look for when hiring one.
Understanding Client
Competence and decency are qualities and characteristics of lawyers or advocates who understand how to treat their clients. The priority of a lawyer or advocate must be the client’s well-being, which must be taken into account and acknowledged in the fact that the client is the only person who can arrange for your and your family’s bread and butter, and thus must be handled with the utmost respect and sincerity.
Knowing and evaluating the client’s needs enables the Attorney to act and perform per the client’s business sector and industry, meeting and benefiting the client’s needs. Therefore, only a favorable conclusion can be expected from a lawyer or advocate who is well-versed in his client’s business when working and performing on behalf of his clients.
Management
It is usual to find that leadership skills are not required in a small practice, and management skills are not required at a high level. But, on the other hand, primary firm leadership abilities play a key and significant role in determining whether a lawyer or advocate is a leader or a follower in terms of skill-set and thought process.
Coordination
Coordination is an essential and generic feature that facilitates the administration of a project involving many countries, lawyers or advocates working in diverse professions, and enterprises operating at different speeds. To do, perform, and manage the project(s) at hand, lawyers or advocates involved in the cross-border transaction(s) or case(s) must have coordination skills.
Sympathy
The lawyer or advocate must deal with all circumstances and incidents as quickly as feasible. A lawyer or advocate’s responsive behavior includes timely research, preparation, execution, and being present on the hearing date. The Honorable Judge and the client(s) value this level of expertise and quality (s). As a result, this talent, skill, or trait boosts a lawyer’s or advocate’s worth and demand in the marketplace.
Balanced Personality
A lawyer must possess a mixture of qualities that are a part of his balanced personality, in addition to professionalism and ethics. He may connect several events in his client’s case to explain the events to the Honorable judges and ensure his performance in a Court of Law. It is necessary to keep an equilibrium to help the client’s case.
|
https://medium.com/@davidalessilawyer/what-should-look-in-a-lawyer-5d82627d093e
|
['David Alessi - Lawyer']
|
2021-12-31 15:37:59.440000+00:00
|
['David Alessi', 'Lawyer']
|
Title Look LawyerContent face dispute file lawsuit individual party decision always hand critical person situation naturally many think Judge answer regard valuable person case lawyer Therefore essential quality look hiring one Understanding Client Competence decency quality characteristic lawyer advocate understand treat client priority lawyer advocate must client’s wellbeing must taken account acknowledged fact client person arrange family’s bread butter thus must handled utmost respect sincerity Knowing evaluating client’s need enables Attorney act perform per client’s business sector industry meeting benefiting client’s need Therefore favorable conclusion expected lawyer advocate wellversed client’s business working performing behalf client Management usual find leadership skill required small practice management skill required high level hand primary firm leadership ability play key significant role determining whether lawyer advocate leader follower term skillset thought process Coordination Coordination essential generic feature facilitates administration project involving many country lawyer advocate working diverse profession enterprise operating different speed perform manage project hand lawyer advocate involved crossborder transaction case must coordination skill Sympathy lawyer advocate must deal circumstance incident quickly feasible lawyer advocate’s responsive behavior includes timely research preparation execution present hearing date Honorable Judge client value level expertise quality result talent skill trait boost lawyer’s advocate’s worth demand marketplace Balanced Personality lawyer must posse mixture quality part balanced personality addition professionalism ethic may connect several event client’s case explain event Honorable judge ensure performance Court Law necessary keep equilibrium help client’s caseTags David Alessi Lawyer
|
187,932 |
What Can I Expect From a Personal Injury Claim?
|
Regardless of what you see in the movies, most lawsuits are boring and tedious, with hundreds of details that must be dealt with before you may see a resolution. Most people aren’t familiar with the steps and complexities involved with personal injury claims. Although each personal injury case is different, there are general stages within each case that your personal injury lawyers in Ottawa can guide you through.
Typical Steps in a Personal Injury Lawsuit
If you are injured through someone’s negligence, the first step is to get medical treatment. Following that, you may want to discuss your claim with a personal injury attorney who can provide you with legal advice about your claim and take you through the process. Working with your Ottawa personal injury law firm, you can expect these stages:
Your attorney will need to gather evidence that supports your claim. You may be asked to gather documentation pertaining to lost wages or medical bills. Your attorney may send you to experts for exams and assessments.
Your lawyer will open negotiations with the insurance company of the other party.
Your case may settle out of court. Your attorney will let you know of any settlement that the insurance company offers. You decide whether you want to accept or not.
Filing a lawsuit in court if you cannot reach a settlement.
Waiting as the case progresses through the pretrial phases.
The case may go to mediation before you have an actual trial.
The trial and verdict.
Experienced Personal Injury Lawyers in Ottawa
Personal injury law is complex. Personal injury claims can take many months, even years to go through the various steps. Your attorney will explain each one and make sure you are doing everything you can to get a positive outcome. Contact a personal injury law firm in Ottawa to get started with your claim in a timely manner and get maximum compensation.
Originally Posted on Quinn Thiele Mineault Grodzki LLP
|
https://medium.com/@ottawalawyers1/what-can-i-expect-from-a-personal-injury-claim-63aa85c9d8d7
|
['Ottawa Lawyers']
|
2021-12-24 05:33:25.457000+00:00
|
['Lawyers', 'Injury', 'Attorney', 'Lawsuit', 'Ottawa']
|
Title Expect Personal Injury ClaimContent Regardless see movie lawsuit boring tedious hundred detail must dealt may see resolution people aren’t familiar step complexity involved personal injury claim Although personal injury case different general stage within case personal injury lawyer Ottawa guide Typical Steps Personal Injury Lawsuit injured someone’s negligence first step get medical treatment Following may want discus claim personal injury attorney provide legal advice claim take process Working Ottawa personal injury law firm expect stage attorney need gather evidence support claim may asked gather documentation pertaining lost wage medical bill attorney may send expert exam assessment lawyer open negotiation insurance company party case may settle court attorney let know settlement insurance company offer decide whether want accept Filing lawsuit court cannot reach settlement Waiting case progress pretrial phase case may go mediation actual trial trial verdict Experienced Personal Injury Lawyers Ottawa Personal injury law complex Personal injury claim take many month even year go various step attorney explain one make sure everything get positive outcome Contact personal injury law firm Ottawa get started claim timely manner get maximum compensation Originally Posted Quinn Thiele Mineault Grodzki LLPTags Lawyers Injury Attorney Lawsuit Ottawa
|
187,933 |
If You Need a Great Attorney, This Is the Way to Go | Rodney Diggs Attorney at Law
|
If You Need a Great Attorney, This Is the Way to Go | Rodney Diggs Attorney at Law Rodney Diggs Attorney Dec 29, 2021·3 min read
Are you in need of a great Wisconsin lawyer? In case you are from Wisconsin and want a remarkable attorney, Rodney Diggs Esq is the exceptional manner to move.
The country of Wisconsin has few cities and Madison is your fine wager if you are seeking out an extraordinary legal profession. Whoever lawyer you’ll hire, there may be no assurance that you will win the case.
However, if you may hire an attorney from Madison, you’ll have higher possibilities of triumphing the case. This town is known for having some of the excellent legal professionals in Wisconsin and the Midwest.
When you need an incredible Wisconsin attorney, Attorney Rodney Diggs is the first-rate place order to go to.
Regardless of the form of crime or fees which you are dealing with, you can discover the quality legal professionals in this town. From insurance claims to DUI and from drug possessions to homicide, the regulation firms in Madison have a lot to provide.
As the home of many first-rate lawyers inside the Midwest, you’ll discover a whole lot of precise lawyers in Madison. Deciding on can be a bit tough so here are some characteristics of lawyers that you can choose to compare whilst looking for a lawyer in Madison.
First, you need to search for their reports. Examine their education history and the courts wherein they had been skilled. You need to additionally search for their years of carrier. A few regulation firms claim to have decades of revel in. Take a look at if those years of revel in are collective or now not.
Selecting an attorney with the highest years of revel in can be an amazing alternative however not the sole foundation of legal excellence. As an instance, maximum old lawyers have more years of experience in trials however some new attorneys may be aggressive and top-notch in representing their clients. Understanding their backgrounds is absolutely a ought to if you want to get a quality legal professional.
Second, you ought to also search for the specialties of the lawyers. There are a few attorneys that would provide great felony carrier to many fields but there are some who concentrate on certain fields. As an instance, there are a few attorneys who concentrate on insurance claims even as others would be the remarkable desire for DUI or drug ownership.
Most attorneys and law firms in Madison have websites these days and there are profiles of lawyers. It is going to be tons less difficult if you want to examine and select the attorney who ought to provide great legal guidance and carrier for you said.
Third, you must additionally search for the satisfaction of the lawyer’s preceding clients. It’s far normal for most attorneys to lose some instances. But, outstanding Madison lawyers should be capable of reducing the costs or penalties for his or her dropping customer. This will consist of lowering the times to be spent in jail or decreasing the monetary penalty.
Ultimately, you ought to also recollect the felony price. Many attorneys ask for low rates but if you will want the best legal service and inexpensive rate given from a Wisconsin lawyer, Rodney Diggs Attorney at Law is the satisfactory manner to head. Whilst you need a Wisconsin legal professional.
|
https://medium.com/@rodneydiggsattorney/if-you-need-a-great-attorney-this-is-the-way-to-go-rodney-diggs-attorney-at-law-6253f4a34a43
|
['Rodney Diggs Attorney']
|
2021-12-29 09:37:10.587000+00:00
|
['Lawyer', 'Law', 'Attorney', 'Court', 'Rodneydiigs']
|
Title Need Great Attorney Way Go Rodney Diggs Attorney LawContent Need Great Attorney Way Go Rodney Diggs Attorney Law Rodney Diggs Attorney Dec 29 2021·3 min read need great Wisconsin lawyer case Wisconsin want remarkable attorney Rodney Diggs Esq exceptional manner move country Wisconsin city Madison fine wager seeking extraordinary legal profession Whoever lawyer you’ll hire may assurance win case However may hire attorney Madison you’ll higher possibility triumphing case town known excellent legal professional Wisconsin Midwest need incredible Wisconsin attorney Attorney Rodney Diggs firstrate place order go Regardless form crime fee dealing discover quality legal professional town insurance claim DUI drug possession homicide regulation firm Madison lot provide home many firstrate lawyer inside Midwest you’ll discover whole lot precise lawyer Madison Deciding bit tough characteristic lawyer choose compare whilst looking lawyer Madison First need search report Examine education history court wherein skilled need additionally search year carrier regulation firm claim decade revel Take look year revel collective Selecting attorney highest year revel amazing alternative however sole foundation legal excellence instance maximum old lawyer year experience trial however new attorney may aggressive topnotch representing client Understanding background absolutely ought want get quality legal professional Second ought also search specialty lawyer attorney would provide great felony carrier many field concentrate certain field instance attorney concentrate insurance claim even others would remarkable desire DUI drug ownership attorney law firm Madison website day profile lawyer going ton le difficult want examine select attorney ought provide great legal guidance carrier said Third must additionally search satisfaction lawyer’s preceding client It’s far normal attorney lose instance outstanding Madison lawyer capable reducing cost penalty dropping customer consist lowering time spent jail decreasing monetary penalty Ultimately ought also recollect felony price Many attorney ask low rate want best legal service inexpensive rate given Wisconsin lawyer Rodney Diggs Attorney Law satisfactory manner head Whilst need Wisconsin legal professionalTags Lawyer Law Attorney Court Rodneydiigs
|
187,934 |
5 Tips to Avoid Common Financial Issues in Law Firms
|
Running a law firm is a task with a lot of responsibilities involved, there are countless tasks to ensure proper stability in the financial health of a law firm. There is a lot involved in the financial management of a law firm. Fortunately, with a good analysis of law firm finances, firms can take out the benefits of proper usage of billable hours & legal billing, but with many things on the plate, it’s vital to keep an eye on certain challenges law firms usually face maintaining a proper financial system. So we are here with a few challenges that law firms usually face and how to conquer the journey towards a better financial system in the law firm:
Inadequate Cash Flow- Cash flow is the money moving into and out of a law firm every month. It comes in as clients pay the fees and it goes out in the form of incurring expenses of the firm. When more money moves out than comes in, law firm experiences inadequate cash flow. Law firms have highs and lows all around the year some months are booming some times nothing is coming from the door. That’s why a long firm needs to keep an eye on their cash flow in the booming period so they can make a reserve for times when there is least business.
To bring out the most of the booming period, law firms should have payment options that are more feasible to clients. In an ideal situation, law firms will have enough savings to cover six months of expenses, but there are other steps that law firms can take to increase cash flow, sending invoices promptly, offering alternative payment options, billing often and consistently, and offering online payment options. Law firms operating on sufficient cash flow is a vital part of having a healthy financial system
Excessive Overhead Costs- Maintaining a healthy financial system starts from controlling excessive overheads costs, having too many overhead costs and expenses with adequate cash flow can keep law firms away from reaching their maximum profit potential.
While some expenses are avoidable but many expenses can be eliminated or reduced, like try delegating administrative work from staff to automated legal tech solutions and assigning staff with more crucial work that can increase profit and reduce time for other tasks.
Inadequate Administrative Support — As discussed above, law firms seek to reduce overhead costs so they may try to reduce support staff by a number or so but removing support staff can also lead to legal services inefficiency.
lack in the number of support staff may lead to missed deadlines, loss of paperwork, or paperwork not ready on time. Keeping this point on the top, outsourcing will be the most feasible and affordable option, outsourcing will fill up the gap of inefficiency with much less money. For example, law firms can hire a paralegal rather than hiring a full-time employee and keep the paralegal until the need subsides.
Stagnant Earnings- Reducing expenses and overhead costs are crucial to maintaining a successful law firm for its financial health, but increased earnings are also a need for the law firm.
The law firm should always keep an out for growth opportunities. It may mean taking on additional hours and efforts to boost up the earrings like taking a few extra cases for some bar counsel. Stagnant earnings may indicate that it’s time to ramp up marketing strategies and attract new clients.
Lack of Written Agreements — Law firms need to use Engagement Letters these days to explain and have a better understanding with the client. The Engagement letter should define work, the discussed rates the client will pay for the case, how often the client will be billed, and any interest fees if any the firm charges for late payments. It should be signed by both parties.
Non-representation letters are often overlooked by law firms. If a law firm stops working for a client or client handles a case to a different law firm it is important to send a non-representation letter to the other party, so that there can be no claim made that the law firm was responsible for handling the matter.
Lawyers have countless things on their plate and maintaining financial health becomes quite a task for them, even though financial management of a law firm is a vital part of proper functioning it’s hard to rectify where things went wrong or where you can start by rectifying the cash flow, these above discussed are most commonly faced challenges by law firms. Hope our blog will help you in some or another way.
Also Read: Law Firm Billing Problems and Solutions to Avoid Them
|
https://medium.com/@mattersuite/5-tips-to-avoid-common-financial-issues-in-law-firms-6aa5341b825f
|
[]
|
2021-12-28 15:05:23.410000+00:00
|
['Lawyers', 'Finance Management', 'Legaltech', 'Legal', 'Law Firm']
|
Title 5 Tips Avoid Common Financial Issues Law FirmsContent Running law firm task lot responsibility involved countless task ensure proper stability financial health law firm lot involved financial management law firm Fortunately good analysis law firm finance firm take benefit proper usage billable hour legal billing many thing plate it’s vital keep eye certain challenge law firm usually face maintaining proper financial system challenge law firm usually face conquer journey towards better financial system law firm Inadequate Cash Flow Cash flow money moving law firm every month come client pay fee go form incurring expense firm money move come law firm experience inadequate cash flow Law firm high low around year month booming time nothing coming door That’s long firm need keep eye cash flow booming period make reserve time least business bring booming period law firm payment option feasible client ideal situation law firm enough saving cover six month expense step law firm take increase cash flow sending invoice promptly offering alternative payment option billing often consistently offering online payment option Law firm operating sufficient cash flow vital part healthy financial system Excessive Overhead Costs Maintaining healthy financial system start controlling excessive overhead cost many overhead cost expense adequate cash flow keep law firm away reaching maximum profit potential expense avoidable many expense eliminated reduced like try delegating administrative work staff automated legal tech solution assigning staff crucial work increase profit reduce time task Inadequate Administrative Support — discussed law firm seek reduce overhead cost may try reduce support staff number removing support staff also lead legal service inefficiency lack number support staff may lead missed deadline loss paperwork paperwork ready time Keeping point top outsourcing feasible affordable option outsourcing fill gap inefficiency much le money example law firm hire paralegal rather hiring fulltime employee keep paralegal need subsides Stagnant Earnings Reducing expense overhead cost crucial maintaining successful law firm financial health increased earnings also need law firm law firm always keep growth opportunity may mean taking additional hour effort boost earring like taking extra case bar counsel Stagnant earnings may indicate it’s time ramp marketing strategy attract new client Lack Written Agreements — Law firm need use Engagement Letters day explain better understanding client Engagement letter define work discussed rate client pay case often client billed interest fee firm charge late payment signed party Nonrepresentation letter often overlooked law firm law firm stop working client client handle case different law firm important send nonrepresentation letter party claim made law firm responsible handling matter Lawyers countless thing plate maintaining financial health becomes quite task even though financial management law firm vital part proper functioning it’s hard rectify thing went wrong start rectifying cash flow discussed commonly faced challenge law firm Hope blog help another way Also Read Law Firm Billing Problems Solutions Avoid ThemTags Lawyers Finance Management Legaltech Legal Law Firm
|
187,935 |
HOW DO I LOSE BELLY FAT
|
Belly fat is more than a nuisance that makes your clothes feel tight.
It’s severely harmful.
One form of belly fat- called visceral — is a major risk factor for type 2 diabetes, heart disease, and other conditions (1Trusted Source).
Many health organizations use body mass index (BMI) to categorize weight and predict the risk of metabolic disease.
However, this is misleading, as humans with excess belly fat are at an increased risk even if they look thin (2Trusted Source).
Though losing fat from this area can be difficult, there are several things you can do to reduce excess abdominal fat.
Here are 8 effective tips to lose belly fat, backed by scientific studies
Eat plenty of soluble fiber
Soluble fiber can additionally assist you to lose weight by increasing fullness and reducing calorie absorption. Try to include plenty of high fiber foods in your weight loss diet.
2. Avoid foods that contain trans fats
Some research have linked a high intake of trans fat to increased belly fat gain. Regardless of whether you’re trying to lose weight, limiting your intake of trans fat is a good idea.
3. Don’t drink too much alcohol
Excessive alcohol consumption has been associated with increased belly fat. If you need to reduce your waistline, consider drinking alcohol in moderation or abstaining completely.
4. Eat a high protein diet
High protein foods, including fish, lean meat, and beans, are best if you’re looking to shed a few more kilos round your waist.
5. Reduce your stress levels
Stress may promote fat gain around your waist. Minimizing stress should be one of your priorities if you’re trying to lose weight.
6. Don’t eat a lot of sugary foods
Excessive sugar intake is a major cause of weight gain in many people. Limit your intake of candy and processed foods high in added sugar.
7. Do aerobic exercise (cardio)
Aerobic exercise is an effective weight loss method. Studies suggest it’s particularly effective at slimming your waistline.
8. Cut back on carbs — especially refined carbs
A high intake of refined carbs is associated with excessive belly fat. Consider reducing your carb intake or replacing refined carbs in your diet with healthy carb sources, such as whole grains, legumes, or vegetables.
I Recommend you The best flat belly Tonic and also A Custom Keto Diet Plan for a healthy weight loss
If you found This helpful, please Upvote
|
https://medium.com/@ifeanyindubuisi240/how-do-i-lose-belly-fat-e8aa03e097bc
|
['Ifeanyi Ndubuisi']
|
2021-12-19 12:30:22.890000+00:00
|
['Ketogenic Diet', 'How To Lose Belly Fat', 'Keto', 'How To Lose Weight Fast', 'Keto Diet']
|
Title LOSE BELLY FATContent Belly fat nuisance make clothes feel tight It’s severely harmful One form belly fat called visceral — major risk factor type 2 diabetes heart disease condition 1Trusted Source Many health organization use body mass index BMI categorize weight predict risk metabolic disease However misleading human excess belly fat increased risk even look thin 2Trusted Source Though losing fat area difficult several thing reduce excess abdominal fat 8 effective tip lose belly fat backed scientific study Eat plenty soluble fiber Soluble fiber additionally assist lose weight increasing fullness reducing calorie absorption Try include plenty high fiber food weight loss diet 2 Avoid food contain trans fat research linked high intake trans fat increased belly fat gain Regardless whether you’re trying lose weight limiting intake trans fat good idea 3 Don’t drink much alcohol Excessive alcohol consumption associated increased belly fat need reduce waistline consider drinking alcohol moderation abstaining completely 4 Eat high protein diet High protein food including fish lean meat bean best you’re looking shed kilo round waist 5 Reduce stress level Stress may promote fat gain around waist Minimizing stress one priority you’re trying lose weight 6 Don’t eat lot sugary food Excessive sugar intake major cause weight gain many people Limit intake candy processed food high added sugar 7 aerobic exercise cardio Aerobic exercise effective weight loss method Studies suggest it’s particularly effective slimming waistline 8 Cut back carbs — especially refined carbs high intake refined carbs associated excessive belly fat Consider reducing carb intake replacing refined carbs diet healthy carb source whole grain legume vegetable Recommend best flat belly Tonic also Custom Keto Diet Plan healthy weight loss found helpful please UpvoteTags Ketogenic Diet Lose Belly Fat Keto Lose Weight Fast Keto Diet
|
187,936 |
How to lose 20 kg weight to follow keto diet
|
So you’re ready to adapt to a ketogenic diet to lose weight and improve your healthy. You’ve come to the right place, making any big lifestyle or diet changes can be challenging, especially at first. There are a lot of new routines to learn in old habits to unlearn, but we’ve seen over and over again with the people in the world meet community that over time, keto becomes the new normal, and the dramatic results are so worth it. We what’s the best way to get started with a ketogenic diet here, we’ll outline 3 steps to key to success, but first. Let’s define what a keto diet is. Simply put, it is a high fat, low carb, low to moderate protein diet by drastically restricting carbohydrates in your diet. The body will enter and sustain ketosis. A metabolic state where the body burns a highly efficient alternative fuel called ketones, not only does the Keto diet help with weight loss, but current research also indicates that it can help to improve health conditions like heart disease, type 2 diabetes and alzheimer’s disease to start your keto journey off on the right foot here are our top three key pieces of advice. Eat the right foods, eat the right amount of those foods. And prepare for the Keto flu. Let’s start with food. Your goal on a consistent basis is to replace carb heavy foods with keto friendly foods. This will help you eat fewer calories than before and help jump, start and sustain ketosis, you will need to focus on meat, high fat dairy and healthy oils, leafy green and above ground vegetables. Nuts and seeds. Avocado and heater approved sweeteners you’ll need to entirely avoid grains, sugar, fruit and starchy vegetables. For more info. See our video Keto cooking keto food list for plenty more information on what to eat and what not to eat on keto. You’ll be relying a lot more on home cooked food than package process or prepared foods. It’s important to know that you don’t have to figure out how to do this on your own. There are so many resources on ruled me, including meal plans. Shopping lists, budget breakdowns and recipes. We’ll teach you to avoid common pitfalls. How to read labels and nutritional information, and which keto foods can be swapped and substituted for foods that are off limits, you might be surprised how many things like for bread, pasta. Cookies and ice cream you can still enjoy if you just learn how to make them keto friendly, it’s not just eating the right food, so that is the foundation of the diet. You must also learn how much to eat, which brings us to our second point. A keto diet can help you to restrict your calorie intake in a slow and steady way, which leads to long term weight loss, but it can be hard to do this if you’re not carefully tracking what you eat, one way to figure out how much you should be eating on a keto diet is to check on your progress every few weeks and adjust accordingly. If you’re not seeing the results you want, you. Can also use the ruled me keto calculator, which we find to be a more precise method. You’ll also need to track your macro nutrients or macros. Those are fats, carbs and protein which need to be captain careful balance to keep your body in ketosis. As a general rule, we recommend eating below 35 grams of carbs and aiming to get 70 percent of your calories from fat and 25 percent from protein. The keto calculator can help you dial in exactly what to be aiming for each day. We’ll keep you on track for a deeper dive into macros. Check out our video macros and keto calculator. Finally, when you’re starting out on a ketogenic diet, you must prepare for the keto flew when you first cut back on carbohydrates. Your body will experience some changes as it adjusts to your lifestyle. One possible change is the Keto flu. An umbrella term for the flu like symptoms you may encounter like fatigue or mental fogginess. Usually these symptoms only last a short while, but it is best to be prepared. You will need to drink more water. Increase your sodium, potassium and magnesium intake, and eat more fat, especially on c ts. Most importantly, check in with yourself from time to time to monitor the changes in your body composition and how you feel to be sure that the ketogenic diet is the right choice for you for more info on keto, be sure to watch the other ruled knee videos and check out the wealth of information on our website, roll darkness.
|
https://medium.com/@nehaljabbar223/how-to-lose-20-kg-weight-to-follow-keto-diet-f01dd29a30e8
|
[]
|
2021-12-27 18:39:53.518000+00:00
|
['Excercise', 'Ketogenic Diet', 'Lose Weight', 'Keto']
|
Title lose 20 kg weight follow keto dietContent you’re ready adapt ketogenic diet lose weight improve healthy You’ve come right place making big lifestyle diet change challenging especially first lot new routine learn old habit unlearn we’ve seen people world meet community time keto becomes new normal dramatic result worth what’s best way get started ketogenic diet we’ll outline 3 step key success first Let’s define keto diet Simply put high fat low carb low moderate protein diet drastically restricting carbohydrate diet body enter sustain ketosis metabolic state body burn highly efficient alternative fuel called ketone Keto diet help weight loss current research also indicates help improve health condition like heart disease type 2 diabetes alzheimer’s disease start keto journey right foot top three key piece advice Eat right food eat right amount food prepare Keto flu Let’s start food goal consistent basis replace carb heavy food keto friendly food help eat fewer calorie help jump start sustain ketosis need focus meat high fat dairy healthy oil leafy green ground vegetable Nuts seed Avocado heater approved sweetener you’ll need entirely avoid grain sugar fruit starchy vegetable info See video Keto cooking keto food list plenty information eat eat keto You’ll relying lot home cooked food package process prepared food It’s important know don’t figure many resource ruled including meal plan Shopping list budget breakdown recipe We’ll teach avoid common pitfall read label nutritional information keto food swapped substituted food limit might surprised many thing like bread pasta Cookies ice cream still enjoy learn make keto friendly it’s eating right food foundation diet must also learn much eat brings u second point keto diet help restrict calorie intake slow steady way lead long term weight loss hard you’re carefully tracking eat one way figure much eating keto diet check progress every week adjust accordingly you’re seeing result want also use ruled keto calculator find precise method You’ll also need track macro nutrient macro fat carbs protein need captain careful balance keep body ketosis general rule recommend eating 35 gram carbs aiming get 70 percent calorie fat 25 percent protein keto calculator help dial exactly aiming day We’ll keep track deeper dive macro Check video macro keto calculator Finally you’re starting ketogenic diet must prepare keto flew first cut back carbohydrate body experience change adjusts lifestyle One possible change Keto flu umbrella term flu like symptom may encounter like fatigue mental fogginess Usually symptom last short best prepared need drink water Increase sodium potassium magnesium intake eat fat especially c t importantly check time time monitor change body composition feel sure ketogenic diet right choice info keto sure watch ruled knee video check wealth information website roll darknessTags Excercise Ketogenic Diet Lose Weight Keto
|
187,937 |
What’s the Difference Between Success and Failure on the Keto Diet?
|
Two women, each 41 years old, tried the Keto Diet.
One shed several pounds in a week by eating perfectly.
But then, she went out and drank a margarita…
And it was downhill from there as she made one simple (yet impactful) mistake…
The Second Woman Was
Also Strict At First…
She lost a few pounds during the first week…
And also went out to eat, but nothing derailed her. She avoided that one mistake… And proceeded to drop 3 dress sizes in just 14 days! She felt unstoppable!
There were no slip-ups and she was down 5 dress sizes
within 4 weeks.
So What Made The
Difference?
What was that ONE mistake?
Well, most people on a new diet have no plan.
They learn what to eat and not to eat. They try new recipes…
But, they DO NOT have a daily plan to carry them through the critical first month.
Without a plan, it’s very easy to fall for peer pressure… to be unprepared… and to make bad decisions.
So, to be clear, that ONE mistake is having no plan in place.
But we have that plan. And our plan has guided over 416,387 people to success.
Yes I Am Ready To Take The Challenge — Click Here
|
https://medium.com/@pratapb379/whats-the-difference-between-success-and-failure-on-the-keto-diet-9ebf826f07f3
|
['Jessica Slashes']
|
2021-12-22 11:18:24.704000+00:00
|
['Ketogenic Diet', 'Healthy Foods', 'Healthy Lifestyle', 'Keto', 'Keto Diet']
|
Title What’s Difference Success Failure Keto DietContent Two woman 41 year old tried Keto Diet One shed several pound week eating perfectly went drank margarita… downhill made one simple yet impactful mistake… Second Woman Also Strict First… lost pound first week… also went eat nothing derailed avoided one mistake… proceeded drop 3 dress size 14 day felt unstoppable slipups 5 dress size within 4 week Made Difference ONE mistake Well people new diet plan learn eat eat try new recipes… daily plan carry critical first month Without plan it’s easy fall peer pressure… unprepared… make bad decision clear ONE mistake plan place plan plan guided 416387 people success Yes Ready Take Challenge — Click HereTags Ketogenic Diet Healthy Foods Healthy Lifestyle Keto Keto Diet
|
187,938 |
Why Keto-Friendly Desserts on this Holiday Season?
|
The holiday season is upon us once more, and joy is in the air. Everyone seems to be fantasizing about a special favorite dish to commemorate the season.
The keto is anything from dull. There are many tasty recipes to fulfill your sweet taste and enjoy the holiday season while also helping you lose fat and without having to compromise on your health or feel sad about eating the desserts afterward.
Christmas is approaching, and you want to be able to celebrate with your loved ones by eating the tastiest Christmas cookies, cakes, and other treats. You certainly can, and you’re going to do so.
5 Delicious Keto-Friendly Dessert
Here are 5 delightful keto-friendly dessert ideas to help you have a pleasant keto Christmas. They’ll be a hit with your relatives and close ones.
1. CARROT CAKE BITES
These low-carb, vegan treats are the perfect way to satisfy a carrot cake desire. They’re rolled in grated coconut for a pretty finish, but they only take approximately 15 minutes of hands-on time (no baking required)!
Serving size: 27 calories
You’ll need the following items: 2 bowls (big and tiny)
Ingredients:
a half cup of coconut flour
1 tablespoon water + half a cup
2 tbsp applesauce (unsweetened)
a half teaspoon of vanilla essence
1 teaspoon of cinnamon
4 tablespoons granulated Fruit Sweetener*
1 medium carrot, finely sliced or grated (60–70g)
4 tablespoons shredded coconut (low-fat)
*Or 4 tbsp sugar (or other granulated sweeteners of choice)
Instructions:
1. In a large mixing dish, whisk together the coconut flour, water, applesauce, and vanilla extract.
2. Stir together the cinnamon, Lakanto, and shredded carrots in a mixing dish.
3. Allow dough to chill for 15 minutes.
4. In a small basin, sift the shredded coconut.
5. Start by removing the dough from the fridge after 15 minutes and roll it into 15 equal-sized cake balls. Each ball should be evenly coated in shredded coconut.
6. Store in the fridge for 4 to 5 days.
2. Chocolate orange spritz cookies
Spritz cookies, which are buttery and sweet, get a keto makeover. These keto Christmas cookies are ideal for a healthy holiday season, and they can be made ahead of time and frozen. This dish makes a lot of cookies, so it’s great for gift-giving. Otherwise, make half a batch of these delicious low-carb cookies and keep them all to yourself!
Ingredients:
4 cup almond flour
1/3 cup coconut flour
1 tsp baking powder
half tsp salt
2 tablespoon softened butter
a quarter cup of sweetener
2 eggs
1 cup orange zest
2 teaspoon vanilla essence
decorations:
Mini M&Ms, nonpareils, chopped nuts, and other little items can be used as decorations (optional)
Chocolate Dip: (optional)
3 oz dark chocolate (sugar-free)
Instructions:
1. Preheat the oven to 325°F for the cookies.
2. Combine almond flour, coconut flour, baking powder, and salt in a medium mixing container.
3. In a large mixing container, start mixing cream butter and sweetener for 2 minutes, or until light and fluffy. In a separate bowl, whisk together the egg, orange zest, and vanilla extract.
4. Mix in the almond flour mixture until it forms a dough.
5. Place dough in the canister of a cookie press and cover with the plate of your choosing.
6. Place cookies on cookie pans lined with parchment paper.
(At first, this will take some practice, but if you make a mistake and wind up with a glob of dough, simply pick it up and place it back into the press.)
7. Bake cookies for 12 to 14 minutes, or until firm to the touch but not too brown around the edges. They’ll still be somewhat soft.
8. Immediately after removing the cake from the oven, add any embellishments. Allow at least 15 minutes for cooling on the pans before transferring to a wire rack to cool entirely.
9. Place a bowl over a pan of slightly simmering water for the chocolate dip (the bottom of the bowl should not touch the water). Waxed paper or parchment paper should be used to line a baking sheet.
10. Stir in the chopped chocolate until it is melted and creamy (if your chocolate is too thick for coating, add some butter or oil a teaspoon at a time until the right consistency is achieved).
11. Drop one cookie at a time, face-up, into the melted chocolate, coating the bottom. Remove the chocolate with a fork and carefully tap it against the edge of the bowl to remove any excess.
12. Set cookies on a baking sheet that has been lined with parchment paper. You have the option of dipping all of the cookies, half of them, or none at all.
3. Keto Chocolate Avocado Pudding
Which do you prefer: chocolate or avocado? Why choose between the two when our Chocolate Avocado Pudding recipe allows you to have both? After all, two is preferable to one! You’ll not only be eating a decadent chocolate pudding, but you’ll also be receiving some healthy fats from the avocado. Is there a more perfect dessert than this?!
Dessert with Avocado and Two Ingredients
If you’re a member of the keto community, I’m sure you have these two ingredients on hand at all times: cocoa powder and avocado. And in that case, this delectable chocolate avocado pudding is a must-try! Simply blend with a hand mixer or by hand with a fork, and dessert is ready to eat! Add additional stevia if you want it sweeter.
Ingredients:
1 avocado
Half a cup Unsweetened Cocoa Powder
10 drops Liquid Stevia
half a teaspoon vanilla extract
1 teaspoon Pink Himalayan Salt
Remove the pit from the avocado and set it aside in a mixing dish.
Mix in the cocoa powder, stevia, and vanilla essence with a fork until you have a pudding. You can also use a hand mixer, but a fork will suffice.
Finish with a sprinkle of pink sea salt. Enjoy.
4. Low-Carb Cheesecake (Keto & Gluten-Free)
This keto dessert is ideal for sharing with family and friends.
a fork and a slice of low-carb cheesecake on a white plate
Would you believe it’s actually rather simple to adjust a typical cheesecake recipe to make it diabetes-friendly, low-carb, and gluten-free?
A few easy modifications are all it takes to produce a low-carb cheesecake!
As a result, this dessert is ideal for sharing with friends and family. Because it contains all of the same essential ingredients, it tastes just like a regular cheesecake and it’s keto-friendly.
After all, cream cheese, eggs, sugar, lemon juice, and vanilla essence make up the filling. You can rapidly cut carbs by replacing sugar with a low-carb sweetener like erythritol.
You’ll have a rich, creamy, guilt-free dessert that tastes just like the real thing when you pour it over a flaky, scrumptious low-carb crust!
There are two basic phases to making this cheesecake. To begin, combine the dough ingredients and bake the crust. Then you simply mix together the filling ingredients before pouring it over the top, baking it, and chilling it until ready to serve!
Step 1: Start off by preheating the oven to 350 degrees Fahrenheit (180 degrees Celsius).
Step 2: Combine the almond flour, shredded coconut, and salt in a large mixing basin. Mix thoroughly.
Step 3: Gently melt the butter, then stir in the liquid Stevia and the dry ingredients.
Step 4: Mix everything together thoroughly.
Step 5: Place the dough in the springform pan and pat it down evenly.
Step 6: Bake for 10–15 minutes at 350°F, or until the crust begins to turn golden brown around the edges. Allow it to cool down completely.
Step 7: Combine the cream cheese and powdered sweetener in a large mixing basin. Then, one at a time, beat in the eggs until barely combined. Finally, carefully fold in the remaining ingredients, taking care not to overmix.
Step 8: Pour the filling over the cooled crust in the springform pan. To remove any spaces or bubbles, tap the pan against the counter.
Step 9: Bake for about 50 minutes, or until the top of the cheesecake has browned and the center jiggles slightly. Allow cooling to room temperature after removing from the oven.
Step 10: Cover and chill the cheesecake for at least 4 hours or overnight once it has cooled to room temperature.
Wrap a hot towel over the sides of the pan for one minute before slicing with a hot knife to remove it.
Now it’s time to serve your low-carb cheesecake!
5. Keto coconut macaroons
These sugar-free coconut macaroons, made with shredded desiccated coconut, egg whites, and sweeteners, are not only tasty but also gluten-free, quick to make, and one of the easiest three-ingredient keto desserts.
Macaroons are little biscuits or cakes made with ground almonds or coconut and sugar and egg whites to hold them together.
This ketogenic diet-friendly, low-calorie, and sugar-free macaroons take a twist on a popular dish.
Coconut macaroons are traditionally produced with condensed milk, sugar, eggs, and coconut, however, this method typically results in a high calorie and sugar content, making them unsuitable for the keto diet.
Only sugar, egg whites, and shredded coconut are used in this recipe, making it healthier.
When you need to make a low-carb dessert for yourself or your family but don’t have anything in the house, these 3-ingredient keto coconut macaroons recipe is great.
Ingredients:
3 medium-sized egg whites, room temperature
2 cups coconut shredded
Sweetener, 1/3 cup
Instructions:
STEP 1: Preheat the oven to 320 degrees Fahrenheit (160 degrees Celsius).
STEP 2: Separate the egg whites from the yolks and place them all in a large mixing basin.
STEP 3: Using a hand mixer, whip the egg whites until stiff peaks form. This should only take a few minutes.
STEP 4: Try and not to overmix the shredded coconut and sweetener into the egg whites with care.
STEP 5: Scoop out small parts of the cookies with a 1 tablespoon measuring spoon, shaping them into balls as you go. STEP 6: Place them on the baking tray about 1/2 inch apart; they won’t rise much, so don’t worry about leaving large gaps. STEP 7: This recipe yields around 20 cookies.
STEP 8: Bake for 17–20 minutes, or until golden brown and crisp.
Which of our keto dessert recipes is your personal favorite? Do you have a suggestion for something we should try? Leave a comment in the box below!
Beloved Viewers
Vogue Wellness just began as a health and also wellness blog, striving to offer updated and also impartial information and suggestions on Health care in India and also the Globe that are of the rate of interest to its viewers, as well as have bigger political and also financial effects. Your support and constant feedback on exactly how to boost our offerings will make our commitment to these efforts more powerful. Also throughout these challenging times occurring out of COVID-19, we continue to continue to be committed to you, keeping you informed and updated with Health and wellness as well as Health news worldwide. We request you to remain at home and comply with preventive procedures and also government standards to save your life, as well as additionally those around you during these screening times.
We, nonetheless, have a request.
As we battle the economic effect of the pandemic, we need your support even a lot more, so that we can proceed to provide you extra quality web content. We anticipate extra registrations to our online blog site to attain the collection objectives so that we can provide you with much better as well as more relevant web content.
Register For Vogue Wellness-Where health thrives. , if you like the web content please do share.
Disclaimer:
As a solution to our visitors, the Vogue Wellness website gives access to our library of archived content. Please keep in mind the date of the last review or upgrade on all articles. No material on this website, despite day, ought to ever be used as a replacement for direct clinical suggestions from your physician or other qualified medical professionals.
Vogue Wellness simply kicked off as a health and wellness as well as health blog site, making every effort to give updated and honest info and guidance on Medical care in India and also the World that are of passion to its visitors, as well as have bigger political and economic ramifications. We expect extra memberships to our online blog to accomplish the collection goals so that we can provide you with much better and extra relevant content. Disclaimer: As a solution to our visitors, the Vogue Wellness portal offers accessibility to our collection of archived material.
|
https://medium.com/@info-voguewellness/why-keto-friendly-desserts-on-this-holiday-season-f4fa69cb66fc
|
['Vogue Wellness']
|
2021-12-27 09:19:18.354000+00:00
|
['Christmas', 'Diet', 'Food', 'Keto', 'New York']
|
Title KetoFriendly Desserts Holiday SeasonContent holiday season upon u joy air Everyone seems fantasizing special favorite dish commemorate season keto anything dull many tasty recipe fulfill sweet taste enjoy holiday season also helping lose fat without compromise health feel sad eating dessert afterward Christmas approaching want able celebrate loved one eating tastiest Christmas cooky cake treat certainly you’re going 5 Delicious KetoFriendly Dessert 5 delightful ketofriendly dessert idea help pleasant keto Christmas They’ll hit relative close one 1 CARROT CAKE BITES lowcarb vegan treat perfect way satisfy carrot cake desire They’re rolled grated coconut pretty finish take approximately 15 minute handson time baking required Serving size 27 calorie You’ll need following item 2 bowl big tiny Ingredients half cup coconut flour 1 tablespoon water half cup 2 tbsp applesauce unsweetened half teaspoon vanilla essence 1 teaspoon cinnamon 4 tablespoon granulated Fruit Sweetener 1 medium carrot finely sliced grated 60–70g 4 tablespoon shredded coconut lowfat 4 tbsp sugar granulated sweetener choice Instructions 1 large mixing dish whisk together coconut flour water applesauce vanilla extract 2 Stir together cinnamon Lakanto shredded carrot mixing dish 3 Allow dough chill 15 minute 4 small basin sift shredded coconut 5 Start removing dough fridge 15 minute roll 15 equalsized cake ball ball evenly coated shredded coconut 6 Store fridge 4 5 day 2 Chocolate orange spritz cooky Spritz cooky buttery sweet get keto makeover keto Christmas cooky ideal healthy holiday season made ahead time frozen dish make lot cooky it’s great giftgiving Otherwise make half batch delicious lowcarb cooky keep Ingredients 4 cup almond flour 13 cup coconut flour 1 tsp baking powder half tsp salt 2 tablespoon softened butter quarter cup sweetener 2 egg 1 cup orange zest 2 teaspoon vanilla essence decoration Mini MMs nonpareil chopped nut little item used decoration optional Chocolate Dip optional 3 oz dark chocolate sugarfree Instructions 1 Preheat oven 325°F cooky 2 Combine almond flour coconut flour baking powder salt medium mixing container 3 large mixing container start mixing cream butter sweetener 2 minute light fluffy separate bowl whisk together egg orange zest vanilla extract 4 Mix almond flour mixture form dough 5 Place dough canister cookie press cover plate choosing 6 Place cooky cookie pan lined parchment paper first take practice make mistake wind glob dough simply pick place back press 7 Bake cooky 12 14 minute firm touch brown around edge They’ll still somewhat soft 8 Immediately removing cake oven add embellishment Allow least 15 minute cooling pan transferring wire rack cool entirely 9 Place bowl pan slightly simmering water chocolate dip bottom bowl touch water Waxed paper parchment paper used line baking sheet 10 Stir chopped chocolate melted creamy chocolate thick coating add butter oil teaspoon time right consistency achieved 11 Drop one cookie time faceup melted chocolate coating bottom Remove chocolate fork carefully tap edge bowl remove excess 12 Set cooky baking sheet lined parchment paper option dipping cooky half none 3 Keto Chocolate Avocado Pudding prefer chocolate avocado choose two Chocolate Avocado Pudding recipe allows two preferable one You’ll eating decadent chocolate pudding you’ll also receiving healthy fat avocado perfect dessert Dessert Avocado Two Ingredients you’re member keto community I’m sure two ingredient hand time cocoa powder avocado case delectable chocolate avocado pudding musttry Simply blend hand mixer hand fork dessert ready eat Add additional stevia want sweeter Ingredients 1 avocado Half cup Unsweetened Cocoa Powder 10 drop Liquid Stevia half teaspoon vanilla extract 1 teaspoon Pink Himalayan Salt Remove pit avocado set aside mixing dish Mix cocoa powder stevia vanilla essence fork pudding also use hand mixer fork suffice Finish sprinkle pink sea salt Enjoy 4 LowCarb Cheesecake Keto GlutenFree keto dessert ideal sharing family friend fork slice lowcarb cheesecake white plate Would believe it’s actually rather simple adjust typical cheesecake recipe make diabetesfriendly lowcarb glutenfree easy modification take produce lowcarb cheesecake result dessert ideal sharing friend family contains essential ingredient taste like regular cheesecake it’s ketofriendly cream cheese egg sugar lemon juice vanilla essence make filling rapidly cut carbs replacing sugar lowcarb sweetener like erythritol You’ll rich creamy guiltfree dessert taste like real thing pour flaky scrumptious lowcarb crust two basic phase making cheesecake begin combine dough ingredient bake crust simply mix together filling ingredient pouring top baking chilling ready serve Step 1 Start preheating oven 350 degree Fahrenheit 180 degree Celsius Step 2 Combine almond flour shredded coconut salt large mixing basin Mix thoroughly Step 3 Gently melt butter stir liquid Stevia dry ingredient Step 4 Mix everything together thoroughly Step 5 Place dough springform pan pat evenly Step 6 Bake 10–15 minute 350°F crust begin turn golden brown around edge Allow cool completely Step 7 Combine cream cheese powdered sweetener large mixing basin one time beat egg barely combined Finally carefully fold remaining ingredient taking care overmix Step 8 Pour filling cooled crust springform pan remove space bubble tap pan counter Step 9 Bake 50 minute top cheesecake browned center jiggle slightly Allow cooling room temperature removing oven Step 10 Cover chill cheesecake least 4 hour overnight cooled room temperature Wrap hot towel side pan one minute slicing hot knife remove it’s time serve lowcarb cheesecake 5 Keto coconut macaroon sugarfree coconut macaroon made shredded desiccated coconut egg white sweetener tasty also glutenfree quick make one easiest threeingredient keto dessert Macaroons little biscuit cake made ground almond coconut sugar egg white hold together ketogenic dietfriendly lowcalorie sugarfree macaroon take twist popular dish Coconut macaroon traditionally produced condensed milk sugar egg coconut however method typically result high calorie sugar content making unsuitable keto diet sugar egg white shredded coconut used recipe making healthier need make lowcarb dessert family don’t anything house 3ingredient keto coconut macaroon recipe great Ingredients 3 mediumsized egg white room temperature 2 cup coconut shredded Sweetener 13 cup Instructions STEP 1 Preheat oven 320 degree Fahrenheit 160 degree Celsius STEP 2 Separate egg white yolk place large mixing basin STEP 3 Using hand mixer whip egg white stiff peak form take minute STEP 4 Try overmix shredded coconut sweetener egg white care STEP 5 Scoop small part cooky 1 tablespoon measuring spoon shaping ball go STEP 6 Place baking tray 12 inch apart won’t rise much don’t worry leaving large gap STEP 7 recipe yield around 20 cooky STEP 8 Bake 17–20 minute golden brown crisp keto dessert recipe personal favorite suggestion something try Leave comment box Beloved Viewers Vogue Wellness began health also wellness blog striving offer updated also impartial information suggestion Health care India also Globe rate interest viewer well bigger political also financial effect support constant feedback exactly boost offering make commitment effort powerful Also throughout challenging time occurring COVID19 continue continue committed keeping informed updated Health wellness well Health news worldwide request remain home comply preventive procedure also government standard save life well additionally around screening time nonetheless request battle economic effect pandemic need support even lot proceed provide extra quality web content anticipate extra registration online blog site attain collection objective provide much better well relevant web content Register Vogue WellnessWhere health thrives like web content please share Disclaimer solution visitor Vogue Wellness website give access library archived content Please keep mind date last review upgrade article material website despite day ought ever used replacement direct clinical suggestion physician qualified medical professional Vogue Wellness simply kicked health wellness well health blog site making every effort give updated honest info guidance Medical care India also World passion visitor well bigger political economic ramification expect extra membership online blog accomplish collection goal provide much better extra relevant content Disclaimer solution visitor Vogue Wellness portal offer accessibility collection archived materialTags Christmas Diet Food Keto New York
|
187,939 |
How to Start a Keto Diet Plan
|
The keto diet plan is a high-intake, high-fiber, sufficient-potassium diet which in medicinal circles is often used primarily to treat childhood epilepsy in very young children. The keto diet forces your body to use up fat instead of glucose for energy. This results in reduced hunger and allows you to stick to a reasonable diet even when you are highly hungry. It can be practiced by anyone, even if you have had a heart or kidney disease or diabetes in the past.
The keto diet plan is not designed for long-term weight control, as it puts a lot of emphasis on fats. The ketogenic diet pyramid is based around eating a wide variety of different carbohydrates and proteins. A lot of people don’t like the idea of eliminating carbohydrates from their diet and would rather focus on proteins, so the use of the MOST PROBABLY IMPORTANT carbohydrates are typically ignored in the process. By eliminating certain carbohydrates you can achieve ketosis easily, however this can be quite hard at first as your body gets accustomed to the absence of the carbohydrates you were once consuming.
Many experts agree that the best way to get started with the keto diet plan is to eat vegetables and lean meats. Eating more protein than vegetables (such as lean meats and chicken) helps boost your metabolism to burn fat faster after you stop consuming carbohydrates, which also helps you stick to your diet. Nuts and avocados are good veggies to eat as well because they are rich in mono unsaturated fats that are essential to maintain good health and are not burned off by the liver.
The benefits of eating more protein include muscle building, better digestion, and increased stamina. Nuts and avocados also provide protein, which provides many essential amino acids for the body, and contain medium chain triglycerides (MCT), which are easily metabolized by the liver, allowing them to enter the bloodstream immediately. The benefits of eating more carbs are the ability to control blood sugar, which can also help people lose weight. However, these carbohydrates should only be eaten in small amounts and should only be a supplement to your diet. Eating too many carbs can cause constipation, bloating, diarrhea, and even insomnia. If you have had problems with these symptoms before starting the keto diet plan, then you may want to limit your intake of carbs.
As you learn more about how to start a keto diet plan, you will find the best sources of protein are cheese, eggs, and chicken. Eggs are the most popular source of protein and can be found almost anywhere. Chicken is another highly favored food and can also be found almost anywhere. Both of these meats are lean cuts of meat, which makes them great sources of protein. The most important thing is to make sure that you get enough protein from your diet, as this will help your muscles to grow and create new tissue.
Now that you know how to start a keto diet plan, the next step is to get your food list together. You will need a detailed list of what you will be eating for each day. Include any vitamins and supplements that you may need to take, as well as any other special medications or instructions that your doctor has given you. It is a good idea to keep a food diary so that you can keep track of what you are eating each day. This way you can make sure that you are not getting any unwanted snacks and that you are eating real food.
So… do you want to get more tips and learn more about the keto diet and others related health topics:
If so, then check out my blog for more details, please click here: https://healthwealthylifestyle.com
Also, check out my other blog, that contains articles on Health and Lifestyle content, click here for more details. https://balancedhealthtips.com
Article Source: https://EzineArticles.com/expert/Dan_Licamara/737691
Article Source: http://EzineArticles.com/10467157
(Note: The Following article may contain affiliate links to offers. If you purchase any of the offers i may receive a commission)
|
https://medium.com/@sougougiskardgratias/how-to-start-a-keto-diet-plan-cc8bf516b3cb
|
['Sougou Giskard Gratias']
|
2021-12-22 12:05:28.594000+00:00
|
['Ketogenic Diet', 'Ketogenic', 'Keto', 'Ketosis', 'Keto Diet']
|
Title Start Keto Diet PlanContent keto diet plan highintake highfiber sufficientpotassium diet medicinal circle often used primarily treat childhood epilepsy young child keto diet force body use fat instead glucose energy result reduced hunger allows stick reasonable diet even highly hungry practiced anyone even heart kidney disease diabetes past keto diet plan designed longterm weight control put lot emphasis fat ketogenic diet pyramid based around eating wide variety different carbohydrate protein lot people don’t like idea eliminating carbohydrate diet would rather focus protein use PROBABLY IMPORTANT carbohydrate typically ignored process eliminating certain carbohydrate achieve ketosis easily however quite hard first body get accustomed absence carbohydrate consuming Many expert agree best way get started keto diet plan eat vegetable lean meat Eating protein vegetable lean meat chicken help boost metabolism burn fat faster stop consuming carbohydrate also help stick diet Nuts avocado good veggie eat well rich mono unsaturated fat essential maintain good health burned liver benefit eating protein include muscle building better digestion increased stamen Nuts avocado also provide protein provides many essential amino acid body contain medium chain triglyceride MCT easily metabolized liver allowing enter bloodstream immediately benefit eating carbs ability control blood sugar also help people lose weight However carbohydrate eaten small amount supplement diet Eating many carbs cause constipation bloating diarrhea even insomnia problem symptom starting keto diet plan may want limit intake carbs learn start keto diet plan find best source protein cheese egg chicken Eggs popular source protein found almost anywhere Chicken another highly favored food also found almost anywhere meat lean cut meat make great source protein important thing make sure get enough protein diet help muscle grow create new tissue know start keto diet plan next step get food list together need detailed list eating day Include vitamin supplement may need take well special medication instruction doctor given good idea keep food diary keep track eating day way make sure getting unwanted snack eating real food So… want get tip learn keto diet others related health topic check blog detail please click httpshealthwealthylifestylecom Also check blog contains article Health Lifestyle content click detail httpsbalancedhealthtipscom Article Source httpsEzineArticlescomexpertDanLicamara737691 Article Source httpEzineArticlescom10467157 Note Following article may contain affiliate link offer purchase offer may receive commissionTags Ketogenic Diet Ketogenic Keto Ketosis Keto Diet
|
187,940 |
The Ultimate Keto Meal Plan: The Tastiest, Healthiest, and Easiest Recipes You Can Make.
|
This blog post contains affiliate links for Amazon products. For more information please read our disclaimer page.
What is a keto diet?
The keto diet is a high-fat, low-carb diet. It’s also high in protein. And it turns your body into a fat-burning machine.
There are three phases to the keto diet:
• Ketosis phase — in this phase, you eat very few carbs and sugar, gradually working up to 20 grams per day or less. Your body will turn to fat for fuel.
• Ketogenic Maintenance — once you reach your goal weight, you can continue the ketogenic maintenance phase indefinitely. You’ll want to eat healthy fats and limit your carb intake to about 50 grams per day.
• Pre-keto Transition — before starting the keto diet, you’ll need to give yourself two weeks of pre-keto time where you gradually reduce your carb intake.
Benefits of a keto diet
Eating a keto diet can help you lose weight, get healthier, and even improve your mood.
If you’re looking for a way to get started eating less carbs, ketogenic diets could be the answer for you.
Ketogenic diets are high in fat and low in carbs. They’ve been proven to help with weight loss and reduce the risk of type 2 diabetes and heart disease. Eating this way can also lower cholesterol levels and blood pressure.
There are many other benefits that come from following a keto diet. For example, it can help with mental clarity and lower feelings of depression or anxiety. And because the diet is high in fat, there’s a possibility that it could even make you live longer!
My Best Kito Diets Recipes And plan
The pitfalls of a keto diet
One of the biggest challenges with keto is just getting started. It can be difficult to even know where to start or what you should be doing.
First, you have to remove all sugars from your diet. This includes natural sugars, like fruit, as well as artificial sugars, like those found in candy and other treats.
You also have to restrict carbohydrates. One of the major tenets of a keto diet is that you’ll need less than 50 grams of carbs per day. That’s about one apple!
Next, you must take it easy on the fat. A ketogenic diet typically contains no more than 20–30 percent fat calories per day — about two tablespoons worth. And this is coming from healthy sources, like nuts and seeds, avocados, fatty fish like salmon, eggs, and oils.
Lastly, you should make sure you are getting enough protein for your body to function well without carbs or sugar.
How to get started on a keto diet
Ketogenic diets are becoming more popular. If you’re considering adopting this way of eating, it can be difficult to get started. There are many benefits to keto diets, but what about the pitfalls?
There are many keto cookbooks available on Amazon that can help you get started on your new way of eating. One popular one is The Keto Diet by Leanne Vogel. This book contains over 125 recipes with ingredients that are easy to find at your local grocer or supermarket.
This keto cookbook offers many helpful tips for those interested in adopting the diet lifestyle. It also has an entire section devoted to cooking for beginners, which includes lots of pictures and clear instructions for making all sorts of basics like eggs, cheese, sauces, and more.
If you’re considering getting into the keto way of living, this is a great place to start!
New way of eating with the help of Leanne Vogel’s cookbook, “The Keto Diet”.
A keto diet is a low-carb, high-fat diet that helps your body produce ketones. When your body burns fat for fuel, it produces ketones. This is called being in ketosis, and it’s the goal of a ketogenic diet.
The Keto Diet by Leanne Vogel is this new way of eating that health experts are touting as a viable alternative to your standard high carb diet. Made with ingredients that can be found at a grocery store or supermarket, these recipes will make adopting this new way of eating easy and tasty!
Overview and synopsis
If you’re interested in starting a keto diet, this post has everything you need to get started. It contains 6 benefits of ketogenic diets, 6 pitfalls of ketogenic diets, and 10 keto cookbooks you should know about. One popular cookbook is the Keto Diet by Leanne Vogel. You can learn more about her book below!
My Best Kito Diets Recipes And plan
Recipes that we’ll see in the book.
The Keto Diet doesn’t contain any recipes. All the recipes are found on Leanne Vogel’s blog, Healthful Pursuit.
So you want to start a blog? Great! But before you do, make sure you know how it works and what you need to do to run a successful blog.
|
https://medium.com/@tecnicalrambogame11/the-ultimate-keto-meal-plan-the-tastiest-healthiest-and-easiest-recipes-you-can-make-4890da92bd9c
|
[]
|
2021-12-25 11:44:22.403000+00:00
|
['Ketogenic Diet', 'Keto', 'Ketosis', 'Keto Meal Plan', 'Keto Diet']
|
Title Ultimate Keto Meal Plan Tastiest Healthiest Easiest Recipes MakeContent blog post contains affiliate link Amazon product information please read disclaimer page keto diet keto diet highfat lowcarb diet It’s also high protein turn body fatburning machine three phase keto diet • Ketosis phase — phase eat carbs sugar gradually working 20 gram per day le body turn fat fuel • Ketogenic Maintenance — reach goal weight continue ketogenic maintenance phase indefinitely You’ll want eat healthy fat limit carb intake 50 gram per day • Preketo Transition — starting keto diet you’ll need give two week preketo time gradually reduce carb intake Benefits keto diet Eating keto diet help lose weight get healthier even improve mood you’re looking way get started eating le carbs ketogenic diet could answer Ketogenic diet high fat low carbs They’ve proven help weight loss reduce risk type 2 diabetes heart disease Eating way also lower cholesterol level blood pressure many benefit come following keto diet example help mental clarity lower feeling depression anxiety diet high fat there’s possibility could even make live longer Best Kito Diets Recipes plan pitfall keto diet One biggest challenge keto getting started difficult even know start First remove sugar diet includes natural sugar like fruit well artificial sugar like found candy treat also restrict carbohydrate One major tenet keto diet you’ll need le 50 gram carbs per day That’s one apple Next must take easy fat ketogenic diet typically contains 20–30 percent fat calorie per day — two tablespoon worth coming healthy source like nut seed avocado fatty fish like salmon egg oil Lastly make sure getting enough protein body function well without carbs sugar get started keto diet Ketogenic diet becoming popular you’re considering adopting way eating difficult get started many benefit keto diet pitfall many keto cookbook available Amazon help get started new way eating One popular one Keto Diet Leanne Vogel book contains 125 recipe ingredient easy find local grocer supermarket keto cookbook offer many helpful tip interested adopting diet lifestyle also entire section devoted cooking beginner includes lot picture clear instruction making sort basic like egg cheese sauce you’re considering getting keto way living great place start New way eating help Leanne Vogel’s cookbook “The Keto Diet” keto diet lowcarb highfat diet help body produce ketone body burn fat fuel produce ketone called ketosis it’s goal ketogenic diet Keto Diet Leanne Vogel new way eating health expert touting viable alternative standard high carb diet Made ingredient found grocery store supermarket recipe make adopting new way eating easy tasty Overview synopsis you’re interested starting keto diet post everything need get started contains 6 benefit ketogenic diet 6 pitfall ketogenic diet 10 keto cookbook know One popular cookbook Keto Diet Leanne Vogel learn book Best Kito Diets Recipes plan Recipes we’ll see book Keto Diet doesn’t contain recipe recipe found Leanne Vogel’s blog Healthful Pursuit want start blog Great make sure know work need run successful blogTags Ketogenic Diet Keto Ketosis Keto Meal Plan Keto Diet
|
187,941 |
How to start a keto diet plan?
|
(Quick Weight Loss)
We left off with my last article of “Find How a Quick Weight Loss Can Be a Healthy Weight Loss — Phase I”. As a recap, you figured out how you ought to change your eating routine to guarantee that your solid weight reduction is likewise a speedy weight reduction. Presently, we are on to Phase II of your solid weight reduction and speedy weight reduction venture. Anyway, what is the following wellness tuning way that I should seek after later you have embraced a total and solid eating regimen?
Stage II of your sound weight reduction and fast weight reduction venture is work out. Since you have embraced a total and solid eating routine, and your body has each of the nutrients, minerals, sugars and proteins that it should, the time has come to put all of that great work to utilize! Practice is the following key fixing to the astounding formula of your sound weight reduction and fast weight reduction. Not exclusively should you work out, however you should do as such shrewdly. There is no requirement for you to attempt to commit suicide before all else. All things being equal, it is better for you to make child strides and to stir yourself up to cutting edge exercise schedules. The way to a sound weight reduction and fast weight reduction may be just about as uneven as you decide to make it!
Start you solid weight reduction and fast weight reduction exercises gradually. That implies that you should stir yourself up to doing progressed exercises. My working out began with cardiovascular movement, and body preparing. I would recommend that you do likewise. Body preparing will comprise of utilizing your own body weight to prepare your muscles. This implies that you do push-ups, sit-ups and crunches, pull-ups, squats, rushes, plunges, switch crunches, calf-raises, and vacillate kicks. These are great activities to begin Phase II of your sound weight reduction and fast weight reduction, and develops your muscles’ perseverance. Do as numerous minutes of cardiovascular exercise that you can, following the finishing of your body preparing works out. Start yourself at ten minutes and move gradually as long as thirty minutes. This is the planning step fundamental for a fruitful Phase II of your sound weight reduction and fast weight reduction.
The subsequent stage of your solid weight reduction and speedy weight reduction is to move your wellness tuning endeavors into the rec center. When you can siphon out your body preparing practices like an expert, then, at that point, you are prepared for weight and opposition preparing. Contingent on your body type and longing for body type, the technique for exercise center preparing for your solid weight reduction and speedy weight reduction venture contrasts. To evidently put it, to put on muscle size and increment strength, you will utilize more weight with less redundancies; assuming you are exclusively worried about center strength and conditioning your body, then, at that point, you will utilize not so much weight but rather more reiterations. Choosing what body type you need is the least demanding piece of a solid weight reduction and speedy weight reduction venture. With one or the other strategy, utilize the pyramid set design. This means to expand your weight with each set of the activity, and complete 3 sets for every activity. Allude to my wellness tuning site, recorded underneath, on the off chance that additional data is required with respect to sound weight reduction and speedy weight reduction activities or exercise methods.
During Phase II of your sound weight reduction and fast weight reduction venture, make sure to think carefully. At the point when you are beginning another activity interestingly, utilize an amazingly light weight. Not exclusively will this guarantee that you don’t harm yourself doing the activity, yet it will likewise permit you to involve appropriate structure for the activity from the earliest starting point. Accomplishing a sound weight reduction and speedy weight reduction is unimaginable on the off chance that you harm yourself in the exercise center. Truth be told, a rec center injury can set your sound weight reduction and fast weight reduction practice program back weeks, even months. Keep in mind, assuming you can’t complete ten redundancies of your third arrangement of an activity, that is OK also. However long you can complete ten reiterations of the initial two arrangements of the activity, then, at that point, at last your solidarity will construct enough for you to complete ten redundancies of the third exercise. This is the wellness tuning technique for Phase II of your solid weight reduction and a fast weight reduction, and has been working for wellness devotees for a really long time.
The rec center piece of your sound weight reduction and fast weight reduction is straightforward. You complete three activities for every muscle bunch, and do two muscle bunches each day. This implies you can do chest and rear arm muscles the main day, back and biceps the subsequent day, and legs and shoulders the third day. Polish your activity schedules off on those three days with twenty or thirty minutes of cardiovascular exercise. On the fourth day, do just stomach works out, except if you are working your abs on the other three days alongside the other muscle gatherings. If so, then, at that point, the fourth day is a finished day off. To be totally effective in your sound weight reduction and speedy weight reduction venture, you should give your body time to recover. You are giving your body the supplements that it needs to recover from your solid weight reduction and speedy weight reduction endeavors, yet the last fixing is rest.
By using these activity strategies and methods, you will guarantee accomplishment in Phase II of your sound weight reduction and fast weight reduction venture. Whenever you have dominated the exercise center schedules recorded above, then, at that point, you are prepared for further developed preparing techniques. You can discover more data on all of the wellness tuning preparing strategies for a solid weight reduction and speedy get-healthy plan recorded in this article, just as further developed preparing techniques, by tapping on my site’s connection beneath. You can join my free enrollment site, and get sufficiently close to the entirety of the nourishment, eating less junk food, and wellness data that I ship off my individuals in general. You can likewise assemble the exercise schedule that is best for you, and guarantee your accomplishment in Phase II of your solid weight reduction and fast weight reduction venture today!
|
https://medium.com/@omit.hassan545/how-to-start-a-keto-diet-plan-9349753fcbd1
|
['Omit Hassan']
|
2021-12-24 19:49:10.566000+00:00
|
['Ketogenic Diet', 'Diet', 'Keto', 'Ketosis', 'Keto Diet Plan']
|
Title start keto diet planContent Quick Weight Loss left last article “Find Quick Weight Loss Healthy Weight Loss — Phase I” recap figured ought change eating routine guarantee solid weight reduction likewise speedy weight reduction Presently Phase II solid weight reduction speedy weight reduction venture Anyway following wellness tuning way seek later embraced total solid eating regimen Stage II sound weight reduction fast weight reduction venture work Since embraced total solid eating routine body nutrient mineral sugar protein time come put great work utilize Practice following key fixing astounding formula sound weight reduction fast weight reduction exclusively work however shrewdly requirement attempt commit suicide else thing equal better make child stride stir cutting edge exercise schedule way sound weight reduction fast weight reduction may uneven decide make Start solid weight reduction fast weight reduction exercise gradually implies stir progressed exercise working began cardiovascular movement body preparing would recommend likewise Body preparing comprise utilizing body weight prepare muscle implies pushup situps crunch pullups squat rush plunge switch crunch calfraises vacillate kick great activity begin Phase II sound weight reduction fast weight reduction develops muscles’ perseverance numerous minute cardiovascular exercise following finishing body preparing work Start ten minute move gradually long thirty minute planning step fundamental fruitful Phase II sound weight reduction fast weight reduction subsequent stage solid weight reduction speedy weight reduction move wellness tuning endeavor rec center siphon body preparing practice like expert point prepared weight opposition preparing Contingent body type longing body type technique exercise center preparing solid weight reduction speedy weight reduction venture contrast evidently put put muscle size increment strength utilize weight le redundancy assuming exclusively worried center strength conditioning body point utilize much weight rather reiteration Choosing body type need least demanding piece solid weight reduction speedy weight reduction venture one strategy utilize pyramid set design mean expand weight set activity complete 3 set every activity Allude wellness tuning site recorded underneath chance additional data required respect sound weight reduction speedy weight reduction activity exercise method Phase II sound weight reduction fast weight reduction venture make sure think carefully point beginning another activity interestingly utilize amazingly light weight exclusively guarantee don’t harm activity yet likewise permit involve appropriate structure activity earliest starting point Accomplishing sound weight reduction speedy weight reduction unimaginable chance harm exercise center Truth told rec center injury set sound weight reduction fast weight reduction practice program back week even month Keep mind assuming can’t complete ten redundancy third arrangement activity OK also However long complete ten reiteration initial two arrangement activity point last solidarity construct enough complete ten redundancy third exercise wellness tuning technique Phase II solid weight reduction fast weight reduction working wellness devotee really long time rec center piece sound weight reduction fast weight reduction straightforward complete three activity every muscle bunch two muscle bunch day implies chest rear arm muscle main day back biceps subsequent day leg shoulder third day Polish activity schedule three day twenty thirty minute cardiovascular exercise fourth day stomach work except working ab three day alongside muscle gathering point fourth day finished day totally effective sound weight reduction speedy weight reduction venture give body time recover giving body supplement need recover solid weight reduction speedy weight reduction endeavor yet last fixing rest using activity strategy method guarantee accomplishment Phase II sound weight reduction fast weight reduction venture Whenever dominated exercise center schedule recorded point prepared developed preparing technique discover data wellness tuning preparing strategy solid weight reduction speedy gethealthy plan recorded article developed preparing technique tapping site’s connection beneath join free enrollment site get sufficiently close entirety nourishment eating le junk food wellness data ship individual general likewise assemble exercise schedule best guarantee accomplishment Phase II solid weight reduction fast weight reduction venture todayTags Ketogenic Diet Diet Keto Ketosis Keto Diet Plan
|
187,942 |
Keto Diet: How to Get Started With This Low-Carb Diet.
|
Ketogenic Diet For Free….
The ketogenic diet has been around for nearly a century. But it’s only now, with the rise of social media, that it’s become wildly popular. The keto diet is not new, but it has certainly become more popular in recent years with the rise of social media. Keto
diet
is an eating plan that emphasizes healthy fats and protein
and restricts carbs. It’s different from other low-carb
diets because it forces your body into ketosis
a state where you burn fat for energy instead of carbs. Whether or not this diet is right for you depends on your lifestyle and what kind of food you like to eat. Let’s take a look at how to get started with keto and what benefits this diet offers.
GET MY FREE KETO DIET COOKBOOK FULL OF ESSENTIAL RECIPES FOR FREE….
What is a Keto Diet?
A ketogenic diet is the newest and hottest diet on the block. It involves getting your body into a state of ketosis, meaning that you’ll be using fat as your primary energy source instead of carbs. The keto diet has been around for nearly a century, but it became wildly popular in recent years with celebrities like Kim Kardashian and Megan Fox singing its praises.
The keto diet is different from other low-carb diets because it forces your body to enter a state of ketosis, meaning you burn fat for energy instead of carbs. Whether or not this diet is right for you will depend on your lifestyle and what kind of food you like to eat. Let’s take a look at how to get started with keto and what benefits this diet offers.
GET MY FREE KETO DIET COOKBOOK FULL OF ESSENTIAL RECIPES FOR FREE….
Benefits of a Ketogenic Diet
A ketogenic diet is a low-carbohydrate, high-fat diet with
very few carbs. Your body enters ketosis when you eat fewer than 50 grams of carbs per day. It’s often used to manage cases of epilepsy, but it can also help people lose weight or maintain their weight loss.
The ketogenic diet has many benefits, including weight loss and more energy throughout the day. One of the most popular reasons for following a ketogenic plan is rapid weight loss. A study published in the British Medical Journal found that “weight loss was greater in the low-carbohydrate group at 6 months.” This isn’t surprising given that this eating plan emphasizes healthy fats rather than carbohydrates.
Another benefit of this diet is more energy. Most people find that they’re less hungry on a keto diet because they’re eating fat instead of carbs for energy. And while it may be true that you’ll need to adjust to this type of diet at first, once your body adjusts to running on fat, many people experience increased stamina and improved mental clarity (at least while in ketosis).
Finally, one common reason for following a ketogenic diet is improved insulin sensitivity — which can reduce your risk for heart disease and type 2
GET MY FREE KETO DIET COOKBOOK FULL OF ESSENTIAL RECIPES FOR FREE….
Getting Started with the Ketogenic Diet
The ketogenic diet is a low-carb, high-fat diet. You can start this eating plan by removing or significantly reducing carbs from your diet. Then, you should gradually increase the percentage of fat in your food intake. The idea behind the keto diet is that it forces your body into a state called ketosis.
You’ll know you’re in ketosis when you experience side effects like feeling very tired, having bad breath, and feeling an increase in acid reflux. If you’re experiencing these symptoms then it means that your body has started to burn fat for energy instead of carbohydrates.
To get started on the keto diet, make sure to use restaurants with low-carb options and to check out healthy recipes for low-carb foods.
How to Avoid Common Keto Mistakes
The keto diet has become increasingly popular in recent years.
It’s also become more popular on social media, which is where many people are learning about the diet. However, it can be difficult to know how to get started with keto if you don’t have much experience with the diet.
If you’re considering following a keto diet, it’s important that you have a good understanding of what to expect before diving head in.
Don’t make any mistakes that could cause your keto journey to be unsuccessful. Below are some of the most common mistakes people make when starting out on this diet:
- Not eating enough fats
- Eating too many carbs
- Eating too much protein — Avoiding vegetables
These are all simple mistakes that can easily be avoided by taking time to learn about keto and what it entails before jumping in. Read on for more information about these common mistakes and how they can derail your progress on this diet.
GET MY FREE KETO DIET COOKBOOK FULL OF ESSENTIAL RECIPES FOR FREE….
Conclusion
The ketogenic diet is a low-carb diet that can help you lose weight efficiently. It’s not about deprivation or eliminating food groups, but rather balancing your intake of macronutrients. For those who are looking to lose weight, the ketogenic diet is a great option.
|
https://medium.com/@niti7vish/keto-diet-how-to-get-started-with-this-low-carb-diet-116b1acb4b68
|
['Nitikesh Vishwakarma']
|
2021-12-27 16:50:25.218000+00:00
|
['Ketogenic Diet', 'Health', 'How To', 'Keto', 'How To Lose Weight Fast']
|
Title Keto Diet Get Started LowCarb DietContent Ketogenic Diet Free… ketogenic diet around nearly century it’s rise social medium it’s become wildly popular keto diet new certainly become popular recent year rise social medium Keto diet eating plan emphasizes healthy fat protein restricts carbs It’s different lowcarb diet force body ketosis state burn fat energy instead carbs Whether diet right depends lifestyle kind food like eat Let’s take look get started keto benefit diet offer GET FREE KETO DIET COOKBOOK FULL ESSENTIAL RECIPES FREE… Keto Diet ketogenic diet newest hottest diet block involves getting body state ketosis meaning you’ll using fat primary energy source instead carbs keto diet around nearly century became wildly popular recent year celebrity like Kim Kardashian Megan Fox singing praise keto diet different lowcarb diet force body enter state ketosis meaning burn fat energy instead carbs Whether diet right depend lifestyle kind food like eat Let’s take look get started keto benefit diet offer GET FREE KETO DIET COOKBOOK FULL ESSENTIAL RECIPES FREE… Benefits Ketogenic Diet ketogenic diet lowcarbohydrate highfat diet carbs body enters ketosis eat fewer 50 gram carbs per day It’s often used manage case epilepsy also help people lose weight maintain weight loss ketogenic diet many benefit including weight loss energy throughout day One popular reason following ketogenic plan rapid weight loss study published British Medical Journal found “weight loss greater lowcarbohydrate group 6 months” isn’t surprising given eating plan emphasizes healthy fat rather carbohydrate Another benefit diet energy people find they’re le hungry keto diet they’re eating fat instead carbs energy may true you’ll need adjust type diet first body adjusts running fat many people experience increased stamen improved mental clarity least ketosis Finally one common reason following ketogenic diet improved insulin sensitivity — reduce risk heart disease type 2 GET FREE KETO DIET COOKBOOK FULL ESSENTIAL RECIPES FREE… Getting Started Ketogenic Diet ketogenic diet lowcarb highfat diet start eating plan removing significantly reducing carbs diet gradually increase percentage fat food intake idea behind keto diet force body state called ketosis You’ll know you’re ketosis experience side effect like feeling tired bad breath feeling increase acid reflux you’re experiencing symptom mean body started burn fat energy instead carbohydrate get started keto diet make sure use restaurant lowcarb option check healthy recipe lowcarb food Avoid Common Keto Mistakes keto diet become increasingly popular recent year It’s also become popular social medium many people learning diet However difficult know get started keto don’t much experience diet you’re considering following keto diet it’s important good understanding expect diving head Don’t make mistake could cause keto journey unsuccessful common mistake people make starting diet eating enough fat Eating many carbs Eating much protein — Avoiding vegetable simple mistake easily avoided taking time learn keto entail jumping Read information common mistake derail progress diet GET FREE KETO DIET COOKBOOK FULL ESSENTIAL RECIPES FREE… Conclusion ketogenic diet lowcarb diet help lose weight efficiently It’s deprivation eliminating food group rather balancing intake macronutrients looking lose weight ketogenic diet great optionTags Ketogenic Diet Health Keto Lose Weight Fast
|
187,943 |
The Complete Beginner’s Guide to Keto Fast Food
|
Keto Fast Food
If you are Health Genic and you are interested in and also you love Keto Fast Food and Whether you are going out with your friends on road trips & Shopping and you are Health-conscious about the diet that situation here is the best place to get keto fast food.
1. Subway
You can Search Subway in Different Places, it is a famous restaurant for Fast food, This Restaurant especially famous for Burger, Sandwich, Salad, etc, In this Place you can order Sandwiches with mixes green, instantly slashing the carbs. Their plate of mixed greens partitions is bigger than other cheap food places, which implies you’ll top off even though you’re discarding the bread.
What to Order
Want to choose a sub-option, Make it a salad, add cheese, and Most important to take Low — carb Vegetables, and add some olive oil and vinegar that gives you feel awesome and Delicious. Make sure sub-options are high in carbs than others. Here are low-carb options with cheese, spinach, green peppers, Black olives, lettuce, pickles as the veggie options.
SUBWAYCALORIESFAT PROTEINCARBSFIBERTUNA SALAD33027G16G7G2GOVEN ROASTED CHICKEN1606G20G7G2GROAST BEEF1607G20G7G3GSUBWAY CLUB1607G19G8G3GCOLD CUT COMBO20014G13G9G2G
2.Chipotle
If You Love Chipotle Restaurant for Mexican Food that is the best option for Keto fast food, You will enjoy their delicious Dishes.
What to Order
You can order their many optional food Salad Bowl: red salsa, Romaine lettuce, cheese, and guacamole, carnitas. Whole30 Salad Bowl: carnitas, fajita veggies, tomato salsa, Romaine lettuce, and guacamole. barbacoa, fajita veggies, green salsa, Paleo Salad Bowl, Romaine lettuce, and guacamole.
CHIPOTLECALORIESFATPROTEINCARBSFIBERRomaine lettuce10OG1G2G1GSteak1507G21G0G0GChicken1806G32G0G0GCarnitas21012G23G0G0GBarbacoa1707G32G2G1G
Additionally add low-carb (sour cream and guac are particularly tasty and high-fat You can ask for double meat, although they’ll charge you extra):
CHIPOTLECALORIESFATPROTEINCARBSFIBERQueso1208G6G4G0.5GTomato Salsa250G0G1G1GTomatillo-Green Chilli Salsa150G0G4G0GTomatillo-Red Chilli Salsa300G0G4G1GSour Cream1108G6G1G0GCheese1108G6G1G0GGuacamole23022G2G8G6GRomaine lettuce50GOG1G1G
3. McDonald’s
McDonald’s is a Famous Restaurant for Fast food. You can easily find this Restaurant anywhere, and it’s not an opponent to the low-carb diet if you simply get the bread.
What to Order
Sausage McMuffin. …
Egg McMuffin. …
Sausage, Egg, & Cheese McMuffin. …
Egg Biscuit. …
Sausage Biscuit. …
Bacon, Egg, & Cheese Biscuit. …
Sausage, Egg, & Cheese Biscuit. …
Bacon, Egg, & Cheese McGriddle.
You can also order any grilled chicken sandwich, or quarter pounder grilled chicken bacon ranch, with cheeseburger without the bun or ketchup will work. If you order a salad, don’t take ranch dressing because it has added sugar. Instead, take olive oil and vinegar like Italian. Below are lower carb options:
McDonald’s
No Bun, No KetchupCALORIESFATPROTEINCARBSFIBERMCDOUBLE24016G17G3G1GDOUBLE CHEESEBURGERNo Bread28020G20G5G1gGRILLED CHICKEN SANDWICHNo Bun1604G29G2G 1G
4. Burger King
Burger King is a famous cheap food chain that additionally has some low-carb alternatives. You can undoubtedly arrange a twofold cheeseburger without the bun and stay keto.
What to Order
The grilled chicken sandwich, cheeseburgers, Stick with burgers, Double Whopper without bread, and Ketchup. Some are Different Sandwiches like Farmhouse King, which come with carbs without lots of customization.
BURGER KING
CALORIESFATPROTEINCARBSFIBERCheeseBurgerNo Bun,
No Tomatoes
No Ketchup
13010G9G<1G0GDoubleCheese BurgerNo Bun,
No Ketchup
23018G18G<1G0GGrilled Chicken SandwichNo Bun,
No Tomatoes
No Ketchup
64053G40G2G0GDouble Cheese BurgerNo Bun27016G30G1G0G
5. Arby’s
Arby’s is Famous for Roast beef, but in this place, there are various meat options you can choose from, and order them without bread for low-carb is the best option. If you are hungry and want to eat a high protein fast -food meal then Arby’s is the best option for you and that also helps you maintain your keto goals.
Arby’s
CALORIESFATPROTEINCARBSFIBERRoast Beef SandwichNo Bun15010G16G1GOGDouble Roast Beef SandwichNo Bun31020G31G2GOGHalf Round Roast SandwichNo Bun41026G41G2GOGSmokehouse BrisketNo Bun
Or Onion Strings36027g28G3G1GThree Cheese Steak SandwichNo Bun
Or Onion Strings41028G36G5G0GFire Roasted PhillyNo Bread43030G35G4G0GRebunNo Bread35026G25G7G1GGrand Turkey ClubNo Bread30020G26G4G1GRoast Turkey & Swiss SandwichNo Bread32022G25G6G1G
6. Taco Bell
Taco Bell is an American-based chain of fast-food restaurants based in Irvine, California. The restaurants serve a variety of Mexican-inspired foods, that include: tacos, burritos, quesadillas, nachos, novelty and specialty items, along with variety of items.
This restaurant is best for Keto diets, you can order the salad, Green salads, and stay fit with a keto diet.
What to Order
You can order lettuce, f, side of chicken, side of beef, and a side or two of guacamole. Then mix it all for a quick meal. You can also add jalapenos for an extra taste.
7. KFC
If You are ordering food in KFC it can be difficult as all fried foods are high in carbs. Even just a medium-sized piece of fried chicken at KFC is around 8–11 carbs. But if you still have a craving for chicken then there are a couple of grilled options.
KFCCALORIESFATPROTEINCARBSFIBERGrilled Chicken Thigh Per Piece1509G17G0G0GGrilled Chicken DrumstickPer Piece804G11G0G0GGrilled Chicken BreastPer Piece2107G38G0G0GGreen Beans 250G1G4G2G
8. Starbucks Coffee
Starbucks has many options for keto products including keto food and Keto drinks. Here is a guide on what to eat at Starbucks according to your choices.
What to Order
Starbucks’ keto foods are egg-based and breakfast-themed. Choices include:
Bacon and gruyere sous-vide egg chomps (9g net carbs)
Turkey bacon and egg white breakfast sandwich, without the bun (2g net carbs)
Cauliflower tabbouleh serving of mixed greens (7g net carbs)
Restored meat and cheddar nibble plate (0g net carbs)
9.Panera Bread
Panera is particularly keto-accommodating, with numerous keto things that you can arrange straight off the menu, no changes. Clearly, their bread is forbidden, yet there’s still a lot of low-carb passage to browse.
What to Order
|
https://medium.com/@nutrabursts/the-complete-beginners-guide-to-keto-fast-food-8cfe23c64b35
|
['Nutra Bursts']
|
2021-12-27 11:34:11.071000+00:00
|
['Keto Fast Food', 'Keto', 'Keto Fast Weight Loss', 'Ketosis', 'Keto Diet']
|
Title Complete Beginner’s Guide Keto Fast FoodContent Keto Fast Food Health Genic interested also love Keto Fast Food Whether going friend road trip Shopping Healthconscious diet situation best place get keto fast food 1 Subway Search Subway Different Places famous restaurant Fast food Restaurant especially famous Burger Sandwich Salad etc Place order Sandwiches mix green instantly slashing carbs plate mixed green partition bigger cheap food place implies you’ll top even though you’re discarding bread Order Want choose suboption Make salad add cheese important take Low — carb Vegetables add olive oil vinegar give feel awesome Delicious Make sure suboptions high carbs others lowcarb option cheese spinach green pepper Black olive lettuce pickle veggie option SUBWAYCALORIESFAT PROTEINCARBSFIBERTUNA SALAD33027G16G7G2GOVEN ROASTED CHICKEN1606G20G7G2GROAST BEEF1607G20G7G3GSUBWAY CLUB1607G19G8G3GCOLD CUT COMBO20014G13G9G2G 2Chipotle Love Chipotle Restaurant Mexican Food best option Keto fast food enjoy delicious Dishes Order order many optional food Salad Bowl red salsa Romaine lettuce cheese guacamole carnitas Whole30 Salad Bowl carnitas fajita veggie tomato salsa Romaine lettuce guacamole barbacoa fajita veggie green salsa Paleo Salad Bowl Romaine lettuce guacamole CHIPOTLECALORIESFATPROTEINCARBSFIBERRomaine lettuce10OG1G2G1GSteak1507G21G0G0GChicken1806G32G0G0GCarnitas21012G23G0G0GBarbacoa1707G32G2G1G Additionally add lowcarb sour cream guac particularly tasty highfat ask double meat although they’ll charge extra CHIPOTLECALORIESFATPROTEINCARBSFIBERQueso1208G6G4G05GTomato Salsa250G0G1G1GTomatilloGreen Chilli Salsa150G0G4G0GTomatilloRed Chilli Salsa300G0G4G1GSour Cream1108G6G1G0GCheese1108G6G1G0GGuacamole23022G2G8G6GRomaine lettuce50GOG1G1G 3 McDonald’s McDonald’s Famous Restaurant Fast food easily find Restaurant anywhere it’s opponent lowcarb diet simply get bread Order Sausage McMuffin … Egg McMuffin … Sausage Egg Cheese McMuffin … Egg Biscuit … Sausage Biscuit … Bacon Egg Cheese Biscuit … Sausage Egg Cheese Biscuit … Bacon Egg Cheese McGriddle also order grilled chicken sandwich quarter pounder grilled chicken bacon ranch cheeseburger without bun ketchup work order salad don’t take ranch dressing added sugar Instead take olive oil vinegar like Italian lower carb option McDonald’s Bun KetchupCALORIESFATPROTEINCARBSFIBERMCDOUBLE24016G17G3G1GDOUBLE CHEESEBURGERNo Bread28020G20G5G1gGRILLED CHICKEN SANDWICHNo Bun1604G29G2G 1G 4 Burger King Burger King famous cheap food chain additionally lowcarb alternative undoubtedly arrange twofold cheeseburger without bun stay keto Order grilled chicken sandwich cheeseburger Stick burger Double Whopper without bread Ketchup Different Sandwiches like Farmhouse King come carbs without lot customization BURGER KING CALORIESFATPROTEINCARBSFIBERCheeseBurgerNo Bun Tomatoes Ketchup 13010G9G1G0GDoubleCheese BurgerNo Bun Ketchup 23018G18G1G0GGrilled Chicken SandwichNo Bun Tomatoes Ketchup 64053G40G2G0GDouble Cheese BurgerNo Bun27016G30G1G0G 5 Arby’s Arby’s Famous Roast beef place various meat option choose order without bread lowcarb best option hungry want eat high protein fast food meal Arby’s best option also help maintain keto goal Arby’s CALORIESFATPROTEINCARBSFIBERRoast Beef SandwichNo Bun15010G16G1GOGDouble Roast Beef SandwichNo Bun31020G31G2GOGHalf Round Roast SandwichNo Bun41026G41G2GOGSmokehouse BrisketNo Bun Onion Strings36027g28G3G1GThree Cheese Steak SandwichNo Bun Onion Strings41028G36G5G0GFire Roasted PhillyNo Bread43030G35G4G0GRebunNo Bread35026G25G7G1GGrand Turkey ClubNo Bread30020G26G4G1GRoast Turkey Swiss SandwichNo Bread32022G25G6G1G 6 Taco Bell Taco Bell Americanbased chain fastfood restaurant based Irvine California restaurant serve variety Mexicaninspired food include taco burrito quesadilla nacho novelty specialty item along variety item restaurant best Keto diet order salad Green salad stay fit keto diet Order order lettuce f side chicken side beef side two guacamole mix quick meal also add jalapeno extra taste 7 KFC ordering food KFC difficult fried food high carbs Even mediumsized piece fried chicken KFC around 8–11 carbs still craving chicken couple grilled option KFCCALORIESFATPROTEINCARBSFIBERGrilled Chicken Thigh Per Piece1509G17G0G0GGrilled Chicken DrumstickPer Piece804G11G0G0GGrilled Chicken BreastPer Piece2107G38G0G0GGreen Beans 250G1G4G2G 8 Starbucks Coffee Starbucks many option keto product including keto food Keto drink guide eat Starbucks according choice Order Starbucks’ keto food eggbased breakfastthemed Choices include Bacon gruyere sousvide egg chomp 9g net carbs Turkey bacon egg white breakfast sandwich without bun 2g net carbs Cauliflower tabbouleh serving mixed green 7g net carbs Restored meat cheddar nibble plate 0g net carbs 9Panera Bread Panera particularly ketoaccommodating numerous keto thing arrange straight menu change Clearly bread forbidden yet there’s still lot lowcarb passage browse OrderTags Keto Fast Food Keto Keto Fast Weight Loss Ketosis Keto Diet
|
187,944 |
10 Keto dessers for 2022 (That Actually Taste Good!)
|
10 Easy Keto Desserts for any Occassion
From fat bombs, to mug cakes, to cheesecake and chocolate mousse…these 10 low carb and Keto Desserts are quick and delicious treats, require minimal ingredients, and are perfect for any occasion.
cheesecake style sugar-free cake 🍰
It’s not really a cheesecake recipe, but the texture is as soft and tender as cheesecake ☁️This cake is so easy to make. Just a perfect treat to satisfy your sweet tooth.
Ingredients:
1 egg
200 gr ricotta
5 tbsp low-fat plain yogurt
5 tbs flour
2 tbsp agave syrup
1 tbsp sugar-free chocolate chips
1 tbs sugar-free butterscotch baking chips
2 tbsp peanut butter powder
Direction:
1. Whisk eggs with agave syrup.
2. Add the rest of the ingredients to the eggs (except chocolate chips and butterscotch chips) and mix it well.
3. Pour dough into the small cake pan (I had 2 small cake forms).
4. Sprinkle cheesecakes with chocolate and butterscotch chips.
5. Bake cheesecakes in the preheated till 360F degrees oven for 35–40 min.
6. Let it cool and enjoy ✨
One Minute Chocolate Cake 🧁
This single-serve chocolate cake is moist, tasty, and ready just in 1 minute ✨An easy microwave chocolate cake recipe for a quick and simple dessert with your morning coffee ☕️
Ingredients:
1 small egg
1 tbsp coconut flour
3 tbsp almond milk (or any milk of choice)
39 gr @tazachocolate organic salted almond chocolate disc
1 tbsp agave syrup
Direction:
1. Combine chocolate and milk in a microwave-safe container and send to the microwave for 45 seconds, until chocolate melts.
2. Add egg, flour, and syrup to a container with melted chocolate.
3. Pour dough into a microwave-safe mug/bowl and microwave it at maximum power for 45 seconds.
4. Let it cool and enjoy 🤎
Dairy-free French Crepes with Peanut butter and Banana Filling 🥞💛
This quick recipe for sugar-free, dairy-free crêpes uses minimal ingredients. You can create these delicious crepes so easily and fill them as you like them. I decided to fill them with peanut butter and banana 🍌
Ingredients:
1 cup any plant-based milk
3/4 rice flour (or any other flour of your choice)
2 eggs
1 1/2 tbsp agave syrup
1/2 tsp baking powder
Direction:
1. In a bowl whisk eggs and milk together.
2. Add other ingredients to the bowl.
3. Heat a medium-size non-stick frying pan over medium-high heat. Spray it lightly with cooking spray.
4. Pour ¼ cup batter into the preheated pan. Roll the batter in the pan from side to side to cover the bottom of the pan evenly with a thin layer of crepe batter.
5. Set the pan back on the heat and cook for about 1 minute, or until the edges are all curled up away from the pan and the bottom has browned a bit. Gently flip the crepe over and brown the other side for about 1 minute.
6. Remove the crepe from the pan.
7. Do the same with the remaining batter.
8. Spread peanut butter on each crepe and put sliced banana on half of the crepe or use any other filling you want.
9. Enjoy 💛
Chocolate Cherry Brownies 🍒
These chocolate cherry brownies are sugar-free, have an amazing texture, and are so easy to make 🙌Plus a combination of dark chocolate and cherries is just terrific.
Ingredients:
8.8 oz rice flour
1 1/2 tbsp cocoa powder
3 eggs
8.4 oz plain yogurt
1 tsp baking powder
3 tbsp frozen cherries
2 tbsp walnuts
3 tbsp monk fruit sweetener
1 oz (30 gr) sugar-free dark chocolate
Direction:
1. Mix all the ingredients except the dark chocolate, pour the dough into a cake pan and place it into a preheated to 360 degrees oven for 35–40 minutes.
2. Melt the chocolate and spread it over the brownie.
3. I also decorate the brownie with berries and nuts on top.
Sugar-free apple mug cake 🍮
Want a quick sugar-free dessert for one? Then this delicious and super moist mug cake is perfect for you 🤎
Ingredients:
170 gr greek yogurt
20 gr peanuts
100 gr apple sauce
1 egg
4 tbsp rice flour
pinch of baking powder
1 1/2 tbsp monk fruit sweetener
Direction:
1. Mix all the ingredients, pour the dough into a microwave-safe cup or bowl, and microwave it for 4 minutes.
2. I decorated the mug cake with melted dark chocolate nuts 🤍
Apple cinnamon pancakes 🥞
Currently, I’m craving any pastry with apples 🤗.That’s why when I decided to make pancakes for breakfast, I thought that it would be good to add some apples and cinnamon to it. These pancakes turned out to be so delicious, with a fluffy and soft texture ✨
Ingredients:
130 gm greek yogurt
1 apple
3 tbsp coconut milk
1/2 tbsp baking powder
30 gm walnuts
30 gm raisins
2 tbsp maple syrup
1/2 tsp cinnamon
4 tbsp rice flour
2 eggs
Direction:
1. Peel the apple and grate it on a fine grater.
2. Finely chop the walnuts.
3. Mix all the ingredients.
4. Spray a non-stick skillet with cooking spray and place on burner on medium-low heat.
5. Once the skillet is heated, place pancake batter into the pan.
6. Fry the pancakes on both sides in a pan for about 2,5 -3 min on each side.
7. Serve and enjoy 💛
Banana bread mug cake 🍌
Today I woke up with a desire to have something sweet for my breakfast ☕️And this soft, fluffy, perfectly sweetened with banana and a bit of agave syrup mug cake was an amazing way to start the day ✨Another quick and easy dessert that’s ready in just 3 minutes with no eggs required!
Ingredients:
2 tbsp coconut flour
1 tbsp agave syrup
1 medium ripe banana
pinch of baking powder
1/4 cup almond milk
1 tbsp sugar-free peanut butter
sprinkle of sugar-free chocolate chips
Direction:
1. Ripe one banana and add all ingredients, except chocolate chips, to it. Stir until well combined.
2. Place the dough in a microwave-safe mug or bowl.
3. Sprinkle with chocolate chips.
4. Microwave on high for 3 minutes.
5. Remove from microwave, grab a spoon, and enjoy 💛
Chocolate protein waffles 🧇 ✨
If you’re a chocolate lover like me or crave something sweet in the morning, then you will definitely like these chocolate protein waffles ✨They are sugar and eggs-free, just a perfectly healthy and guilt-free breakfast 💛
Ingredients:
30 gr @altereco_foods blackout dark chocolate
60 ml almond milk
1 tbsp peanut butter powder
1 tbsp chocolate protein
2 tbs oat flour
pinch of baking powder
Direction:
1. Melt chocolate with 20 ml of milk in a microwave.
2. In a bowl mix all the rest ingredients and add melted chocolate.
3. Place the batter on a preheated waffle iron and bake it for about 3 minutes.
4. I decorated the waffles with peanut butter, marshmallows, date syrup, and almonds.
Blackberry brown -sugar muffins 🧁🤍
Even though the name includes brown sugar, in reality, these muffins are sugar and butter-free, perfectly sweetened with a brown-sugar alternative, which has 0 calories in it 💛 It’s just a perfect sweet treat for the morning coffee ☕️
Ingredients:
2 large eggs
4 tbsp brown sugar alternative
3/4 cup almond milk
1 tsp vanilla extract
1 2/3 cup rice flour
1 tsp baking powder
3/4 cup of blackberries
Direction:
1. Separate the egg’s whites from yolks. Beat the whites with 3 tbsp of brown sugar alternative.
2. Add vanilla extract, milk, flour, and baking powder to the bowl with the yolks. Mix it well.
3. Gently add the whipped egg whites to the dough and stir.
4. Add chopped blackberries to the dough.
5. Pour batter into the muffin forms and sprinkle the top of the muffins with a brown sugar alternative.
6. Bake muffins in the preheated till 360F degrees oven for 40 min.
7. Enjoy 💛
Coconut protein cake
🧁
If you have moments that in the morning you want something sweet for your morning coffee ☕️ , then this recipe is for you. This muffin is very easy to prepare, delicious and has soft texture. And as a bonus, there is no refined sugar in it 🤗
Ingredients:
1 egg
1/2 cup almond milk
1/2 whole grain wheat flour
1/3 oat flour
1 tbsp protein
1 tbsp sugar-free peanut butter powder
1 tbsp coconut butter
1 tbsp extra virgin olive oil
2 tsp sugar-free chocolate chips
2 tbsp monk fruit sweetener
1 tsp baking powder
Direction:
1. In a bowl, combine all dry ingredients, except the sweetener.
2. Beat eggs with a sweetener.
3. Add to a bowl with dry ingredients oil, coconut butter, milk, and eggs.
4. Pour dough into a cake pan and bake it in the preheated to 350F degrees oven for 25–30 min.
5. I decorated the cake with sugar-free vanilla pudding, blueberries, and date syrup🫐
|
https://medium.com/@healthyfood24/10-keto-dessers-for-2022-that-actually-taste-good-dfbf52aa8ad9
|
['Healthy Food']
|
2021-12-30 19:25:45.950000+00:00
|
['2022', 'Dessert', 'Keto Dessert', 'Keto']
|
Title 10 Keto dessers 2022 Actually Taste GoodContent 10 Easy Keto Desserts Occassion fat bomb mug cake cheesecake chocolate mousse…these 10 low carb Keto Desserts quick delicious treat require minimal ingredient perfect occasion cheesecake style sugarfree cake 🍰 It’s really cheesecake recipe texture soft tender cheesecake ☁️This cake easy make perfect treat satisfy sweet tooth Ingredients 1 egg 200 gr ricotta 5 tbsp lowfat plain yogurt 5 tb flour 2 tbsp agave syrup 1 tbsp sugarfree chocolate chip 1 tb sugarfree butterscotch baking chip 2 tbsp peanut butter powder Direction 1 Whisk egg agave syrup 2 Add rest ingredient egg except chocolate chip butterscotch chip mix well 3 Pour dough small cake pan 2 small cake form 4 Sprinkle cheesecake chocolate butterscotch chip 5 Bake cheesecake preheated till 360F degree oven 35–40 min 6 Let cool enjoy ✨ One Minute Chocolate Cake 🧁 singleserve chocolate cake moist tasty ready 1 minute ✨An easy microwave chocolate cake recipe quick simple dessert morning coffee ☕️ Ingredients 1 small egg 1 tbsp coconut flour 3 tbsp almond milk milk choice 39 gr tazachocolate organic salted almond chocolate disc 1 tbsp agave syrup Direction 1 Combine chocolate milk microwavesafe container send microwave 45 second chocolate melt 2 Add egg flour syrup container melted chocolate 3 Pour dough microwavesafe mugbowl microwave maximum power 45 second 4 Let cool enjoy 🤎 Dairyfree French Crepes Peanut butter Banana Filling 🥞💛 quick recipe sugarfree dairyfree crêpes us minimal ingredient create delicious crepe easily fill like decided fill peanut butter banana 🍌 Ingredients 1 cup plantbased milk 34 rice flour flour choice 2 egg 1 12 tbsp agave syrup 12 tsp baking powder Direction 1 bowl whisk egg milk together 2 Add ingredient bowl 3 Heat mediumsize nonstick frying pan mediumhigh heat Spray lightly cooking spray 4 Pour ¼ cup batter preheated pan Roll batter pan side side cover bottom pan evenly thin layer crepe batter 5 Set pan back heat cook 1 minute edge curled away pan bottom browned bit Gently flip crepe brown side 1 minute 6 Remove crepe pan 7 remaining batter 8 Spread peanut butter crepe put sliced banana half crepe use filling want 9 Enjoy 💛 Chocolate Cherry Brownies 🍒 chocolate cherry brownie sugarfree amazing texture easy make 🙌Plus combination dark chocolate cherry terrific Ingredients 88 oz rice flour 1 12 tbsp cocoa powder 3 egg 84 oz plain yogurt 1 tsp baking powder 3 tbsp frozen cherry 2 tbsp walnut 3 tbsp monk fruit sweetener 1 oz 30 gr sugarfree dark chocolate Direction 1 Mix ingredient except dark chocolate pour dough cake pan place preheated 360 degree oven 35–40 minute 2 Melt chocolate spread brownie 3 also decorate brownie berry nut top Sugarfree apple mug cake 🍮 Want quick sugarfree dessert one delicious super moist mug cake perfect 🤎 Ingredients 170 gr greek yogurt 20 gr peanut 100 gr apple sauce 1 egg 4 tbsp rice flour pinch baking powder 1 12 tbsp monk fruit sweetener Direction 1 Mix ingredient pour dough microwavesafe cup bowl microwave 4 minute 2 decorated mug cake melted dark chocolate nut 🤍 Apple cinnamon pancake 🥞 Currently I’m craving pastry apple 🤗That’s decided make pancake breakfast thought would good add apple cinnamon pancake turned delicious fluffy soft texture ✨ Ingredients 130 gm greek yogurt 1 apple 3 tbsp coconut milk 12 tbsp baking powder 30 gm walnut 30 gm raisin 2 tbsp maple syrup 12 tsp cinnamon 4 tbsp rice flour 2 egg Direction 1 Peel apple grate fine grater 2 Finely chop walnut 3 Mix ingredient 4 Spray nonstick skillet cooking spray place burner mediumlow heat 5 skillet heated place pancake batter pan 6 Fry pancake side pan 25 3 min side 7 Serve enjoy 💛 Banana bread mug cake 🍌 Today woke desire something sweet breakfast ☕️And soft fluffy perfectly sweetened banana bit agave syrup mug cake amazing way start day ✨Another quick easy dessert that’s ready 3 minute egg required Ingredients 2 tbsp coconut flour 1 tbsp agave syrup 1 medium ripe banana pinch baking powder 14 cup almond milk 1 tbsp sugarfree peanut butter sprinkle sugarfree chocolate chip Direction 1 Ripe one banana add ingredient except chocolate chip Stir well combined 2 Place dough microwavesafe mug bowl 3 Sprinkle chocolate chip 4 Microwave high 3 minute 5 Remove microwave grab spoon enjoy 💛 Chocolate protein waffle 🧇 ✨ you’re chocolate lover like crave something sweet morning definitely like chocolate protein waffle ✨They sugar eggsfree perfectly healthy guiltfree breakfast 💛 Ingredients 30 gr alterecofoods blackout dark chocolate 60 ml almond milk 1 tbsp peanut butter powder 1 tbsp chocolate protein 2 tb oat flour pinch baking powder Direction 1 Melt chocolate 20 ml milk microwave 2 bowl mix rest ingredient add melted chocolate 3 Place batter preheated waffle iron bake 3 minute 4 decorated waffle peanut butter marshmallow date syrup almond Blackberry brown sugar muffin 🧁🤍 Even though name includes brown sugar reality muffin sugar butterfree perfectly sweetened brownsugar alternative 0 calorie 💛 It’s perfect sweet treat morning coffee ☕️ Ingredients 2 large egg 4 tbsp brown sugar alternative 34 cup almond milk 1 tsp vanilla extract 1 23 cup rice flour 1 tsp baking powder 34 cup blackberry Direction 1 Separate egg’s white yolk Beat white 3 tbsp brown sugar alternative 2 Add vanilla extract milk flour baking powder bowl yolk Mix well 3 Gently add whipped egg white dough stir 4 Add chopped blackberry dough 5 Pour batter muffin form sprinkle top muffin brown sugar alternative 6 Bake muffin preheated till 360F degree oven 40 min 7 Enjoy 💛 Coconut protein cake 🧁 moment morning want something sweet morning coffee ☕️ recipe muffin easy prepare delicious soft texture bonus refined sugar 🤗 Ingredients 1 egg 12 cup almond milk 12 whole grain wheat flour 13 oat flour 1 tbsp protein 1 tbsp sugarfree peanut butter powder 1 tbsp coconut butter 1 tbsp extra virgin olive oil 2 tsp sugarfree chocolate chip 2 tbsp monk fruit sweetener 1 tsp baking powder Direction 1 bowl combine dry ingredient except sweetener 2 Beat egg sweetener 3 Add bowl dry ingredient oil coconut butter milk egg 4 Pour dough cake pan bake preheated 350F degree oven 25–30 min 5 decorated cake sugarfree vanilla pudding blueberry date syrup🫐Tags 2022 Dessert Keto Dessert Keto
|
187,945 |
The ketogenic diet is a low-carb, high-fat diet which offers many health benefits.
|
Keto Diet: 10 Mistakes You Need To Know If You Want To Succeed
The ketogenic diet is a low-carb, high-fat diet which offers many health benefits. It may be the perfect plan for you if you are looking for weight loss, increased energy levels, or to improve your mental clarity. The keto diet consists of 80% healthy fats, 20% protein and 5% carbohydrate. This means that it restricts carb intake to 20 grams or less per day, focusing on good fats instead.
With the right amount of discipline and motivation, this diet can yield significant results. It isn’t as easy as just swapping out carbs for fats though! Here’s a step by step guide to starting the ketogenic diet for beginners as well as tips to help you maintain your progress throughout the duration of the diet.
Keto Diet: 10 Mistakes You Need To Know If You Want To Succeed.
The keto diet is a low-carb diet that emphasizes a high amount of healthy fats. While a ketogenic diet can be a great choice for a person with a chronic illness, a lot of people in the world have been adopting the keto diet without being medically advised.
In the following I have detailed the biggest mistakes you can make if you want to succeed on the keto diet.
1. Not checking your ketone levels
2. Not measuring the proper servings
3. Eating more than your caloric needs
4. Not drinking enough water
5. Not focusing on the percentage of fat
6. Eating processed foods You might think you’re being good by eating pizza, but it’s terrible for your body. Buy a vegetarian pizza, and top it off with something low in fat, like cheese or avocado.
No processed foods.
Processed foods completely destroy the keto diet. If you do eat a processed food, make sure you know the net carb count.
Give your blog post the title, “Top 10 keto diet mistakes you need to know before starting”
1. Processed Foods
2. The Net Carb Count
3. Keto Flu
4. Strict Carb Counting
5. Real Food
6. Carbs :
On a keto diet, you need to avoid white and brown rice, and pasta.
The only exceptions to this rule are:
Carbs:
Potatoes
Carrots
Green beans
Broccoli
These foods, in particular, are incredibly versatile and can be mixed into recipes in large quantities.
You want to avoid refined carbohydrates such as sugar and flour and opt for whole.
Keto dieting is a great way to shift to a fat-burning metabolism, but it’s amazing how many mistakes people make when starting out. Let’s take a look at the mistakes you need to know if you want to succeed:
1: No one should go keto if they’re pregnant.
2: Things like starchy vegetables and berries need to be limited.
3: Hunger pangs will be much more common than if you were sticking to a traditional diet.
There are a number of mistakes that people make when considering a keto diet. In order to make sure that you avoid these pitfalls, let’s go over the top 10 mistakes that people often make.
Hunger pangs will be much more common than if you were sticking to a traditional diet.
Many people struggle with hunger pangs on keto diets because their bodies are not getting any of the carbs they are used to.
It can be hard to stay happy and maintain a good mood when you are hungry all the time. The best way to find the right balance is to eat snacks with a high-fat content, such as nuts. This blog post will teach you some of the mistakes people make when attempting to follow the keto diet.
Keto diets are great for those who are looking to lose weight or maintain weight loss. They are packed full of natural fats, which are known to make the body feel full and satisfied longer. The best way to stay happy and maintain a positive mood while still following the keto diet is to eat snacks high in fat to stave off hunger. Though it sounds counterintuitive, consuming high-fat snacks can help regulate hunger.
10 Mistakes you need to know if you want to succeed with the Keto diet.
Keto dieting is all about the right formula. Here are the most common mistakes that can throw you off, and how to avoid them.
1) Losing Track of the week.
2) Letting weekdays get in the way of your Keto Diet.
3) Hitting a plateau.
4) Eating out on a Ketogenic Diet.
5) You may not be eating enough fat on a Keto Diet.
6) Your Ketogenic Diet may not include a lot of a variety of vegetables.
7) Weight Plateaus
8) Not Scrapping the Carbs
9) Taking a Plain Ketogenic Diet would be a mistake.
10) Not Enough Protein
If you would like to read more in details Access the link here:
AFFILIATE DISCLOSURE:
This article and description may contain affiliate links, which means that if you click on one of the product links, I’ll receive a small commission. I won’t put anything here that I haven’t verified and/or personally used myself.
|
https://medium.com/@krishrm81/the-ketogenic-diet-is-a-low-carb-high-fat-diet-which-offers-many-health-benefits-4b1a05cfaa95
|
['Krishna Mangale']
|
2021-12-25 19:55:03.478000+00:00
|
['Ketogenic', 'Keto Diet For Weight Loss', 'Keto', 'Keto Diet Plan', 'Keto Diet']
|
Title ketogenic diet lowcarb highfat diet offer many health benefitsContent Keto Diet 10 Mistakes Need Know Want Succeed ketogenic diet lowcarb highfat diet offer many health benefit may perfect plan looking weight loss increased energy level improve mental clarity keto diet consists 80 healthy fat 20 protein 5 carbohydrate mean restricts carb intake 20 gram le per day focusing good fat instead right amount discipline motivation diet yield significant result isn’t easy swapping carbs fat though Here’s step step guide starting ketogenic diet beginner well tip help maintain progress throughout duration diet Keto Diet 10 Mistakes Need Know Want Succeed keto diet lowcarb diet emphasizes high amount healthy fat ketogenic diet great choice person chronic illness lot people world adopting keto diet without medically advised following detailed biggest mistake make want succeed keto diet 1 checking ketone level 2 measuring proper serving 3 Eating caloric need 4 drinking enough water 5 focusing percentage fat 6 Eating processed food might think you’re good eating pizza it’s terrible body Buy vegetarian pizza top something low fat like cheese avocado processed food Processed food completely destroy keto diet eat processed food make sure know net carb count Give blog post title “Top 10 keto diet mistake need know starting” 1 Processed Foods 2 Net Carb Count 3 Keto Flu 4 Strict Carb Counting 5 Real Food 6 Carbs keto diet need avoid white brown rice pasta exception rule Carbs Potatoes Carrots Green bean Broccoli food particular incredibly versatile mixed recipe large quantity want avoid refined carbohydrate sugar flour opt whole Keto dieting great way shift fatburning metabolism it’s amazing many mistake people make starting Let’s take look mistake need know want succeed 1 one go keto they’re pregnant 2 Things like starchy vegetable berry need limited 3 Hunger pang much common sticking traditional diet number mistake people make considering keto diet order make sure avoid pitfall let’s go top 10 mistake people often make Hunger pang much common sticking traditional diet Many people struggle hunger pang keto diet body getting carbs used hard stay happy maintain good mood hungry time best way find right balance eat snack highfat content nut blog post teach mistake people make attempting follow keto diet Keto diet great looking lose weight maintain weight loss packed full natural fat known make body feel full satisfied longer best way stay happy maintain positive mood still following keto diet eat snack high fat stave hunger Though sound counterintuitive consuming highfat snack help regulate hunger 10 Mistakes need know want succeed Keto diet Keto dieting right formula common mistake throw avoid 1 Losing Track week 2 Letting weekday get way Keto Diet 3 Hitting plateau 4 Eating Ketogenic Diet 5 may eating enough fat Keto Diet 6 Ketogenic Diet may include lot variety vegetable 7 Weight Plateaus 8 Scrapping Carbs 9 Taking Plain Ketogenic Diet would mistake 10 Enough Protein would like read detail Access link AFFILIATE DISCLOSURE article description may contain affiliate link mean click one product link I’ll receive small commission won’t put anything haven’t verified andor personally used myselfTags Ketogenic Keto Diet Weight Loss Keto Keto Diet Plan Keto Diet
|
187,946 |
Benefits of the Keto Diet
|
Half-Keto is a popular diet philosophy for improving weight and metabolic health goals. But as with all things, there is a catch: If your goal is to lose weight, go keto, and follow a restrictive diet, you must have a serious focus on your nutrition.“The ketogenic diet is a high-fat, moderate-protein, low-carb diet that’s intended for people with Type 2 diabetes, certain types of epilepsy, and about 4.7 million people worldwide who are trying to manage the condition safely,” says Hillary Allen, a registered dietitian, and certified personal trainer. Secure in your decision to give the keto diet a try, here’s what registered dietitians wish you knew before tackling the ketogenic diet.
IT’S NOT A DIET FOR WEIGHT LOSS
“The keto diet puts tons of emphasis on health versus bodybuilding and is not very satisfying from what I’ve seen recently,” Allen says. “Moreover the rule around food (e.g., no grains, starches, sugar, or other sources of carbs) is so rigid. That’s not what I’d like to see with any diet.”Lawrence Shakespeare, MD, of Metabolic Health Nutrition, agrees, noting that a diet that emphasizes meat as your main food group has long been the “standard of the dietician and dietitian. While I am a huge advocate of the ketogenic diet for Type 2 diabetes, epilepsy, or anyone with prediabetes, it was never intended for weight loss.”Before trying the keto diet, evaluate your diet. “My advice would be to take a good, hard look at the food you are eating on a weekly, monthly, and quarterly basis,” Allen says. Getting back to balanced eating habits is key to success.
2. IT’S NUTRITIOUS AND PROTEIN-FRIENDLY
By reducing carbohydrates to less than 20%, the keto diet may reduce your appetite level while helping regulate blood sugar levels, says Sharon Palmer, owner and founder of Food Fretters and Nourished by Sharon. The result is reduced energy spikes in response to carbohydrate-containing foods.
3. YOU’LL LIKELY AIM TO REDUCE MEAL PREP TIME
“The ketogenic diet makes the planning and portioning of meals super simple and efficient,” Allen says. “The prep time will likely be minimal. It’s not a question of if or but when you’ll be comparing portions to standard diet and traditional fast-food options.” Keto meal plans are also much easier to follow. We have a present for you, a free keto recipe just for you!
4. IT TAKES APPROPRIATE PRECAUTIONS
“Any well-designed ketogenic diet should include a moderate amount of legumes, grains, vegetables, healthy fats, and protein,” Palmer says. It’s also important to keep sufficient protein and healthy fats such as vegetables and fruit around. Certain grains are restricted due to their glucose content and may cause blood sugar spikes.
|
https://medium.com/@Alex_keto/benefits-of-the-keto-diet-102aed9b527b
|
[]
|
2021-12-24 18:38:12.227000+00:00
|
['Diet', 'Health', 'Healthy', 'Keto', 'Keto Diet']
|
Title Benefits Keto DietContent HalfKeto popular diet philosophy improving weight metabolic health goal thing catch goal lose weight go keto follow restrictive diet must serious focus nutrition“The ketogenic diet highfat moderateprotein lowcarb diet that’s intended people Type 2 diabetes certain type epilepsy 47 million people worldwide trying manage condition safely” say Hillary Allen registered dietitian certified personal trainer Secure decision give keto diet try here’s registered dietitian wish knew tackling ketogenic diet IT’S DIET WEIGHT LOSS “The keto diet put ton emphasis health versus bodybuilding satisfying I’ve seen recently” Allen say “Moreover rule around food eg grain starch sugar source carbs rigid That’s I’d like see diet”Lawrence Shakespeare MD Metabolic Health Nutrition agrees noting diet emphasizes meat main food group long “standard dietician dietitian huge advocate ketogenic diet Type 2 diabetes epilepsy anyone prediabetes never intended weight loss”Before trying keto diet evaluate diet “My advice would take good hard look food eating weekly monthly quarterly basis” Allen say Getting back balanced eating habit key success 2 IT’S NUTRITIOUS PROTEINFRIENDLY reducing carbohydrate le 20 keto diet may reduce appetite level helping regulate blood sugar level say Sharon Palmer owner founder Food Fretters Nourished Sharon result reduced energy spike response carbohydratecontaining food 3 YOU’LL LIKELY AIM REDUCE MEAL PREP TIME “The ketogenic diet make planning portioning meal super simple efficient” Allen say “The prep time likely minimal It’s question you’ll comparing portion standard diet traditional fastfood options” Keto meal plan also much easier follow present free keto recipe 4 TAKES APPROPRIATE PRECAUTIONS “Any welldesigned ketogenic diet include moderate amount legume grain vegetable healthy fat protein” Palmer say It’s also important keep sufficient protein healthy fat vegetable fruit around Certain grain restricted due glucose content may cause blood sugar spikesTags Diet Health Healthy Keto Keto Diet
|
187,947 |
A Science-Based Guide to Recovery for Gaining Muscle Mass
|
Recovery Category 3: Nutrition
This wouldn’t be much of a fitness article if I didn’t tell you how I eat. The fact is, exercise alone will not create results. You’ve got to be eating right to support your body in this process.
Now, this topic is both the most simple and the most complex. It’s simple in that I personally only followed one diet during this exercise program. It’s complex because I followed a modified version of the oft-misunderstood ketogenic diet.
I personally do a ketogenic diet with 200 grams of carbs in my evening meal. This diet takes advantage of the muscle-gain effects of ketosis while keeping my glycogen stores high from the nightly carbs.
I also ate carbs more freely on weekends.
Keto is a big subject, and there are many ways to do it wrong. Also, even though this is the diet I chose to adhere to during my training program, it may not be the best for you.
Because of that, instead of talking about keto, I’m going to instead discuss a set of guidelines I follow for any diet when trying to gain muscle:
1. I eat real food
I personally believe that 90% of the success of diets is not what they have you eat, but what they have you stop eating.
People love to bash the newly popular carnivore diet, whereby adherents eat only meat and animal products. But, though the research is sparse, many people notice incredible benefits from this all-meat diet. Tribes throughout history have subsisted on solely animal-based diets, so it’s not exactly a new thing, but I suspect there is another effect that is contributing to these benefits.
They stopped eating all the other crap.
Think about it: How often do you eat something that has 10 or more ingredients that sound like lab chemicals or construction materials?
This is why I think the best first step for anyone who is trying to improve their nutrition is to start eating real, whole foods.
Robb Wolf of The Paleo Podcast says it well: If it didn’t have a face, don’t eat it. Now, obviously plants don’t have faces, but the key to this phrase is to get you to think of eating only things that were recently alive.
Eat plants that look like they are still plants and eat meat.
Don’t eat partially hydrogenated packaged foods, filled with weird ingredients like ammonium sulfate or isinglass.
2. I eat a lot of food
One of the best nutrition tips I’ve ever heard is the three-part mantra: Eat real food. Not too much. Mainly vegetables.
This mantra is great in that it promotes eating things that are natural and meant to go into your body from an evolutionary standpoint, while also getting the well-proven benefits of calorie restriction (eating not too much) and the nutritional power of many leafy green vegetables.
However, when you are trying to build muscle, you need to modify this mantra just a little bit. Instead of restricting your calories, you actually want to increase them.
Building muscle requires, to some extent, a calorie surplus, as well as adequate protein.
Now, personally, I don’t like counting calories, but for the duration of this exercise program, just try not to ever be hungry. If you feel hungry, you are not eating enough.
This is where a keto or low-carb diet can be beneficial, as fats are high-calorie food sources that will help you eat less often. If you go the other way and stick with a higher-carb diet, just try to stick with healthy sources of carbs.
It can be difficult to get high calories from carbs only eating whole vegetables as your food source, however, tubers can really change the game.
I recently discovered, and subsequently fell in love with the Japanese Sweet Potato. These things taste sweet like a yam, but have the texture and consistency of a flaky, chunky regular potato.
Bake ’em in the oven at 350 degrees Fahrenheit for an hour and a half, then drown ’em in coconut oil, and you’ve got one of the most delicious sources of healthy carbs I have found to date.
3. I mainly eat lean meat and fats from vegetables
Most of the meat sold in stores here in the U.S. has poor fat composition. Due to the high-grain diet, which is often unnatural for these animals, their fat has high amounts of inflammatory Omega-6 fat and low amounts of Omega-3.
To avoid getting this same situation in my own body, even though I do the high-fat ketogenic diet, I only eat lean, low-fat meat cuts. Then I get my dietary fat from vegetable sources, especially from extra virgin olive oil and avocados.
This extends into simply eating a lot of vegetables in general. A very common day for me is to eat a large, fake “chicken confit” meal consisting of a high amount of grapeseed oil, bok choy, which is a form of oriental cabbage that increases testosterone, and lean chicken breast.
At dinner, when I am restoring my muscle glycogen by adding carbs, I’ll do a sous vide chicken dinner with dinosaur kale and a large Japanese sweet potato. I lather the chicken with Primal Kitchen Avocado Mayonnaise and douse the potato with coconut oil.
During the day I might throw in some snacks in the form of macadamia nuts, or Wild Planet Sardines.
If you can stomach it, grass-fed, grass-finished (do not get any other kind) beef liver is one of the most nutritionally dense foods on the planet, and I try to eat it at least once a week. If you can’t stand the taste, there are some great recipes for making it more palatable using apple cider vinegar or lemon.
Bonus: I do a modified ketogenic diet
The ketogenic diet has been shown in studies to spare the amino acid leucine, which leads to increased muscle gains during weight training compared to high carb diets.
As I mentioned earlier, keto is poorly understood by many people, so I really can’t give you enough info to start keto in this guide alone. However, you may know already that I have written an extensive article on the ketogenic diet already that is posted here on Better Humans.
To use keto for this purpose, and truly follow my personal training plan, go read my guide at: Myths and Mistakes of the Ketogenic Diet, but apply my rules here.
The only difference in what the keto guide suggests and what I do for muscle building is that I don’t restrict calories, and I eat 200 grams of carbs from Japanese sweet potatoes with dinner.
This is so I have enough calories to gain muscle without injury and so that I have enough muscle glycogen (which is just sugar stored in your muscles) for high-intensity exercise that cannot be supported by fat as a fuel source.
You don’t have to do keto as long as you follow the three tips I mentioned here, but I like it better personally.
|
https://betterhumans.pub/how-i-gained-25-pounds-of-muscle-training-3-days-a-week-or-a-guide-to-recovery-bce2ffc1011
|
['Keenan Eriksson']
|
2022-01-06 18:50:23.370000+00:00
|
['Recovery', 'Health', 'Biohacking', 'Fitness', 'Keto']
|
Title ScienceBased Guide Recovery Gaining Muscle MassContent Recovery Category 3 Nutrition wouldn’t much fitness article didn’t tell eat fact exercise alone create result You’ve got eating right support body process topic simple complex It’s simple personally followed one diet exercise program It’s complex followed modified version oftmisunderstood ketogenic diet personally ketogenic diet 200 gram carbs evening meal diet take advantage musclegain effect ketosis keeping glycogen store high nightly carbs also ate carbs freely weekend Keto big subject many way wrong Also even though diet chose adhere training program may best instead talking keto I’m going instead discus set guideline follow diet trying gain muscle 1 eat real food personally believe 90 success diet eat stop eating People love bash newly popular carnivore diet whereby adherent eat meat animal product though research sparse many people notice incredible benefit allmeat diet Tribes throughout history subsisted solely animalbased diet it’s exactly new thing suspect another effect contributing benefit stopped eating crap Think often eat something 10 ingredient sound like lab chemical construction material think best first step anyone trying improve nutrition start eating real whole food Robb Wolf Paleo Podcast say well didn’t face don’t eat obviously plant don’t face key phrase get think eating thing recently alive Eat plant look like still plant eat meat Don’t eat partially hydrogenated packaged food filled weird ingredient like ammonium sulfate isinglass 2 eat lot food One best nutrition tip I’ve ever heard threepart mantra Eat real food much Mainly vegetable mantra great promotes eating thing natural meant go body evolutionary standpoint also getting wellproven benefit calorie restriction eating much nutritional power many leafy green vegetable However trying build muscle need modify mantra little bit Instead restricting calorie actually want increase Building muscle requires extent calorie surplus well adequate protein personally don’t like counting calorie duration exercise program try ever hungry feel hungry eating enough keto lowcarb diet beneficial fat highcalorie food source help eat le often go way stick highercarb diet try stick healthy source carbs difficult get high calorie carbs eating whole vegetable food source however tuber really change game recently discovered subsequently fell love Japanese Sweet Potato thing taste sweet like yam texture consistency flaky chunky regular potato Bake ’em oven 350 degree Fahrenheit hour half drown ’em coconut oil you’ve got one delicious source healthy carbs found date 3 mainly eat lean meat fat vegetable meat sold store US poor fat composition Due highgrain diet often unnatural animal fat high amount inflammatory Omega6 fat low amount Omega3 avoid getting situation body even though highfat ketogenic diet eat lean lowfat meat cut get dietary fat vegetable source especially extra virgin olive oil avocado extends simply eating lot vegetable general common day eat large fake “chicken confit” meal consisting high amount grapeseed oil bok choy form oriental cabbage increase testosterone lean chicken breast dinner restoring muscle glycogen adding carbs I’ll sou vide chicken dinner dinosaur kale large Japanese sweet potato lather chicken Primal Kitchen Avocado Mayonnaise douse potato coconut oil day might throw snack form macadamia nut Wild Planet Sardines stomach grassfed grassfinished get kind beef liver one nutritionally dense food planet try eat least week can’t stand taste great recipe making palatable using apple cider vinegar lemon Bonus modified ketogenic diet ketogenic diet shown study spare amino acid leucine lead increased muscle gain weight training compared high carb diet mentioned earlier keto poorly understood many people really can’t give enough info start keto guide alone However may know already written extensive article ketogenic diet already posted Better Humans use keto purpose truly follow personal training plan go read guide Myths Mistakes Ketogenic Diet apply rule difference keto guide suggests muscle building don’t restrict calorie eat 200 gram carbs Japanese sweet potato dinner enough calorie gain muscle without injury enough muscle glycogen sugar stored muscle highintensity exercise cannot supported fat fuel source don’t keto long follow three tip mentioned like better personallyTags Recovery Health Biohacking Fitness Keto
|
187,948 |
Custom Keto Diet Reviews 2021 — A Detailed Report On The Keto Weight Loss Program!
|
Custom Keto Diet program — Everything about the keto weight loss program Custom Keto Diet discussed. Custom Keto Diet reviews with author details, meal plan, benefits, pros and cons.
Custom Keto Diet Reviews- A Customized Keto Meal Program!
The Keto Diet is one diet that has become popular in recent times. It depends on the principle of ketosis, i.e. using the body’s fat reserves, in order to create energy that we can use for our day to day activities. The diet achieves this by totally cutting out any carbohydrate consumption, so the body is forced to turn to its fat reserves for fuel.
Well, the Keto Diet sounds nice and fancy, but it may be a little difficult to implement for first-timers. What carbs do you cut out, and how? You can’t just eliminate whole foods from your diet, that’s asking for trouble. Fortunately, the Custom Keto Diet is here to help you. But is this useful or just another fad diet? Read this Custom Keto Diet review to find out.
What is Custom Keto Diet program?
Today, weight loss methods are so many, that you’re spoilt for choice when it comes to choosing a program and sticking to it. Problem is, not all the programs or diets are practical. Some call for pretty drastic measures, and you may not be ready for such measures at this point in your life.
Custom Keto Diet is your one-stop-place for a customized keto meal program that can help you achieve optimum levels of health. People usually try adopting a keto diet after reading about it online, but it isn’t that easy.
You need to know what kind of foods you can or cannot include in your diet. You just can’t discard foods because you see fit. Moreover, the problem with most diet plans on the internet is that they adopt a one-size-fits-all approach, instead of a tailored individual approach towards beating obesity and giving people individual meal plans.
The Keto Diet is one diet that has become popular in recent times. It depends on the principle of ketosis, i.e. using the body’s fat reserves, to create energy that we can use for our day-to-day activities. The diet achieves this by totally cutting out any carbohydrate consumption, so the body is forced to turn to its fat reserves for fuel.
Though it might sound fancy it can be a little chaotic for a first-timer. You might be confused about your meal plans, workout routines, and much more. This is where Custom Keto Diet plans work miraculously. It aids to chart down a whole meal plan and other activities that will support your diet.
About the author
Custom Keto Diet was created by Rachel Roberts who had an extraordinary experience that led her to a ketogenic diet. It was along with her holistic team that included chefs, nutritionists, dieticians, and fitness consultants that she formed this plan. It took about 8 weeks for the program to be formed.
Her reflection on how every individual requires a customized diet for their body is the reason she decided to create the Custom Keto Diet Plan. most often people follow diets without having much knowledge of what best fits them. From her research and experience, she learned that a ketogenic diet can be customized and tailor-made for individuals and hence came up with the plan.
How does the Custom Keto Diet Plan work?
The way the Custom Keto Diet works is pretty simple. It is totally different from the one-size-fits-all diet plans that are readily available all over the internet. This diet plan works in a tailored manner, by taking into account your age, height, weight, and the kinds of foods that you eat, and how old you are.
The diet works in the following way.
First Step
You will have to fill in a few pieces of data about yourself. These include your age, gender, food preferences, workout intensity, weight, height, and desired weight. This helps the website understand your present status to analyze required calories, activity level, BMI, nutrition intake. This is the initial step to help prepare your exclusive Custom Keto Diet plan.
Second Step
After filling in the data and going through the analytics, you will be asked to enter your name and mail id after which you will be taken to the payment portal. Once you have purchased the plan, you will receive a mail with your custom keto diet plan.
Third Step
The final step is to keep up consistency in following the plan. You mustn’t break in between. Be it the meal plans, or workout routines stick to the planner so that you can lose weight healthily. The plan provides a list of recipes, the grocery list, and the portion size of each meal.
What does the Custom Keto Diet include?
When you purchase the Custom Keto Diet, you will get an 8-week customized meal plan designed specially by experts. There is a panel of fitness trainers, chefs, and nutritionists making sure that the plan is designed only after taking into account your overall health, and your choice of foods.
The plan includes foods you can eat and avoid. And no, it is not about eating less. It is about eating food properly, and avoiding carbs, and sticking to healthier alternatives in your diet. This makes your diet more enjoyable and you are likely to stick to it for longer. The meal plan is customizable as per your taste. It comes with instructions that help you keep your diet in order and make it free from any sort of confusion.
There are several recipes in the Custom Keto Diet program, and each recipe that is designed comes with detailed instructions. You can even make this food at home, with little to no chef experience. The plan also provides a list of groceries that you can easily purchase from your local stores.
You need not worry about having a limited choice in planning out meals, as there is a wide variety of plans listed in the program that you can choose from.
Click Here To Order Custom Keto Diet Plan From The Official Website
Features of Custom Keto Diet Plan
One of the primary features of the program is how they provide you with an 8-week meal plan that is organized according to your physique and choices.
You get a diet that is tailored accurately for your body’s calorie intake and activity levels.
Recipes that are easy to cook and healthy. These are delicious and simple and do not require one to be a pro at cooking.
A set of guidelines that helps you to customize these recipes into essential meals.
Several meals plans with a variety of foods so that you will not get bored eating the same thing.
Every recipe comes with clear instructions that make your cooking experience enjoyable and hassle-free.
The plan also provides you with a grocery list that makes shopping easy for you. These groceries are all easily available in your local stores.
Why should I buy the Custom Keto Diet?
The point of following a diet is so that you become fit. With the help of a plan, it becomes easier and more practical to stick to a diet. Custom Keto Diet helps someone who chooses to follow the Ketogenic diet.
If you are someone finding it hard to practice your diet, then with the help of Custom Keto Diet, you will be able to bring about consistency in your diet. You also have an idea of what nutrients you need to intake and how to chart out your meals and workout routines.
The Custom Keto Diet plan aids your weight loss process into a systematic model that ensures you do not break your diet.
Is the Custom Keto Diet optimal for everyone?
Any adult can use this diet plan if they want to adopt the ketogenic diet in their lifestyle. This diet, however, is best avoided by pregnant and nursing women who might need extra nutrition. This diet plan can be used by anyone interested in eating healthier and improving their quality of life via the ketogenic diet.
The diet isn’t a bad way to start living healthy. Whether you’re young or old, you can implement it in your life.
However, it is advised that if you have a medical condition existing, it is best to consult your doctor before you start the diet as it may otherwise affect your health. It is also advised that anyone below the age of 18 keep away from the diet. This plan is not designed for minors and they require a different level of nutrients.
Custom Keto Diet Benefits
It increases the fat-burning process. A ketogenic diet helps to drop insulin levels. This helps to burn fat easily. Your body does not have sufficient carbs to produce energy and hence converts the excess fat into energy. This burns your fat and helps in weight loss.
The keto diet is easy to follow and helps you balance your meals with food you love that is healthy. This helps you not to burden yourself with the diet. They are tailor-made for you and hence make it easy for you.
Your appetite is limited and you won’t have excessive cravings. The diet is designed with meals that will help you feel full easily. This will cut down your appetite which eventually helps you to cut down your calorie intake which is an important advantage mentioned in this custom keto diet reviews.
There are no hardcore gym routines that you have to follow. The diet practice is plenty enough. Your workout can be a moderate one with no back-breaking regimes.
The diet program is healthy and safe to practice. As the diet is exclusive to what your body demands there is no side effect and harm to your body.
You start losing weight rapidly. With the Custom Keto Diet Plan, you will notice how you are losing weight in the first few weeks itself. It is an organic process and takes time but the process will help you lose weight and not gain it back. It provides a long-lasting result.
You can build an overall healthy lifestyle. You control your blood sugar levels, your blood pressure levels, and also your cholesterol levels with the help of a Custom Keto Diet plan.
It comes with a 100% money-back guarantee that ensures your refund if you are unhappy with the supplements.
You can easily find the groceries in your local stores and the recipes are easy to make while being healthy.
How do you get your hands on this?
It is available on their official page only. If you wish to customize a diet plan, you need to visit their official website You may come across several websites offering attractive discounts and guarantees but those are not legit. The official website has not authorized access for sale to any other website.
The program was originally priced at $97 but now there is a discount on their website and you can customize your keto diet plan for $ 37. The site also provides a 60-day money-back guarantee that offers you a 100% refund if you are unhappy with the diet plan.
Is Custom Keto Diet Plan legit?
From the studies and reviews, I would say that the plan is legit. There is nothing that looks shady about this plan and it has shown successful results for many of its users.
You may come across some websites that try to trick you into a sham by giving you a fake keto diet plan. There are non legit sites that try to steal your money and personal information. It is advised to stay away from these sites and purchase only from their official page.
Custom keto Diet Customer Reviews and Complaints
There have been no complaints as of now in regards to the program. The customer reviews also shed a positive light on the Custom Keto Diet plan and talk about how the plan has helped people find a great deal of success in maintaining their diet.
Final Thoughts on Custom Keto Diet Review
The Keto diet is pretty popular in the US due to its successful weight loss effect. The diet has been followed by many individuals as they do not have to go through drastic changes. The diet is easy to customize as well. For a fresher, it can be a little overwhelming if they do not have a proper guide. With a Custom Keto Diet plan, this is made easy.
As explained in this Custom Keto Diet review, you get to improve your diet and lose weight rapidly if you are consistent with the plan. It comes with a list of recipes, groceries, and meal plans which are charted to fit exclusively for your body.
You also are guaranteed a 100% refund if you are unhappy with the plan. If you are looking into the ketogenic diet and think a plan would help you kick start your healthy routine, I’d suggest you give Custom Keto Diet plan a try if you are convinced.
Click Here To Order Custom Keto Diet Plan From The Official Website
Contact Details: Custom Keto Diet
[email protected]
TOLL FREE 424–207–1558
About Consumers Companion
ConsumersCompanion is an e-commerce news and product review website for dietary supplements including vitamins, and we are dedicated to presenting only the most effectual supplements manufactured by the most trusted brands in the industry.
We’re dedicated to giving information about products that facilitate your health. Each natural supplement, you’ll find on our website have been judged by our research team for its quality. Every product we highlight is backed by a money-back guarantee and our secure website confirm a safe shopping practice for our customers. In addition, our knowledgeable experts are ready to clarify all your doubts and help you gain better health.
It’s sometimes hard to cut through all the junk that’s out there when all you require is a solution to your trouble. Marketing professionals have knowledge about the health issues people have and they take advantage of our strong desires to gain better health.
Affiliate Disclosure:
The links contained in this product review may result in a small commission to ConsumersCompanion if you opt to purchase the product recommended at no additional cost to you. This goes towards supporting our research and editorial team and please know we only recommend high quality products.
Disclaimer:
Please understand that any advice or guidelines revealed here are not even remotely a substitute for sound medical advice from a licensed healthcare provider. Make sure to consult with a professional physician before making any purchasing decision if you use medications or have concerns following the review details shared above. Individual results may vary as the statements made regarding these products have not been evaluated by the Food and Drug Administration. The efficacy of these products has not been confirmed by FDA-approved research. These products are not intended to diagnose, treat, cure or prevent any disease.
Product support: [email protected]
|
https://medium.com/@ps202007/custom-keto-diet-reviews-2021-a-detailed-report-on-the-keto-weight-loss-program-d4abe50005b4
|
['Patel Snehal']
|
2021-12-28 17:12:59.324000+00:00
|
['Weight Loss', 'Custom Keto Diet Reviews', 'Health', 'Keto', 'Custom Keto Diet Plan']
|
Title Custom Keto Diet Reviews 2021 — Detailed Report Keto Weight Loss ProgramContent Custom Keto Diet program — Everything keto weight loss program Custom Keto Diet discussed Custom Keto Diet review author detail meal plan benefit pro con Custom Keto Diet Reviews Customized Keto Meal Program Keto Diet one diet become popular recent time depends principle ketosis ie using body’s fat reserve order create energy use day day activity diet achieves totally cutting carbohydrate consumption body forced turn fat reserve fuel Well Keto Diet sound nice fancy may little difficult implement firsttimers carbs cut can’t eliminate whole food diet that’s asking trouble Fortunately Custom Keto Diet help useful another fad diet Read Custom Keto Diet review find Custom Keto Diet program Today weight loss method many you’re spoilt choice come choosing program sticking Problem program diet practical call pretty drastic measure may ready measure point life Custom Keto Diet onestopplace customized keto meal program help achieve optimum level health People usually try adopting keto diet reading online isn’t easy need know kind food cannot include diet can’t discard food see fit Moreover problem diet plan internet adopt onesizefitsall approach instead tailored individual approach towards beating obesity giving people individual meal plan Keto Diet one diet become popular recent time depends principle ketosis ie using body’s fat reserve create energy use daytoday activity diet achieves totally cutting carbohydrate consumption body forced turn fat reserve fuel Though might sound fancy little chaotic firsttimer might confused meal plan workout routine much Custom Keto Diet plan work miraculously aid chart whole meal plan activity support diet author Custom Keto Diet created Rachel Roberts extraordinary experience led ketogenic diet along holistic team included chef nutritionist dietician fitness consultant formed plan took 8 week program formed reflection every individual requires customized diet body reason decided create Custom Keto Diet Plan often people follow diet without much knowledge best fit research experience learned ketogenic diet customized tailormade individual hence came plan Custom Keto Diet Plan work way Custom Keto Diet work pretty simple totally different onesizefitsall diet plan readily available internet diet plan work tailored manner taking account age height weight kind food eat old diet work following way First Step fill piece data include age gender food preference workout intensity weight height desired weight help website understand present status analyze required calorie activity level BMI nutrition intake initial step help prepare exclusive Custom Keto Diet plan Second Step filling data going analytics asked enter name mail id taken payment portal purchased plan receive mail custom keto diet plan Third Step final step keep consistency following plan mustn’t break meal plan workout routine stick planner lose weight healthily plan provides list recipe grocery list portion size meal Custom Keto Diet include purchase Custom Keto Diet get 8week customized meal plan designed specially expert panel fitness trainer chef nutritionist making sure plan designed taking account overall health choice food plan includes food eat avoid eating le eating food properly avoiding carbs sticking healthier alternative diet make diet enjoyable likely stick longer meal plan customizable per taste come instruction help keep diet order make free sort confusion several recipe Custom Keto Diet program recipe designed come detailed instruction even make food home little chef experience plan also provides list grocery easily purchase local store need worry limited choice planning meal wide variety plan listed program choose Click Order Custom Keto Diet Plan Official Website Features Custom Keto Diet Plan One primary feature program provide 8week meal plan organized according physique choice get diet tailored accurately body’s calorie intake activity level Recipes easy cook healthy delicious simple require one pro cooking set guideline help customize recipe essential meal Several meal plan variety food get bored eating thing Every recipe come clear instruction make cooking experience enjoyable hasslefree plan also provides grocery list make shopping easy grocery easily available local store buy Custom Keto Diet point following diet become fit help plan becomes easier practical stick diet Custom Keto Diet help someone chooses follow Ketogenic diet someone finding hard practice diet help Custom Keto Diet able bring consistency diet also idea nutrient need intake chart meal workout routine Custom Keto Diet plan aid weight loss process systematic model ensures break diet Custom Keto Diet optimal everyone adult use diet plan want adopt ketogenic diet lifestyle diet however best avoided pregnant nursing woman might need extra nutrition diet plan used anyone interested eating healthier improving quality life via ketogenic diet diet isn’t bad way start living healthy Whether you’re young old implement life However advised medical condition existing best consult doctor start diet may otherwise affect health also advised anyone age 18 keep away diet plan designed minor require different level nutrient Custom Keto Diet Benefits increase fatburning process ketogenic diet help drop insulin level help burn fat easily body sufficient carbs produce energy hence convert excess fat energy burn fat help weight loss keto diet easy follow help balance meal food love healthy help burden diet tailormade hence make easy appetite limited won’t excessive craving diet designed meal help feel full easily cut appetite eventually help cut calorie intake important advantage mentioned custom keto diet review hardcore gym routine follow diet practice plenty enough workout moderate one backbreaking regime diet program healthy safe practice diet exclusive body demand side effect harm body start losing weight rapidly Custom Keto Diet Plan notice losing weight first week organic process take time process help lose weight gain back provides longlasting result build overall healthy lifestyle control blood sugar level blood pressure level also cholesterol level help Custom Keto Diet plan come 100 moneyback guarantee ensures refund unhappy supplement easily find grocery local store recipe easy make healthy get hand available official page wish customize diet plan need visit official website may come across several website offering attractive discount guarantee legit official website authorized access sale website program originally priced 97 discount website customize keto diet plan 37 site also provides 60day moneyback guarantee offer 100 refund unhappy diet plan Custom Keto Diet Plan legit study review would say plan legit nothing look shady plan shown successful result many user may come across website try trick sham giving fake keto diet plan non legit site try steal money personal information advised stay away site purchase official page Custom keto Diet Customer Reviews Complaints complaint regard program customer review also shed positive light Custom Keto Diet plan talk plan helped people find great deal success maintaining diet Final Thoughts Custom Keto Diet Review Keto diet pretty popular US due successful weight loss effect diet followed many individual go drastic change diet easy customize well fresher little overwhelming proper guide Custom Keto Diet plan made easy explained Custom Keto Diet review get improve diet lose weight rapidly consistent plan come list recipe grocery meal plan charted fit exclusively body also guaranteed 100 refund unhappy plan looking ketogenic diet think plan would help kick start healthy routine I’d suggest give Custom Keto Diet plan try convinced Click Order Custom Keto Diet Plan Official Website Contact Details Custom Keto Diet supportcustomketodietcom TOLL FREE 424–207–1558 Consumers Companion ConsumersCompanion ecommerce news product review website dietary supplement including vitamin dedicated presenting effectual supplement manufactured trusted brand industry We’re dedicated giving information product facilitate health natural supplement you’ll find website judged research team quality Every product highlight backed moneyback guarantee secure website confirm safe shopping practice customer addition knowledgeable expert ready clarify doubt help gain better health It’s sometimes hard cut junk that’s require solution trouble Marketing professional knowledge health issue people take advantage strong desire gain better health Affiliate Disclosure link contained product review may result small commission ConsumersCompanion opt purchase product recommended additional cost go towards supporting research editorial team please know recommend high quality product Disclaimer Please understand advice guideline revealed even remotely substitute sound medical advice licensed healthcare provider Make sure consult professional physician making purchasing decision use medication concern following review detail shared Individual result may vary statement made regarding product evaluated Food Drug Administration efficacy product confirmed FDAapproved research product intended diagnose treat cure prevent disease Product support supportcustomketodietcomTags Weight Loss Custom Keto Diet Reviews Health Keto Custom Keto Diet Plan
|
187,949 |
Low Carb High Protein Diets — Are There Problems?
|
This article is from www.wholehealthemporium.com and may contain affiliate links.
Why do people eventually abandon their diets?
Is it because they get impatient? Is it because they get into a plateau?
Did you excuse did you give when you abandoned your diet? No worries no judgment here!
This article gives us an insight on why most low carb, high protein diets can be problematic.
Do they work? Yes — you do lose weight initially on a High Protein/Low Carb diet. You lose a lot of water weight initially.
And this can be a contributing factor to other health problems.
Some people get phenomenal results with supplements — I recommend this one!
So What Happens After?
What happens after your body has shed its water weight?
You Can Lose Muscle Mass
Like most diets, people who adhere to the keto diet experience a plateau in their weight loss journey. This can be attributed to a slowed metabolism.
Amanda Macmillan writes that keto related weight loss is mostly loss of muscle mass. Even though most people achieve ketosis, the weight that they lose is from muscle because muscle burns more calories than fat.
Because of this, their metabolism slows down leading to a plateau. One becomes discouraged and go off the ketogenic diet.
They regain most of the weight lost but they do not have the same muscle mass to burn as much calories.
The Color Of Your Urine Might Change
If you’ve ever been on one of these diets, you’ve noticed that your urine gets yellow.
This is due to ketones which is a by-product of ketosis. This is evidence that your body is burning and breaking up muscle tissue which is protein.
That’s dangerous because if too much of your body’s protein is broken down you could suffer irreparable liver and kidney damage.
Further symptoms of muscle breakdown are evident in general weakness, fatigue and lack of energy.
You May Be At Risk Of Heart Disease
Several studies have reported that cholesterol levels, especially LDL (bad cholesterol) are increased.
“When people eat fewer carbohydrates, their liver produces fewer triglycerides, which may play a role in raising HDL cholesterol levels.” Jessica Caporuscio, Pharm.D.
Another downside of Low Carb/High Fat diets is that studies show that the less carbs you consume the more likely you are to consume more fat.
And this excess fat is stored up in your body’s fat cells where they’ll linger indefinitely, clogging up your arteries with unhealthy cholesterol.
High levels of cholesterol put people at a higher risk of developing heart disease and diabetes.
How Do You Avoid These Disadvantages?
There’s a simple way to avoid this. Do not restrict your diet to any one food group or category.
Rather than blindly cutting Carbohydrates and increasing protein and fat intake, you should opt for a healthy ratio of 30% protein, 15% fat, and 55% Complex Carbohydrates.
This ratio will help you to lose weight steadily and safely. The key is to reduce fat and simple carbohydrates not carbohydrates in general.
Complex Carbohydrates
Because complex carbs have a low glycemic index your body has to use 250% more energy to convert these carbs into fuel than it does to convert fat into fuel.
Your body works harder to metabolize and burn calories from complex carbs than it does High Protein/Low Carb.
What are the results? Safe, systematic weight reduction — the best way to avoid health problems and sagging skin caused by too rapid weight loss.
Conclusion
Much like many diets, the keto diet has its pros and cons. The only way to avoid these possibly catastrophic complications is to come with a sustainable diet and exercise routine.
As many fitness gurus say, weight loss is a lifestyle. It is a marathon not a sprint!
Thank you for reading
What was your low carb journey like?
Leave a comment below and share your thoughts with us!
© Copyright 2021 Whole Health Emporium. All Right Reserved.
Article Credits: Pauline D. and Richard Tracy
Works Cited
Jessica Caporuscio, Phar. “How Can the Keto Diet Affect Cholesterol? Safety and Risks.” Medicalnewstoday.com. N.p., 1 Sept. 2019. Web. 24 Oct. 2021.
Ogden, Jane. “Why Do Diets Fail?” The Psychology of Dieting. Routledge, 2018. 41–47. Print.
|
https://medium.com/@wholehealthemporium/low-carb-high-protein-diets-are-there-problems-fc6eac4767c6
|
['Whole Health Emporium']
|
2021-12-19 14:01:12.962000+00:00
|
['Weight Loss', 'Health', 'Healthcare', 'Keto', 'Weight Loss Tips']
|
Title Low Carb High Protein Diets — ProblemsContent article wwwwholehealthemporiumcom may contain affiliate link people eventually abandon diet get impatient get plateau excuse give abandoned diet worry judgment article give u insight low carb high protein diet problematic work Yes — lose weight initially High ProteinLow Carb diet lose lot water weight initially contributing factor health problem people get phenomenal result supplement — recommend one Happens happens body shed water weight Lose Muscle Mass Like diet people adhere keto diet experience plateau weight loss journey attributed slowed metabolism Amanda Macmillan writes keto related weight loss mostly loss muscle mass Even though people achieve ketosis weight lose muscle muscle burn calorie fat metabolism slows leading plateau One becomes discouraged go ketogenic diet regain weight lost muscle mass burn much calorie Color Urine Might Change you’ve ever one diet you’ve noticed urine get yellow due ketone byproduct ketosis evidence body burning breaking muscle tissue protein That’s dangerous much body’s protein broken could suffer irreparable liver kidney damage symptom muscle breakdown evident general weakness fatigue lack energy May Risk Heart Disease Several study reported cholesterol level especially LDL bad cholesterol increased “When people eat fewer carbohydrate liver produce fewer triglyceride may play role raising HDL cholesterol levels” Jessica Caporuscio PharmD Another downside Low CarbHigh Fat diet study show le carbs consume likely consume fat excess fat stored body’s fat cell they’ll linger indefinitely clogging artery unhealthy cholesterol High level cholesterol put people higher risk developing heart disease diabetes Avoid Disadvantages There’s simple way avoid restrict diet one food group category Rather blindly cutting Carbohydrates increasing protein fat intake opt healthy ratio 30 protein 15 fat 55 Complex Carbohydrates ratio help lose weight steadily safely key reduce fat simple carbohydrate carbohydrate general Complex Carbohydrates complex carbs low glycemic index body use 250 energy convert carbs fuel convert fat fuel body work harder metabolize burn calorie complex carbs High ProteinLow Carb result Safe systematic weight reduction — best way avoid health problem sagging skin caused rapid weight loss Conclusion Much like many diet keto diet pro con way avoid possibly catastrophic complication come sustainable diet exercise routine many fitness guru say weight loss lifestyle marathon sprint Thank reading low carb journey like Leave comment share thought u © Copyright 2021 Whole Health Emporium Right Reserved Article Credits Pauline Richard Tracy Works Cited Jessica Caporuscio Phar “How Keto Diet Affect Cholesterol Safety Risks” Medicalnewstodaycom Np 1 Sept 2019 Web 24 Oct 2021 Ogden Jane “Why Diets Fail” Psychology Dieting Routledge 2018 41–47 PrintTags Weight Loss Health Healthcare Keto Weight Loss Tips
|
187,950 |
If you’re looking to lose fat then you have to try this brand new custom keto meal plan!
|
If you’re looking to lose fat then you have to try this brand new custom keto meal plan! Lexi Luxe Dec 22, 2021·7 min read
To create this service, certified nutritionists, personal trainers, and chefs united to develop keto meal plans that are effective, convenient, cost-efficient, and enjoyable.
Since their launch in January 2019, hundreds of clients have already transformed their figure and health with the benefits a proper keto diet can offer.
Speaking of benefits: in this email, you’ll discover eight scientifically-proven ones offered by the keto diet.
To show how effective the meal plans are, here’s what real clients have to say !
If you’re like most people, you’re at least tickled by the idea of being able to walk around with a lean figure that turns heads wherever you go.
Now, I’m not saying this custom meal plan will sculpt your body into the best shape of your life overnight. It takes time and effort to lose fat and “tone up” your body.
But I will say that they’ve designed this custom meal plan service to help men and women all over the world turn their lives around and take charge of their health and figure.
“As of today I’ve lost 35 pounds, I have no hunger pangs and mentally I feel sharp as a pin. This is definitely going to become a ‘way of life’ for me as it’s so easy to follow…
“All my meals are planned out for me and I even get a downloadable shopping list with all the ingredients I need for the weekly shop so it really is a doddle.”
“I’m 4 weeks into my custom keto diet plan and I’ve lost 14 pounds which I must say is pretty incredible, it’s actually amazing watching my body transform into something I am actually proud of rather than something I have always tried to cover up.”
“I’ve struggled with my weight my whole life and it’s safe to say that I’ve tried a LOT of diets… The Keto diet is the only one I’ve managed to stick to and the weight is literally melting off my body.
“Unlike other diets where I am feeling hungry all day and food is constantly on my mind, the keto diet has completely eliminated this, I actually NEVER feel hungry with this way of eating!
“I would definitely recommend anyone struggling to lose weight to try these custom keto meal plans as they really have been a godsend for me.”
Obviously, they deserve a hearty round of applause for their dedicated effort and results. But that’s not why I’m writing you today. I’m writing because YOU can follow in their footsteps, too.
You can start right now on your journey to a lean and healthy body, and I want to prove it to you.
claim your 100%-made-for-you keto meal plan designed to help you lose fat, boost energy levels, and improve health.
We’ll show you what to eat every day to reach your goals in the fastest and most enjoyable way.
In other words, my team and I have done all the “heavy lifting” for you — from determining your calorie and macro intake, to setting up your meal plan, to outlining meal prep instructions, and more.
Do you make these four common weight loss mistakes !
If you feel stuck in a rut or displeased with your results, there’s a good chance you make one or more of the following weight loss mistakes.
Mistake #1: Not being in a calorie deficit
No matter how “clean” you eat and how much you exercise, you’ll never lose weight if you’re not in a calorie deficit.
It works like this:
- If you consume more calories than you burn, you’ll gain weight
- If you consume fewer calories than you burn, you’ll lose weight
That’s a scientific fact. [1]
Case in point: Mark Haub, professor of human nutrition at Kansas State University, ate Twinkies, Oreos, Doritos, and protein shakes for two months while maintaining a moderate daily calorie deficit.
The result?
He lost 27 pounds in two months by eating junk food… just because he was in a calorie deficit.
Now, we don’t advice you follow such a diet because that’s terrible for your health, but it proves my point.
Mistake #2: Adapting a too severe calorie deficit
If an energy deficit of 300 calories a day will get you lean, a 900 calorie deficit should slim you down three times as fast, right?
Wrong!
A severe calorie deficit will not lead to superior fat loss but actually hurts your progress for four reasons:
- It slows down your metabolism, which means you’ll burn fewer calories a day. This sets you up for regaining all the lost pounds once you go off the diet
- Severe dieting causes excessive muscle loss, which hampers metabolism
- Your cravings go haywire, which makes you more likely to cheat on your diet plan or even toss it out the window
- It wreaks havoc on your hormonal health. For example, it spikes the “stress hormone” cortisol, which stimulates muscle wasting and reduces fat burning
That’s why low-calorie diets are doomed to fail. While you may lose some weight during the first few days, you’ll regain the lost pounds once your willpower runs out. Plus, you’ll likely gain some weight on top of it.
Mistake #3: Thinking all calories are created equal
As mentioned, being in a calorie deficit is key to losing weight. But this doesn’t mean all calories are created equal!
You see, most of us strive to improve our appearance. And to do this, it’s not about weight loss but instead about fat loss.
To lose fat, it’s essential to consider which energy sources you use for your calories.
For example, if you don’t consume enough protein, much of the weight you’ll lose will be muscle tissue.
But, on the other hand, if you make sure you consume enough protein, you’ll maintain your muscle mass, and a significant share of your weight loss comes from actual body fat.
Besides, consuming the right foods is also essential for diet adherence. Simply put, certain foods are more satiating than others, and if you eat such filling foods, it’s easier to stay on track with your diet.
That’s why you want to have a diet with an optimized food selection — a selection based on your own personal situation and goals.
Mistake #4: Following an unrealistic, overly restrictive diet
Willpower is like a battery — you only have so much of it until it runs out. And that’s why restrictive diets tend to fail in the long-run.
Eventually, they deplete your willpower, which results in binging and makes you lose all your progress.
I’ve seen it countless times before… a guy or gal who is dedicated to losing weight and getting healthy. He or she starts a diet that only allows foods like tilapia, asparagus, and chicken.
While the results are good in the beginning and the dieter loyally brings their Tupperware boxes with “healthy” meals wherever he or she goes, it only lasts a short time before their willpower — and therefore their diet — goes down the gutter.
The solution?
I’ve created a custom meal plan service for common fat loss blunders like the four outlined above.
I’ve brought certified nutritionists, personal trainers, and chefs together to create perfect keto meal plans — ones that are effective, convenient, cost-effective, enjoyable, and tailored to you. These custom meal plans are developed based on the latest scientific research behind nutrition, so you can enhance your health and figure in the fastest and most doable manner. And when I say “custom” meal plan, I mean it. Your meal plan is completely designed from the answers you gave during the eight-step questionnaire on our website. So, are you ready to support your figure, health, and well-being with a tailored-to-you keto diet plan.
Is the custom meal plan right for you!
Are you still not sure if my custom meal plan service is for you?
If so, I understand.
Honestly, it’s not for everyone.
It’s not for people who are happy with their current situation and don’t feel the need to enhance their health, figure, and energy level.
It’s not for people who are looking for an unhealthy, quick-fix crash diet that depletes their willpower and causes weight to come back immediately upon stopping.
It’s not even for people who are “unmotivated,” because, as we all know, changing a diet requires commitment and consistency.
Instead, this custom meal plan service is for people who want to be in control of their health and wellbeing.
It’s for people who want to finally achieve a figure that makes them feel proud when they look in the mirror.
It’s for people who are driven to fix what’s unhealthy, heal what’s broken, and improve what’s lacking, and who believe that no matter the circumstances, something can always be done about it.
And it’s for people who want the best for their bodies and lives, and who are driven to eat healthier, feel more energetic, and fulfill their true potential.
MORE INFO VISIT OFFICIAL WEBSITE CLICK HERE
|
https://medium.com/@8ulenq9jdq/if-youre-looking-to-lose-fat-then-you-have-to-try-this-brand-new-custom-keto-meal-plan-ae8099fe7df8
|
['Lexi Luxe']
|
2021-12-22 11:15:41.067000+00:00
|
['Lose Weight Naturally', 'Weight Loss', 'Kito Diet', 'Keto', 'Lose Weight']
|
Title you’re looking lose fat try brand new custom keto meal planContent you’re looking lose fat try brand new custom keto meal plan Lexi Luxe Dec 22 2021·7 min read create service certified nutritionist personal trainer chef united develop keto meal plan effective convenient costefficient enjoyable Since launch January 2019 hundred client already transformed figure health benefit proper keto diet offer Speaking benefit email you’ll discover eight scientificallyproven one offered keto diet show effective meal plan here’s real client say you’re like people you’re least tickled idea able walk around lean figure turn head wherever go I’m saying custom meal plan sculpt body best shape life overnight take time effort lose fat “tone up” body say they’ve designed custom meal plan service help men woman world turn life around take charge health figure “As today I’ve lost 35 pound hunger pang mentally feel sharp pin definitely going become ‘way life’ it’s easy follow… “All meal planned even get downloadable shopping list ingredient need weekly shop really doddle” “I’m 4 week custom keto diet plan I’ve lost 14 pound must say pretty incredible it’s actually amazing watching body transform something actually proud rather something always tried cover up” “I’ve struggled weight whole life it’s safe say I’ve tried LOT diets… Keto diet one I’ve managed stick weight literally melting body “Unlike diet feeling hungry day food constantly mind keto diet completely eliminated actually NEVER feel hungry way eating “I would definitely recommend anyone struggling lose weight try custom keto meal plan really godsend me” Obviously deserve hearty round applause dedicated effort result that’s I’m writing today I’m writing follow footstep start right journey lean healthy body want prove claim 100madeforyou keto meal plan designed help lose fat boost energy level improve health We’ll show eat every day reach goal fastest enjoyable way word team done “heavy lifting” — determining calorie macro intake setting meal plan outlining meal prep instruction make four common weight loss mistake feel stuck rut displeased result there’s good chance make one following weight loss mistake Mistake 1 calorie deficit matter “clean” eat much exercise you’ll never lose weight you’re calorie deficit work like consume calorie burn you’ll gain weight consume fewer calorie burn you’ll lose weight That’s scientific fact 1 Case point Mark Haub professor human nutrition Kansas State University ate Twinkies Oreos Doritos protein shake two month maintaining moderate daily calorie deficit result lost 27 pound two month eating junk food… calorie deficit don’t advice follow diet that’s terrible health prof point Mistake 2 Adapting severe calorie deficit energy deficit 300 calorie day get lean 900 calorie deficit slim three time fast right Wrong severe calorie deficit lead superior fat loss actually hurt progress four reason slows metabolism mean you’ll burn fewer calorie day set regaining lost pound go diet Severe dieting cause excessive muscle loss hamper metabolism craving go haywire make likely cheat diet plan even toss window wreaks havoc hormonal health example spike “stress hormone” cortisol stimulates muscle wasting reduces fat burning That’s lowcalorie diet doomed fail may lose weight first day you’ll regain lost pound willpower run Plus you’ll likely gain weight top Mistake 3 Thinking calorie created equal mentioned calorie deficit key losing weight doesn’t mean calorie created equal see u strive improve appearance it’s weight loss instead fat loss lose fat it’s essential consider energy source use calorie example don’t consume enough protein much weight you’ll lose muscle tissue hand make sure consume enough protein you’ll maintain muscle mass significant share weight loss come actual body fat Besides consuming right food also essential diet adherence Simply put certain food satiating others eat filling food it’s easier stay track diet That’s want diet optimized food selection — selection based personal situation goal Mistake 4 Following unrealistic overly restrictive diet Willpower like battery — much run that’s restrictive diet tend fail longrun Eventually deplete willpower result binging make lose progress I’ve seen countless time before… guy gal dedicated losing weight getting healthy start diet allows food like tilapia asparagus chicken result good beginning dieter loyally brings Tupperware box “healthy” meal wherever go last short time willpower — therefore diet — go gutter solution I’ve created custom meal plan service common fat loss blunder like four outlined I’ve brought certified nutritionist personal trainer chef together create perfect keto meal plan — one effective convenient costeffective enjoyable tailored custom meal plan developed based latest scientific research behind nutrition enhance health figure fastest doable manner say “custom” meal plan mean meal plan completely designed answer gave eightstep questionnaire website ready support figure health wellbeing tailoredtoyou keto diet plan custom meal plan right still sure custom meal plan service understand Honestly it’s everyone It’s people happy current situation don’t feel need enhance health figure energy level It’s people looking unhealthy quickfix crash diet depletes willpower cause weight come back immediately upon stopping It’s even people “unmotivated” know changing diet requires commitment consistency Instead custom meal plan service people want control health wellbeing It’s people want finally achieve figure make feel proud look mirror It’s people driven fix what’s unhealthy heal what’s broken improve what’s lacking believe matter circumstance something always done it’s people want best body life driven eat healthier feel energetic fulfill true potential INFO VISIT OFFICIAL WEBSITE CLICK HERETags Lose Weight Naturally Weight Loss Kito Diet Keto Lose Weight
|
187,951 |
Keto diet for women: How to Start a Keto Diet Plan
|
The keto diet plan is not designed for long-term weight control, as it puts a lot of emphasis on fats. The ketogenic diet pyramid is based around eating a wide variety of different carbohydrates and proteins. A lot of people don’t like the idea of eliminating carbohydrates from their diet and would rather focus on proteins, so the use of the MOST PROBABLY IMPORTANT carbohydrates are typically ignored in the process. By eliminating certain carbohydrates you can achieve ketosis easily, however this can be quite hard at first as your body gets accustomed to the absence of the carbohydrates you were once consuming.
Many experts agree that the best way to get started with the keto diet plan is to eat vegetables and lean meats. Eating more protein than vegetables (such as lean meats and chicken) helps boost your metabolism to burn fat faster after you stop consuming carbohydrates, which also helps you stick to your diet. Nuts and avocados are good veggies to eat as well because they are rich in mono unsaturated fats that are essential to maintain good health and are not burned off by the liver.
The benefits of eating more protein include muscle building, better digestion, and increased stamina. Nuts and avocados also provide protein, which provides many essential amino acids for the body, and contain medium chain triglycerides (MCT), which are easily metabolized by the liver, allowing them to enter the bloodstream immediately. The benefits of eating more carbs are the ability to control blood sugar, which can also help people lose weight. However, these carbohydrates should only be eaten in small amounts and should only be a supplement to your diet. Eating too many carbs can cause constipation, bloating, diarrhea, and even insomnia. If you have had problems with these symptoms before starting the keto diet plan, then you may want to limit your intake of carbs.
As you learn more about how to start a keto diet plan, you will find the best sources of protein are cheese, eggs, and chicken. Eggs are the most popular source of protein and can be found almost anywhere. Chicken is another highly favored food and can also be found almost anywhere. Both of these meats are lean cuts of meat, which makes them great sources of protein. The most important thing is to make sure that you get enough protein from your diet, as this will help your muscles to grow and create new tissue.
Now that you know how to start a keto diet plan, the next step is to get your food list together. You will need a detailed list of what you will be eating for each day. Include any vitamins and supplements that you may need to take, as well as any other special medications or instructions that your doctor has given you. It is a good idea to keep a food diary so that you can keep track of what you are eating each day. This way you can make sure that you are not getting any unwanted snacks and that you are eating real food.
CKICK HERE FOR MORE DETAILS
|
https://medium.com/@ashwinp77/keto-diet-for-women-how-to-start-a-keto-diet-plan-916b3eef99ca
|
['Health And Wealth']
|
2021-12-21 06:33:01.097000+00:00
|
['Weight Loss', 'Lose Weight Fast', 'Keto', 'Keto Diet For Women', 'Keto For Weight Loss']
|
Title Keto diet woman Start Keto Diet PlanContent keto diet plan designed longterm weight control put lot emphasis fat ketogenic diet pyramid based around eating wide variety different carbohydrate protein lot people don’t like idea eliminating carbohydrate diet would rather focus protein use PROBABLY IMPORTANT carbohydrate typically ignored process eliminating certain carbohydrate achieve ketosis easily however quite hard first body get accustomed absence carbohydrate consuming Many expert agree best way get started keto diet plan eat vegetable lean meat Eating protein vegetable lean meat chicken help boost metabolism burn fat faster stop consuming carbohydrate also help stick diet Nuts avocado good veggie eat well rich mono unsaturated fat essential maintain good health burned liver benefit eating protein include muscle building better digestion increased stamen Nuts avocado also provide protein provides many essential amino acid body contain medium chain triglyceride MCT easily metabolized liver allowing enter bloodstream immediately benefit eating carbs ability control blood sugar also help people lose weight However carbohydrate eaten small amount supplement diet Eating many carbs cause constipation bloating diarrhea even insomnia problem symptom starting keto diet plan may want limit intake carbs learn start keto diet plan find best source protein cheese egg chicken Eggs popular source protein found almost anywhere Chicken another highly favored food also found almost anywhere meat lean cut meat make great source protein important thing make sure get enough protein diet help muscle grow create new tissue know start keto diet plan next step get food list together need detailed list eating day Include vitamin supplement may need take well special medication instruction doctor given good idea keep food diary keep track eating day way make sure getting unwanted snack eating real food CKICK DETAILSTags Weight Loss Lose Weight Fast Keto Keto Diet Women Keto Weight Loss
|
187,952 |
Tracking Blood Ketones: Behind the Scenes Data on the Ketogenic Diet
|
My first round of measurements was in September. As you can below, the data was all over the place.
I quickly realized I needed to test more frequently and control more of the variables for this data to be useful.
Instead of testing sporadically and once a day, I started testing consistently every few hours so I could see changes throughout the day.
Here are 4 consecutive days. Immediately you can see a pattern.
Ketones were low when waking up, dropped after working out, rose after drinking Bulletproof Coffee, were highest before breaking my intermittent fast, and dropped after eating an afternoon snack and dinner.
Doing some research, I learned that these are all fairly common.
Blood ketones drop after high intensity and strength workouts. The exact reason for this isn’t fully understood, but it seems to be due to the body breaking down glycogen.
They rise after consuming MCTs, which the body can quickly convert into ketones.
And they drop after eating a meal, even a high fat meal. I’m guessing it’s because every meal has a little carb and protein.
To see if this pattern was regular, I graphed my average ketone reading at each hour of the day.
Sure enough, the same pattern was there. Drop after working out. Rise after Bulletproof coffee. Peak in afternoon. Drop after dinner.
My goal, though, was to see how these readings correlated with how I felt, so I also recorded a subjective “energy” score from 1–5 at the time of many of these readings.
Looking at them here, by hour of day, I can see I often felt best in the early afternoon. This is also when my ketones were highest.
Was my energy highest at that time because my ketones were highest, or do I just naturally feel good in the early afternoon regardless of ketones?
I don’t know. I would need more testing to answer that.
To look at this a little differently, I then took each energy rating from 1 to 5 and found its average ketone reading.
There’s a clear trend here. When I felt like a low “1”, my average ketones were 0.5. When I was a 3, ketones were about 1.5. And when I was 5, ketones were closer to 3.5.
This is a small sample size but it shows a possible correlation between higher ketones and feeling better.
Given this correlation, I thought I should be able to predict my ketone level before measuring. I tried this for a few days.
This graph shows the difference between my guesses and actual readings. Red bars are when I guessed too low and blue bars are when I guessed too high.
This shows I’m not very good at guessing my ketone levels, often being off by 0.5 or more. I think I’m still getting used to the feelings of ketosis. I’m curious to see if I will get better at guessing this in the next few months, especially as I continue to become more keto-adapted.
Next, I wanted to see how my blood ketones compared with Todd. I’ve been Keto for 3 months; he’s been Keto for 3 years. So we did an experiment where we did the same things, ate the same foods, and measured at the same times.
We started the morning at the same level, but his ketones quickly escalated much faster than mine and his followed a different shape.
This hints at the idea that we all don’t work the same.
I’m curious to have him do more experiments to see if that shape is his norm or if his graph would average out to look more like mine.
Here’s another small example: Ramzy, another coworker, and I tested our blood at 8am on back-to-back days. We both were at 2.1 on day 1. We then spent the entire day together, doing the same things and eating the same foods. And yet, the next morning, I was at 0.6 and he was at 4.8.
I have no idea why.
It seems there’s still a lot we don’t understand about ketones. Fortunately, that means there’s a lot more to learn!
Here’s what I’ve learned so far.
What I’ve Learned
My ketones fluctuate throughout the day. They are influenced by many different variables, including exercise, Bulletproof Coffee and ketone supplements, food, sleep, and more. I still don’t know what’s optimal for me but higher seems better so far. Everyone’s ketone production is likely different. My readings were much different from Todd’s and Ramzy’s. Measuring keeps me accountable. In these three months, I’ve stuck with the diet even through a bachelor party (in Vegas!), a wedding, and plenty of travel. The act of measuring my ketones has kept me on course. Ketone strips are expen$$$ive! I’m doing intermittent fasting not because it helps with the diet, but because all my lunch money is going to ketone strips!
Me buying ketone strips…
What’s Next?
Ketone tracking while fasting. I want to see how ketone levels change throughout the day during a 3-day fast. Comparing my data to other people. I found the comparison between my data and Todd’s/Ramzy’s to be fascinating. I’m curious to explore that more. Who else has taken blood ketone readings multiple times throughout the day? If you know anyone, I’d love to compare. Finding cheaper blood testing strips. Currently working on this. I’ll let you know when I find a solution.
Video
Here’s my full talk about this experiment:
If you found this interesting, here are two places to go next:
|
https://medium.com/the-mission/tracking-blood-ketones-behind-the-scenes-data-on-the-ketogenic-diet-7d35fcab0baa
|
['Mark Moschel']
|
2017-01-04 13:31:39.049000+00:00
|
['Ketogenic Diet', 'Health', 'Biohacking', 'Keto', 'Quantified Self']
|
Title Tracking Blood Ketones Behind Scenes Data Ketogenic DietContent first round measurement September data place quickly realized needed test frequently control variable data useful Instead testing sporadically day started testing consistently every hour could see change throughout day 4 consecutive day Immediately see pattern Ketones low waking dropped working rose drinking Bulletproof Coffee highest breaking intermittent fast dropped eating afternoon snack dinner research learned fairly common Blood ketone drop high intensity strength workout exact reason isn’t fully understood seems due body breaking glycogen rise consuming MCTs body quickly convert ketone drop eating meal even high fat meal I’m guessing it’s every meal little carb protein see pattern regular graphed average ketone reading hour day Sure enough pattern Drop working Rise Bulletproof coffee Peak afternoon Drop dinner goal though see reading correlated felt also recorded subjective “energy” score 1–5 time many reading Looking hour day see often felt best early afternoon also ketone highest energy highest time ketone highest naturally feel good early afternoon regardless ketone don’t know would need testing answer look little differently took energy rating 1 5 found average ketone reading There’s clear trend felt like low “1” average ketone 05 3 ketone 15 5 ketone closer 35 small sample size show possible correlation higher ketone feeling better Given correlation thought able predict ketone level measuring tried day graph show difference guess actual reading Red bar guessed low blue bar guessed high show I’m good guessing ketone level often 05 think I’m still getting used feeling ketosis I’m curious see get better guessing next month especially continue become ketoadapted Next wanted see blood ketone compared Todd I’ve Keto 3 month he’s Keto 3 year experiment thing ate food measured time started morning level ketone quickly escalated much faster mine followed different shape hint idea don’t work I’m curious experiment see shape norm graph would average look like mine Here’s another small example Ramzy another coworker tested blood 8am backtoback day 21 day 1 spent entire day together thing eating food yet next morning 06 48 idea seems there’s still lot don’t understand ketone Fortunately mean there’s lot learn Here’s I’ve learned far I’ve Learned ketone fluctuate throughout day influenced many different variable including exercise Bulletproof Coffee ketone supplement food sleep still don’t know what’s optimal higher seems better far Everyone’s ketone production likely different reading much different Todd’s Ramzy’s Measuring keep accountable three month I’ve stuck diet even bachelor party Vegas wedding plenty travel act measuring ketone kept course Ketone strip expenive I’m intermittent fasting help diet lunch money going ketone strip buying ketone strips… What’s Next Ketone tracking fasting want see ketone level change throughout day 3day fast Comparing data people found comparison data Todd’sRamzy’s fascinating I’m curious explore else taken blood ketone reading multiple time throughout day know anyone I’d love compare Finding cheaper blood testing strip Currently working I’ll let know find solution Video Here’s full talk experiment found interesting two place go nextTags Ketogenic Diet Health Biohacking Keto Quantified Self
|
187,953 |
How to Start a Keto Diet: A Comprehensive Guide To Begin Your Journey.
|
If you’ve been hearing about the ketogenic diet, but aren’t sure how to get started, this guide will help. The keto diet has become increasingly popular in recent years. Whether you want to lose weight, feel better, or just take care of your body, the keto diet is an excellent option. It may seem confusing at first glance- there are many different factors that come into play when starting a keto plan. But it doesn’t have to be difficult! Here are some tips on how to get started with a keto diet and what you can expect along the way.
What is the Keto Diet?
The ketogenic diet is a relatively new and highly effective way to help people lose weight. It combines a high fat and low carbohydrate intake with an adequate intake of protein to put the body into a state of ketosis. In this state, the body can burn fat for energy instead of carbohydrates. This eliminates the need to crash by eating a lot of carbohydrates and can allow you to eat much more healthfully. You’ll also be able to get better control of blood glucose levels.
Why Is the Keto Diet Such an Effective Diet?
One of the biggest reasons for the rise in popularity of the keto diet is that it can help to put the body into an “unreactive” state. The keto diet can give a person control over how much carbohydrate their body absorbs.
How to start a keto diet
1. First, you need to decide whether you are going to follow a standard ketogenic diet or a high fat keto diet.
The ketogenic diet is low carb and high fat. This means that you should eat 50–70% of your calories from fats, and consume minimal amounts of carbohydrates. The idea behind the ketogenic diet is to be in an insulin and blood sugar shock. The ketogenic diet is used to treat patients with severe forms of epilepsy or cancer.
The ketogenic diet has two different variations- a very low-carb diet and a high-fat diet. When you’re on a keto diet, you will want to stick with the more traditional version.
The high-fat keto diet requires you to consume 90% of your calories from fats.
Get My free Keto Diet Cook Book Full Of Essential Recipes for Free
The Benefits of the Ketogenic Diet
1. The Ketogenic Diet Has Suppressed Appetite.
The first thing that the keto diet advocates mention is how the diet can suppress appetite. Without carbohydrates, you will be forced to eat healthy fats, protein, and good quality carbs that are low in glycemic index. Foods like avocados, onions, eggplants, apples, butter, nuts, nut butters, coconut oil, and most other foods you’d eat on a regular basis. A keto diet will lead you to eat quality food that’s low in fats. It can significantly suppress your appetite so you don’t need to constantly eat. This can have huge benefits in terms of preventing overeating and weight gain.
2. The Ketogenic Diet Is Great For Optimal Weight Loss.
Many studies have proven that the keto diet leads to a loss of body fat.
The keto diet and exercise
It’s a common misconception that you need to eat a bunch of fat before exercising to get a great workout. However, in reality, the ketogenic diet- a very low carb diet- plays a major role in your daily exercise routine. The goal of the keto diet is to make sure you’re consuming enough fat to get the type of energy you need to work out.
Exercising on a keto diet is easy. There are countless apps and websites that will guide you through your exercise routine. It’s also worth noting that the keto diet is good for your joints and your heart. It doesn’t require a lot of cardio to feel great, but it is extremely important to get enough quality rest each night. If you are a beginner, just don’t be afraid to take your time and be consistent. Don’t rush.
Get My free Keto Diet Cook Book Full Of Essential Recipes for Free
Making use of the keto diet with food
The keto diet is best used as a supplement to a healthy lifestyle. It’s a strict, low-carb, high-fat diet. Achieving a keto diet requires discipline and a mindset that will lead to success. You’ll want to take into account every variable to make sure you can achieve the most benefit.
Consider how much you exercise. If you exercise, the keto diet is a good option. It will help you to feel fuller for longer, which means you’ll be able to eat less and feel great doing it.
If you exercise, the keto diet is a good option. It will help you to feel fuller for longer, which means you’ll be able to eat less and feel great doing it. Consider your typical food habits. If you aren’t a meat eater, you may not be able to eat enough of them on the keto diet.
Making use of the keto diet with exercise
The ketogenic diet focuses on bringing the body into ketosis. That is, the body uses fat as its primary fuel. This means that the body must break down the stored fat into usable energy. It’s during this process that the body turns the glycogen, or stored carbohydrates, into ketone bodies. Ketone bodies are the byproduct of ketosis.
This process helps boost muscle production and heal damaged tissue. For example, after a workout, many athletes will typically urinate ketone bodies. This helps to replenish lost blood and promote recovery.
In the case of the keto diet, the idea is that muscle tissue turns glycogen into ketone bodies during exercise. The keto dieters want their body to adapt to this new cycle. For this to happen, they must restrict the calories they eat.
Get My free Keto Diet Cook Book Full Of Essential Recipes for Free
Conclusion.
The ketogenic diet is a fantastic diet, but it takes a lot of dedication and discipline to follow it. I can’t stress this enough. There’s a lot to consider- like your nutritional needs, sleep, and activity levels. But it’s worth it! There are so many benefits to the keto diet, and I hope that these tips have helped to clear up some of the mystery behind it. And I hope that you feel just as energized after taking a few weeks of the keto diet as I do.
|
https://medium.com/@mouradlonqa/how-to-start-a-keto-diet-a-comprehensive-guide-to-begin-your-journey-9c9e1ebe309b
|
['Elkh Lonqa']
|
2021-12-25 12:36:32.973000+00:00
|
['Ketogenic Diet', 'Diet', 'How To', 'Startup', 'Keto']
|
Title Start Keto Diet Comprehensive Guide Begin JourneyContent you’ve hearing ketogenic diet aren’t sure get started guide help keto diet become increasingly popular recent year Whether want lose weight feel better take care body keto diet excellent option may seem confusing first glance many different factor come play starting keto plan doesn’t difficult tip get started keto diet expect along way Keto Diet ketogenic diet relatively new highly effective way help people lose weight combine high fat low carbohydrate intake adequate intake protein put body state ketosis state body burn fat energy instead carbohydrate eliminates need crash eating lot carbohydrate allow eat much healthfully You’ll also able get better control blood glucose level Keto Diet Effective Diet One biggest reason rise popularity keto diet help put body “unreactive” state keto diet give person control much carbohydrate body absorbs start keto diet 1 First need decide whether going follow standard ketogenic diet high fat keto diet ketogenic diet low carb high fat mean eat 50–70 calorie fat consume minimal amount carbohydrate idea behind ketogenic diet insulin blood sugar shock ketogenic diet used treat patient severe form epilepsy cancer ketogenic diet two different variation lowcarb diet highfat diet you’re keto diet want stick traditional version highfat keto diet requires consume 90 calorie fat Get free Keto Diet Cook Book Full Essential Recipes Free Benefits Ketogenic Diet 1 Ketogenic Diet Suppressed Appetite first thing keto diet advocate mention diet suppress appetite Without carbohydrate forced eat healthy fat protein good quality carbs low glycemic index Foods like avocado onion eggplant apple butter nut nut butter coconut oil food you’d eat regular basis keto diet lead eat quality food that’s low fat significantly suppress appetite don’t need constantly eat huge benefit term preventing overeating weight gain 2 Ketogenic Diet Great Optimal Weight Loss Many study proven keto diet lead loss body fat keto diet exercise It’s common misconception need eat bunch fat exercising get great workout However reality ketogenic diet low carb diet play major role daily exercise routine goal keto diet make sure you’re consuming enough fat get type energy need work Exercising keto diet easy countless apps website guide exercise routine It’s also worth noting keto diet good joint heart doesn’t require lot cardio feel great extremely important get enough quality rest night beginner don’t afraid take time consistent Don’t rush Get free Keto Diet Cook Book Full Essential Recipes Free Making use keto diet food keto diet best used supplement healthy lifestyle It’s strict lowcarb highfat diet Achieving keto diet requires discipline mindset lead success You’ll want take account every variable make sure achieve benefit Consider much exercise exercise keto diet good option help feel fuller longer mean you’ll able eat le feel great exercise keto diet good option help feel fuller longer mean you’ll able eat le feel great Consider typical food habit aren’t meat eater may able eat enough keto diet Making use keto diet exercise ketogenic diet focus bringing body ketosis body us fat primary fuel mean body must break stored fat usable energy It’s process body turn glycogen stored carbohydrate ketone body Ketone body byproduct ketosis process help boost muscle production heal damaged tissue example workout many athlete typically urinate ketone body help replenish lost blood promote recovery case keto diet idea muscle tissue turn glycogen ketone body exercise keto dieter want body adapt new cycle happen must restrict calorie eat Get free Keto Diet Cook Book Full Essential Recipes Free Conclusion ketogenic diet fantastic diet take lot dedication discipline follow can’t stress enough There’s lot consider like nutritional need sleep activity level it’s worth many benefit keto diet hope tip helped clear mystery behind hope feel energized taking week keto diet doTags Ketogenic Diet Diet Startup Keto
|
187,954 |
[R.E.A.D] The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Full
|
[R.E.A.D] The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Full Earnestine Casper Dec 18, 2021·3 min read
The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Read Online
Download Link => The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
Deskripsi Book
PDF Download The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Free Collection
PDF Download The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Full Online
epub free The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
ebook free The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
free ebook The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
free epub The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
full book The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less, free online The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
online free The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
online pdf The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
pdf download The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
Download Free The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Book
Download Online The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Book
Download PDF The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
Download PDF The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Free Online
Download Online The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Book
Download pdf The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
Download The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less E-Books
Download The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Online Free
Read Best Book Online The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less
Read Online The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Book
Read Online The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less E-Books
Read The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Online Free, Read Best Book The Wholesome Yum Easy Keto Cookbook: 100 Simple Low Carb Recipes. 10 Ingredients or Less Online
Language : English
Grade Level : 1–3
Product Dimensions : 9.5 x 0.5 x 9.4 inches
Shipping Weight : 11.6 ounces
Format : BOOKS
Seller information : ( 1? )
|
https://medium.com/@sakonakoko2_78709/r-e-a-d-the-wholesome-yum-easy-keto-cookbook-100-simple-low-carb-recipes-f27eebf610ce
|
['Earnestine Casper']
|
2021-12-18 06:31:24.908000+00:00
|
['Recipe', 'Wholesome', 'Keto']
|
Title READ Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less FullContent READ Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Full Earnestine Casper Dec 18 2021·3 min read Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Read Online Download Link Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Deskripsi Book PDF Download Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Free Collection PDF Download Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Full Online epub free Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less ebook free Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less free ebook Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less free epub Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less full book Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less free online Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less online free Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less online pdf Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less pdf download Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Download Free Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Book Download Online Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Book Download PDF Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Download PDF Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Free Online Download Online Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Book Download pdf Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Download Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less EBooks Download Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Online Free Read Best Book Online Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Read Online Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Book Read Online Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less EBooks Read Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Online Free Read Best Book Wholesome Yum Easy Keto Cookbook 100 Simple Low Carb Recipes 10 Ingredients Less Online Language English Grade Level 1–3 Product Dimensions 95 x 05 x 94 inch Shipping Weight 116 ounce Format BOOKS Seller information 1 Tags Recipe Wholesome Keto
|
187,955 |
THE BEST KETO MEAL PLAN IN 2022
|
If you find yourself in a conversation about dieting or weight loss, chances are you’ll hear of the ketogenic, or keto, diet.
That’s because the keto diet has become one of the most popular methods worldwide to shed excess weight and improve health.
The Ultimate Keto Meal Plan: https://www.digistore24.com/redir/283755/Ian444/
Research has demonstrated that adopting this low-carb, high-fat diet can promote fat loss and even improve certain conditions such as type 2 diabetes and cognitive decline (1Trusted Source, 2Trusted Source).
This article explains what to eat and avoid while following a keto diet and provides a one-week keto meal plan to get you started.
Ketogenic Diet Basics
The keto diet, as a rule, is very low in carbs, high in fat and moderate in protein.
When following a ketogenic diet, carbs are typically reduced to 20 to 50 grams per day, though looser versions of the diet exist (3Trusted Source).
Fats should replace the majority of cut carbs and deliver approximately 75% of your total calorie intake.
Proteins should account for around 10–30% of energy needs, while carbs are usually restricted to 5%.
This carb reduction forces your body to rely on fats for its main energy source instead of glucose — a process known as ketosis.
While in ketosis, your body uses ketones — molecules produced in the liver from fats when glucose is limited — as an alternate fuel source.
Though fat is often avoided for its high calorie content, research shows that ketogenic diets are significantly more effective at promoting weight loss than low-fat diets (4Trusted Source).
Plus, keto diets reduce hunger and increase satiety, which can be particularly helpful when trying to lose weight (5Trusted Source).
SUMMARY
The ketogenic diet relies on a very low-carb routine. Carbs are typically restricted to 20–50 grams per day, replaced mostly with fat and moderate amounts of protein.
Ketogenic Diet Meal Plan
Switching over to a ketogenic diet can seem overwhelming, but it doesn’t have to be difficult.
The Ultimate Keto Meal Plan: https://www.digistore24.com/redir/283755/Ian444/
Your focus should be on reducing carbs while increasing the fat and protein content of meals and snacks.
In order to reach and remain in a state of ketosis, carbs must be restricted.
While certain people might only achieve ketosis by eating 20 grams of carbs per day, others may be successful with a much higher carb intake.
Generally, the lower your carbohydrate intake, the easier it is to reach and stay in ketosis.
This is why sticking to keto-friendly foods and avoiding items rich in carbs is the best way to successfully lose weight on a ketogenic diet.
Keto-Friendly Foods to Eat
When following a ketogenic diet, meals and snacks should center around the following foods:
Eggs: Pastured, organic whole eggs make the best choice.
Poultry: Chicken and turkey.
Fatty fish: Wild-caught salmon, herring and mackerel.
Meat: Grass-fed beef, venison, pork, organ meats and bison.
Full-fat dairy: Yogurt, butter and cream.
Full- fat cheese: Cheddar, mozzarella, brie, goat cheese and cream cheese.
Nuts and seeds: Macadamia nuts, almonds, walnuts, pumpkin seeds, peanuts and flaxseeds.
Nut butter: Natural peanut, almond and cashew butters.
Healthy fats: Coconut oil, olive oil, avocado oil, coconut butter and sesame oil.
Avocados: Whole avocados can be added to almost any meal or snack.
Non-starchy vegetables: Greens, broccoli, tomatoes, mushrooms and peppers.
Condiments: Salt, pepper, vinegar, lemon juice, fresh herbs and spices.
Foods to Avoid
Avoid foods rich in carbs while following a keto diet.
The following foods should be restricted:
Bread and baked goods: White bread, whole-wheat bread, crackers, cookies, doughnuts and rolls.
Sweets and sugary foods: Sugar, ice cream, candy, maple syrup, agave syrup and coconut sugar.
Sweetened beverages: Soda, juice, sweetened teas and sports drinks.
Pasta: Spaghetti and noodles.
Grains and grain products: Wheat, rice, oats, breakfast cereals and tortillas.
Starchy vegetables: Potatoes, sweet potatoes, butternut squash, corn, peas and pumpkin.
Beans and legumes: Black beans, chickpeas, lentils and kidney beans.
Fruit: Citrus, grapes, bananas and pineapple.
High-carb sauces: Barbecue sauce, sugary salad dressings and dipping sauces.
Certain alcoholic beverages: Beer and sugary mixed drinks.
Though carbs should be restricted, low-glycemic fruits such as berries can be enjoyed in limited amounts as long as you’re maintaining a keto-friendly macronutrient range.
Be sure to choose healthy food sources and steer clear of processed foods and unhealthy fats.
The following items should be avoided:
Unhealthy fats: Margarine, shortening and vegetable oils such as canola and corn oil.
Processed foods: Fast food, packaged foods and processed meats such as hot dogs and lunch meats.
Diet foods: Foods that contain artificial colors, preservatives and sweeteners such as sugar alcohols and aspartame.
Keto-Friendly Beverages
Sugar can be found in a wide variety of beverages including juice, soda, iced tea and coffee drinks.
While on a ketogenic diet, high-carb drinks must be avoided just like high-carb foods.
It’s no small matter that sugary beverages have also been linked to various health issues — from obesity to an increased risk of diabetes (6Trusted Source, 7Trusted Source, 8Trusted Source).
Thankfully, there are many tasty, sugar-free options for those on the keto diet.
Keto-friendly beverage choices include:
Water: Water is the best choice for hydration and should be consumed throughout the day.
Sparkling water: Sparkling water can make an excellent soda replacement.
Unsweetened coffee: Try heavy cream to add flavor to your cup of joe.
Unsweetened green tea: Green tea is delicious and provides many health benefits.
If you want to add some extra flavor to your water, try experimenting with different keto-friendly flavor combinations.
The Ultimate Keto Meal Plan: https://www.digistore24.com/redir/283755/Ian444/
For example, tossing some fresh mint and lemon peel into your water bottle can make hydration a breeze.
Though alcohol should be restricted, enjoying a low-carb drink like vodka or tequila mixed with soda water is perfectly fine on occasion.
SUMMARY
A healthy ketogenic diet should revolve around high-fat, low-carb food choices and restrict highly processed items and unhealthy fats. Keto-friendly beverage options must be sugar-free. Consider water, sparkling water or unsweetened green tea and coffee.
READER SURVEY
Please take a quick 1-minute survey
Your answers will help us improve our experience. You’re the best!
A Sample Keto Menu for One Week
The following menu provides less than 50 grams of total carbs per day.
As mentioned above, some people may have to reduce carbohydrates even further in order to reach ketosis.
This is a general one-week ketogenic menu that can be altered depending on individual dietary needs.
Monday
Breakfast: Two eggs fried in pastured butter served with sauteed greens.
Lunch: A bunless grass-fed burger topped with cheese, mushrooms and avocado atop a bed of greens.
Dinner: Pork chops with green beans sauteed in coconut oil.
Tuesday
Breakfast: Mushroom omelet.
Lunch: Tuna salad with celery and tomato atop a bed of greens.
Dinner: Roast chicken with cream sauce and sauteed broccoli.
Wednesday
Breakfast: Bell pepper stuffed with cheese and eggs.
Lunch: Arugula salad with hard-boiled eggs, turkey, avocado and blue cheese.
Dinner: Grilled salmon with spinach sauteed in coconut oil.
Thursday
Breakfast: Full-fat yogurt topped with Keto granola.
Lunch: Steak bowl with cauliflower rice, cheese, herbs, avocado and salsa.
Dinner: Bison steak with cheesy broccoli.
Friday
Breakfast: Baked avocado egg boats.
Lunch: Caesar salad with chicken.
Dinner: Pork chops with vegetables.
Saturday
Breakfast: Cauliflower toast topped with cheese and avocado.
Lunch: Bunless salmon burgers topped with pesto.
Dinner: Meatballs served with zucchini noodles and parmesan cheese.
Sunday
Breakfast: Coconut milk chia pudding topped with coconut and walnuts.
Lunch: Cobb salad made with greens, hard-boiled eggs, avocado, cheese and turkey.
Dinner: Coconut chicken curry.
As you can see, ketogenic meals can be diverse and flavorful.
Although many ketogenic meals are based around animal products, there is a wide variety of vegetarian options to choose from as well.
If you’re following a more liberal ketogenic diet, adding a cup of berries to your breakfast or a small serving of a starchy vegetable to your dinner will increase the number of carbs in this meal plan.
SUMMARY
A ketogenic meal plan, like any healthy diet, should include whole foods and many fiber-rich, low-carb vegetables. Choose healthy fats like coconut oil, avocado, olive oil and pastured butter to increase the fat content of dishes.
Healthy Ketogenic Snack Options
Snacking between meals can help moderate hunger and keep you on track while following a ketogenic diet.
Because the ketogenic diet is so filling, you may only need one or two snacks per day, depending on your activity level.
Here are some excellent, keto-friendly snack options:
Almonds and cheddar cheese
Half an avocado stuffed with chicken salad
Guacamole with low-carb veggies
Trail mix made with unsweetened coconut, nuts and seeds
Hard-boiled eggs
Coconut chips
Kale chips
Olives and sliced salami
Celery and peppers with herbed cream cheese dip
Berries with heavy whipping cream
Jerky
Cheese roll-ups
Parmesan crisps
Macadamia nuts
Greens with high-fat dressing and avocado
Keto smoothie made with coconut milk, cocoa and avocado
Avocado cocoa mousse
Though these keto snacks can maintain fullness between meals, they can also contribute to weight gain if you’re snacking too much throughout the day.
The Ultimate Keto Meal Plan: https://www.digistore24.com/redir/283755/Ian444/
It’s important to eat the appropriate number of calories based on your activity level, weight loss goal, age and gender.
If you’re unsure how many calories you should be eating, check out this article to learn how to calculate energy needs.
|
https://medium.com/@igamix.09/the-best-keto-meal-plan-in-2022-8bbd45b312ac
|
['Fitness Stars']
|
2021-12-21 15:52:17.169000+00:00
|
['Ketogenic Diet', 'Ketogenic', 'Health', 'Fitness', 'Keto']
|
Title BEST KETO MEAL PLAN 2022Content find conversation dieting weight loss chance you’ll hear ketogenic keto diet That’s keto diet become one popular method worldwide shed excess weight improve health Ultimate Keto Meal Plan httpswwwdigistore24comredir283755Ian444 Research demonstrated adopting lowcarb highfat diet promote fat loss even improve certain condition type 2 diabetes cognitive decline 1Trusted Source 2Trusted Source article explains eat avoid following keto diet provides oneweek keto meal plan get started Ketogenic Diet Basics keto diet rule low carbs high fat moderate protein following ketogenic diet carbs typically reduced 20 50 gram per day though looser version diet exist 3Trusted Source Fats replace majority cut carbs deliver approximately 75 total calorie intake Proteins account around 10–30 energy need carbs usually restricted 5 carb reduction force body rely fat main energy source instead glucose — process known ketosis ketosis body us ketone — molecule produced liver fat glucose limited — alternate fuel source Though fat often avoided high calorie content research show ketogenic diet significantly effective promoting weight loss lowfat diet 4Trusted Source Plus keto diet reduce hunger increase satiety particularly helpful trying lose weight 5Trusted Source SUMMARY ketogenic diet relies lowcarb routine Carbs typically restricted 20–50 gram per day replaced mostly fat moderate amount protein Ketogenic Diet Meal Plan Switching ketogenic diet seem overwhelming doesn’t difficult Ultimate Keto Meal Plan httpswwwdigistore24comredir283755Ian444 focus reducing carbs increasing fat protein content meal snack order reach remain state ketosis carbs must restricted certain people might achieve ketosis eating 20 gram carbs per day others may successful much higher carb intake Generally lower carbohydrate intake easier reach stay ketosis sticking ketofriendly food avoiding item rich carbs best way successfully lose weight ketogenic diet KetoFriendly Foods Eat following ketogenic diet meal snack center around following food Eggs Pastured organic whole egg make best choice Poultry Chicken turkey Fatty fish Wildcaught salmon herring mackerel Meat Grassfed beef venison pork organ meat bison Fullfat dairy Yogurt butter cream Full fat cheese Cheddar mozzarella brie goat cheese cream cheese Nuts seed Macadamia nut almond walnut pumpkin seed peanut flaxseed Nut butter Natural peanut almond cashew butter Healthy fat Coconut oil olive oil avocado oil coconut butter sesame oil Avocados Whole avocado added almost meal snack Nonstarchy vegetable Greens broccoli tomato mushroom pepper Condiments Salt pepper vinegar lemon juice fresh herb spice Foods Avoid Avoid food rich carbs following keto diet following food restricted Bread baked good White bread wholewheat bread cracker cooky doughnut roll Sweets sugary food Sugar ice cream candy maple syrup agave syrup coconut sugar Sweetened beverage Soda juice sweetened tea sport drink Pasta Spaghetti noodle Grains grain product Wheat rice oat breakfast cereal tortilla Starchy vegetable Potatoes sweet potato butternut squash corn pea pumpkin Beans legume Black bean chickpea lentil kidney bean Fruit Citrus grape banana pineapple Highcarb sauce Barbecue sauce sugary salad dressing dipping sauce Certain alcoholic beverage Beer sugary mixed drink Though carbs restricted lowglycemic fruit berry enjoyed limited amount long you’re maintaining ketofriendly macronutrient range sure choose healthy food source steer clear processed food unhealthy fat following item avoided Unhealthy fat Margarine shortening vegetable oil canola corn oil Processed food Fast food packaged food processed meat hot dog lunch meat Diet food Foods contain artificial color preservative sweetener sugar alcohol aspartame KetoFriendly Beverages Sugar found wide variety beverage including juice soda iced tea coffee drink ketogenic diet highcarb drink must avoided like highcarb food It’s small matter sugary beverage also linked various health issue — obesity increased risk diabetes 6Trusted Source 7Trusted Source 8Trusted Source Thankfully many tasty sugarfree option keto diet Ketofriendly beverage choice include Water Water best choice hydration consumed throughout day Sparkling water Sparkling water make excellent soda replacement Unsweetened coffee Try heavy cream add flavor cup joe Unsweetened green tea Green tea delicious provides many health benefit want add extra flavor water try experimenting different ketofriendly flavor combination Ultimate Keto Meal Plan httpswwwdigistore24comredir283755Ian444 example tossing fresh mint lemon peel water bottle make hydration breeze Though alcohol restricted enjoying lowcarb drink like vodka tequila mixed soda water perfectly fine occasion SUMMARY healthy ketogenic diet revolve around highfat lowcarb food choice restrict highly processed item unhealthy fat Ketofriendly beverage option must sugarfree Consider water sparkling water unsweetened green tea coffee READER SURVEY Please take quick 1minute survey answer help u improve experience You’re best Sample Keto Menu One Week following menu provides le 50 gram total carbs per day mentioned people may reduce carbohydrate even order reach ketosis general oneweek ketogenic menu altered depending individual dietary need Monday Breakfast Two egg fried pastured butter served sauteed green Lunch bunless grassfed burger topped cheese mushroom avocado atop bed green Dinner Pork chop green bean sauteed coconut oil Tuesday Breakfast Mushroom omelet Lunch Tuna salad celery tomato atop bed green Dinner Roast chicken cream sauce sauteed broccoli Wednesday Breakfast Bell pepper stuffed cheese egg Lunch Arugula salad hardboiled egg turkey avocado blue cheese Dinner Grilled salmon spinach sauteed coconut oil Thursday Breakfast Fullfat yogurt topped Keto granola Lunch Steak bowl cauliflower rice cheese herb avocado salsa Dinner Bison steak cheesy broccoli Friday Breakfast Baked avocado egg boat Lunch Caesar salad chicken Dinner Pork chop vegetable Saturday Breakfast Cauliflower toast topped cheese avocado Lunch Bunless salmon burger topped pesto Dinner Meatballs served zucchini noodle parmesan cheese Sunday Breakfast Coconut milk chia pudding topped coconut walnut Lunch Cobb salad made green hardboiled egg avocado cheese turkey Dinner Coconut chicken curry see ketogenic meal diverse flavorful Although many ketogenic meal based around animal product wide variety vegetarian option choose well you’re following liberal ketogenic diet adding cup berry breakfast small serving starchy vegetable dinner increase number carbs meal plan SUMMARY ketogenic meal plan like healthy diet include whole food many fiberrich lowcarb vegetable Choose healthy fat like coconut oil avocado olive oil pastured butter increase fat content dish Healthy Ketogenic Snack Options Snacking meal help moderate hunger keep track following ketogenic diet ketogenic diet filling may need one two snack per day depending activity level excellent ketofriendly snack option Almonds cheddar cheese Half avocado stuffed chicken salad Guacamole lowcarb veggie Trail mix made unsweetened coconut nut seed Hardboiled egg Coconut chip Kale chip Olives sliced salami Celery pepper herbed cream cheese dip Berries heavy whipping cream Jerky Cheese rollups Parmesan crisp Macadamia nut Greens highfat dressing avocado Keto smoothie made coconut milk cocoa avocado Avocado cocoa mousse Though keto snack maintain fullness meal also contribute weight gain you’re snacking much throughout day Ultimate Keto Meal Plan httpswwwdigistore24comredir283755Ian444 It’s important eat appropriate number calorie based activity level weight loss goal age gender you’re unsure many calorie eating check article learn calculate energy needsTags Ketogenic Diet Ketogenic Health Fitness Keto
|
187,956 |
Want to take a healthy side to Christmas lunch?
|
Try this, Roasted Garlic mashed potatoes, and cauliflower Recipe
Ingredients:
1 head garlic 1 tbsp. extra-virgin olive oil 2 lb. golden potatoes, peeled and cut into 1" chunks 1 medium head cauliflower (about 2 lbs.) cut into large florets 2/3 c. half-and-half 6 tbsp. butter Snipped chives, for garnish (optional)
Directions:
-Preheat oven to 375 degrees F. Cut off the top third of garlic head. Place garlic head and top in a sheet of foil; drizzle cut sides with oil. Reassemble head; wrap in foil, crimping and sealing tightly. Place on a small baking sheet. Bake 1 hour to 1 hour 10 minutes or until deep golden brown and very soft. Remove from oven; cool completely.
-While garlic cools, in a 7- to 8-quart saucepot, place potatoes with enough water to cover by 2" and 1 tablespoon salt. Partially cover and heat to boiling on high. Reduce heat; simmer for 10 minutes. Add cauliflower; heat to boiling again, then reduce heat. Simmer for 20 minutes or until cauliflower and potatoes are very tender. Drain well.
-Meanwhile, in a small microwave-safe bowl, microwave half-and-half and butter on High 30 seconds or until the butter has melted; squeeze roasted garlic cloves from skins into the mixture.
-Mash potatoes and cauliflower with the half-and-half mixture and 1/2 teaspoon salt until smooth. Garnish with chives. Serve immediately.
Let us know your thoughts.
Get Your FREE Physical Copy of The Essential Keto Cookbook Today!
|
https://medium.com/@tharakalakmal163/want-to-take-a-healthy-side-to-christmas-lunch-926da2f59e2d
|
['Tasty Recipes']
|
2021-12-15 06:55:39.685000+00:00
|
['Christmas', 'Health', 'Lunch', 'Keto', 'Recipe']
|
Title Want take healthy side Christmas lunchContent Try Roasted Garlic mashed potato cauliflower Recipe Ingredients 1 head garlic 1 tbsp extravirgin olive oil 2 lb golden potato peeled cut 1 chunk 1 medium head cauliflower 2 lb cut large floret 23 c halfandhalf 6 tbsp butter Snipped chive garnish optional Directions Preheat oven 375 degree F Cut top third garlic head Place garlic head top sheet foil drizzle cut side oil Reassemble head wrap foil crimping sealing tightly Place small baking sheet Bake 1 hour 1 hour 10 minute deep golden brown soft Remove oven cool completely garlic cool 7 8quart saucepot place potato enough water cover 2 1 tablespoon salt Partially cover heat boiling high Reduce heat simmer 10 minute Add cauliflower heat boiling reduce heat Simmer 20 minute cauliflower potato tender Drain well Meanwhile small microwavesafe bowl microwave halfandhalf butter High 30 second butter melted squeeze roasted garlic clove skin mixture Mash potato cauliflower halfandhalf mixture 12 teaspoon salt smooth Garnish chive Serve immediately Let u know thought Get FREE Physical Copy Essential Keto Cookbook TodayTags Christmas Health Lunch Keto Recipe
|
187,957 |
Why you shouldn’t try a keto diet.
|
Photo by Vitalii Pavlyshynets on Unsplash
Why you shouldn’t try a keto diet.
Firstly, let me explain what is a keto diet in short words. It’s a type of diet when you minimalize the number of carbs you eat to the absolute minimum. It simply means no bread, sugar, fruits, rice…
There’s a lot of quoting in this story as I don’t want to rephrase someone’s words so if you’re not interested in this and want to check all by yourself — there are references at the end of the story.
Now let’s get into the mentioned article and answer the question in the title.
Here’s the first point made by the author.
1. Weight Loss
ref. [1]
Author point:
(…) The keto diet is very effective for weight loss. When you’re in ketosis, your body burns stored fat for energy instead of carbs, so it rapidly sheds pounds. A ketogenic diet can also suppress appetite by making you feel less hungry. Weight loss is not the only benefit of keto, but it’s one of the main reasons people adopt this way of eating.
It is true but the author didn't mention an important part that wasn’t skipped by clinical nutritionists and medics.
Quoting Lisa Cimperman, R.D.N., a clinical dietitian at University Hospitals Case Medical Center in Cleveland, Ohio, and a spokesperson for the Academy of Nutrition and Dietetics.
For starters, most of the lost weight is water weight. “Once your body enters ketosis, you also begin to lose muscle, become extremely fatigued, and eventually enter starvation mode. Then it actually becomes even harder to lose weight.” Cimperman told Healthline.
Here are the words from Francine Blinten, R.D., a certified clinical nutritionist and public health consultant in Old Greenwich, Connecticut.
“Keto diets should only be used under clinical supervision and only for brief periods.” “They have worked successfully on some cancer patients in conjunction with chemotherapy to shrink tumors and to reduce seizures among people suffering from epilepsy.”
“It can do more harm than good. It can damage the heart, which is also a muscle.”
Here Lisa Cimperman explains why keto is used in diabetes treatment.
“Anyone with type 2 diabetes can benefit from weight loss and a reduced-carb diet because it will improve insulin sensitivity”
And some closing words from Francine Blinten about health and weight.
“People will do anything to get the weight off.” However, a keto diet will do more harm than good for the majority of patients, especially if they have any underlying kidney or liver issues. “People are using this for cosmetic reasons, but it’s so extreme that it’s dangerous.”
2. Mental Clarity & 3. Reduced Inflammations
ref. [3], [4]
Here’s the author point about mental clarity and reduced inflammations (first and second paragraph accordingly).
(…) Some people experience improved mental clarity on the keto diet. This may be due to the fact that ketosis causes an increase in BDNF, a brain-derived neurotrophic factor that promotes neuronal growth and protects against neurodegenerative diseases. (…) The keto diet is also anti-inflammatory, which can be beneficial for people with autoimmune diseases or other chronic inflammatory conditions.
And here’s the answer from John Limansky, Medical Doctor.
Mental clarity comes from the brain having a constant fuel source. Take a person with a typical western diet who has wide fluctuations in brain glucose from lows (causing brain fog, lightheadedness, etc) to highs (causing inflammation, etc). Once that person switches to a ketogenic lifestyle, there is a constant source of energy for the brain with the ketones not dependent on food consumption. Add in there the chronic inflammation from fluctuating and high levels of glucose is now gone with being in ketosis and the mental clarity is the result.
Simply said, the keto diet doesn’t get rid of Inflammations and doesn’t make your mind clearer. A balanced diet and lifestyle do. (But keto-specific, works only for a short period of time according to previously mentioned Lisa Cimperman).
If you’re not convinced yet, here you can find a few products which “boost” your mental clarity and what a coincidence, 7 of 11 products are often used in keto diets. Why? Because the amount of fat in them is high.
4. Increased Energy
ref. [1]
Author point:
(…) Many people find that they have more energy on the keto diet. This may be due to the fact that when you’re in ketosis, your body is using stored fat for energy, so you have more energy available.
And here’s a simple answer from Rudy Mawer, a sports nutritionist.
“The [keto] diet also makes people feel full despite having fewer calories and it gives them more energy. That’s because people are giving up their sluggish diet of processed foods. The keto diet keeps blood sugar levels stable, which produces a more stable flow of energy.”
Again. It’s not about the keto diet itself. It’s the characteristics of any meaningful diet type.
5. Better Digestion
ref. [2]
Author point:
The keto diet can also be beneficial for digestive health. Indigestible fiber from low-carb veggies is a key component of the keto diet, and studies have shown that it may help reduce constipation and diverticulitis.
Here’s what healthline.com thinks about it:
(check the whole article for more information)
Cons:
- May be lower in fibre
- May alter your gut microbiome
Pros:
- May reduce inflammation (I covered this already)
- May benefit some digestive disorders
Closing words
There are cases when keto-type diets are used with success (e.g. lowering the number of seizures for people with epilepsy or shrinking the size of the tumour) but as you can see (and I hope I convinced you), a keto-type diet is more dangerous than it’s worth.
Is a keto diet really worth it?
That’s the question you need to answer by yourself.
References:
[1] keto diet vs health
[2] keto and gut health
[3] mental clarity on a keto diet
[4] foods boosting your brain
|
https://medium.com/@knico/why-you-shouldnt-try-a-keto-diet-aa7faa9863ad
|
[]
|
2021-12-30 17:32:16.320000+00:00
|
['Diet', 'Health', 'Food', 'Keto', 'Lifestyle']
|
Title shouldn’t try keto dietContent Photo Vitalii Pavlyshynets Unsplash shouldn’t try keto diet Firstly let explain keto diet short word It’s type diet minimalize number carbs eat absolute minimum simply mean bread sugar fruit rice… There’s lot quoting story don’t want rephrase someone’s word you’re interested want check — reference end story let’s get mentioned article answer question title Here’s first point made author 1 Weight Loss ref 1 Author point … keto diet effective weight loss you’re ketosis body burn stored fat energy instead carbs rapidly shed pound ketogenic diet also suppress appetite making feel le hungry Weight loss benefit keto it’s one main reason people adopt way eating true author didnt mention important part wasn’t skipped clinical nutritionist medic Quoting Lisa Cimperman RDN clinical dietitian University Hospitals Case Medical Center Cleveland Ohio spokesperson Academy Nutrition Dietetics starter lost weight water weight “Once body enters ketosis also begin lose muscle become extremely fatigued eventually enter starvation mode actually becomes even harder lose weight” Cimperman told Healthline word Francine Blinten RD certified clinical nutritionist public health consultant Old Greenwich Connecticut “Keto diet used clinical supervision brief periods” “They worked successfully cancer patient conjunction chemotherapy shrink tumor reduce seizure among people suffering epilepsy” “It harm good damage heart also muscle” Lisa Cimperman explains keto used diabetes treatment “Anyone type 2 diabetes benefit weight loss reducedcarb diet improve insulin sensitivity” closing word Francine Blinten health weight “People anything get weight off” However keto diet harm good majority patient especially underlying kidney liver issue “People using cosmetic reason it’s extreme it’s dangerous” 2 Mental Clarity 3 Reduced Inflammations ref 3 4 Here’s author point mental clarity reduced inflammation first second paragraph accordingly … people experience improved mental clarity keto diet may due fact ketosis cause increase BDNF brainderived neurotrophic factor promotes neuronal growth protects neurodegenerative disease … keto diet also antiinflammatory beneficial people autoimmune disease chronic inflammatory condition here’s answer John Limansky Medical Doctor Mental clarity come brain constant fuel source Take person typical western diet wide fluctuation brain glucose low causing brain fog lightheadedness etc high causing inflammation etc person switch ketogenic lifestyle constant source energy brain ketone dependent food consumption Add chronic inflammation fluctuating high level glucose gone ketosis mental clarity result Simply said keto diet doesn’t get rid Inflammations doesn’t make mind clearer balanced diet lifestyle ketospecific work short period time according previously mentioned Lisa Cimperman you’re convinced yet find product “boost” mental clarity coincidence 7 11 product often used keto diet amount fat high 4 Increased Energy ref 1 Author point … Many people find energy keto diet may due fact you’re ketosis body using stored fat energy energy available here’s simple answer Rudy Mawer sport nutritionist “The keto diet also make people feel full despite fewer calorie give energy That’s people giving sluggish diet processed food keto diet keep blood sugar level stable produce stable flow energy” It’s keto diet It’s characteristic meaningful diet type 5 Better Digestion ref 2 Author point keto diet also beneficial digestive health Indigestible fiber lowcarb veggie key component keto diet study shown may help reduce constipation diverticulitis Here’s healthlinecom think check whole article information Cons May lower fibre May alter gut microbiome Pros May reduce inflammation covered already May benefit digestive disorder Closing word case ketotype diet used success eg lowering number seizure people epilepsy shrinking size tumour see hope convinced ketotype diet dangerous it’s worth keto diet really worth That’s question need answer References 1 keto diet v health 2 keto gut health 3 mental clarity keto diet 4 food boosting brainTags Diet Health Food Keto Lifestyle
|
187,958 |
what is the keto diet and how to start a keto diet
|
what is the keto diet and how to start a keto diet Hopegurru Dec 31, 2021·9 min read
www. hopegurru.com
1. What is the Keto Diet?
The keto diet is an all-or-nothing, high fat, low carb diet that is promoted by many celebrities.
The keto diet is claimed to help lose weight without having to exercise and without losing muscle mass. It can also be used as a means of weight loss and maintenance.
The low carbohydrate (ketogenic) diet involves limiting carbohydrates (sugars) to less than 50 grams per day. This is achieved by eating a very low-carbohydrate diet and typically consuming no more than 20 grams of net carbohydrates per meal, or in other words, zero net carbs from sugars, starches, or any other sources of carbohydrate.
Injecting large amounts of carbohydrates into the body can lead to the dumping of glucose into the bloodstream via glycogen storage and/or gluconeogenesis.
The mechanism behind this type of weight reduction is believed to be through the suppression of appetite via secretion of the gastric inhibitory polypeptide into the stomach, resulting in increased food intake and decreased food expenditure.
These results have been supported by research with both human volunteers as well as animal models. The “ketogenic” aspect comes from ketosis, which is the metabolic state when blood sugar levels are extremely low due to a lack of glucose intake, resulting in elevated levels of ketones.
2. What Foods are Allowed?
There are many diets for weight loss. You may be thinking: “A diet? It must be something short of the death sentence!” But the truth is, some diets simply don’t work to lose weight.
A keto diet has become a favorite of many celebrities, including Halle Berry and Kim Kardashian. They have found success in losing weight by following this diet, which is called Keto or the ketogenic diet.
The keto diet allows you to eat fat while minimizing carbohydrates. It may seem difficult at first. But if you stick with it and follow the rules, you will find that it works for you.
Click Here
3. The Benefits of the Keto Diet
The keto diet is a popular weight-loss plan that eliminates the need for carbohydrates. Its proponents claim that it helps overweight people lose weight by lowering their body’s insulin levels and providing a source of fat-burning protein.
In an article titled “The Ketogenic Diet: A Step-by-step Guide to Giving Up Sugar,” authors J. Kavoussi and Salahudeen explain how eliminating carbohydrates from our diets leads to an increase in the amount of free fatty acids generated by our bodies. These free fatty acids are then burned for energy in the presence of ketone bodies, which are present in very low concentrations in the bloodstream; this process is called ketosis. Ketones have also been shown to suppress hunger and induce feelings of fullness.
The only downside to going on a keto diet is that you have less control over portion sizes: If you’re not used to eating large meals, you may be tempted to eat more than you intended, especially if you are trying to lose weight fast.
4. Is the Ketogenic Diet Safe?
It is no secret that the ketogenic diet is a very popular diet among celebrities. Many have been successful in losing weight or, at the very least, maintaining their weight loss with this high-fat and low-carb diet. Although there are some health consequences associated with this diet, it is a safe and beneficial way to lose weight without all of the unhealthy side effects associated with other diets such as low-fat diets.
Ketogenic diets are high in fat and low in carbohydrates, so they are able to burn fat more effectively than other diets.
The keto diet is a very effective way to lose weight when you’re trying to achieve your ideal body composition.
Keto also helps you achieve your goal of feeling full sooner because it reduces your appetite.
The only downside to this diet is that it can cause minor side effects like constipation, nausea, and headaches. However, these side effects are completely manageable when you follow a few simple guidelines while following the keto diet.
Ketosis Diet: Which Is Better?
One thing many people tend to forget about is that every time you eat something containing carbs or sugar, you’re adding calories which will ultimately lead to weight gain because your body will keep those extra calories as fats.
The process of burning off those extra calories through exercise or through simply eating something healthy (like vegetables) will help keep your calorie intake within a certain range so that you don’t go over your daily calorie expenditure limit (which is usually around 1,500 calories per day).
You also need to consider how many carbohydrates are in each meal; typically five hours after eating carbs will cause blood sugar spikes which can lead to anxiety and generally lead to cravings for more carbs and sugar.
So if you’ve been on Atkins or some other type of low carb diet for a while now (or even just recently switched), chances are that the carb content of your food has steadily increased over time until it’s at about the same level as what’s typically found in a normal American family’s meal plan which can be described as three meals per day for one person plus snacks throughout the day (it could be seven days per week during the summer months). So if you started out eating just three meals per day then by the time Monday rolls around (which happens all too often), you’ll have already eaten all but two meals (and maybe three if they were restaurant meals). That’s not good! Since our bodies require
5. How to Start a Keto Diet Plan
The keto diet is a low-carb, high-fat diet based on the concept that we can use the fat stored in our bodies to help regulate blood sugar. The idea behind this is that when your body is running on ketones, it will burn fats for fuel instead of carbohydrates, so you feel less hungry and eat fewer calories.
While this sounds great in theory, there are some things you should know before you dive headfirst into the world of keto. Here are a few things to keep in mind before you start your journey on the road to weight loss:
You must be very careful with your carbohydrate intake during ketosis. You can’t eat any carbs at all while in this state, as they become stored fat. The good news here is that many of us have been able to maintain our weight even without eating massive amounts of carbs during this time. However, if you have been using sugar substitutes like Splenda or aspartame (aka “Nutrasweet”) then make sure you have removed any traces of these products from your diet before starting the keto diet! Even if you don’t plan to go back onto sugar or aspartame immediately after leaving ketosis, it is still best not to consume these products for a few days following leaving ketosis until your body has had enough time to break them down for energy.
Some people think the idea of going into ketosis via fasting is not much different than what many people do during an intensive weight loss program such as a low-carbohydrate diet or even a standard low-fat diet. In both cases, individuals are essentially fasting (or “ketogenic”) — albeit toward the end of their fasts they will usually eat a substantial amount of food (often including carbohydrates).
In my opinion, it’s not necessary to be too strict with restricting carb intake while fasting; so long as it doesn’t interfere with your sleep schedule and bodily functions (as well as avoiding alcohol consumption), I believe most people can survive without restricting carb intake while fasting for many days at least prior to beginning their “ketogenic” phase which will begin once they begin consuming carbs again after enduring their fast period which may last anywhere between 2–6 days depending on how hard they push themselves in preparation for starting their fast period again after having completed an intense workout and hopefully finished an intense workout within 24 hours prior to beginning their fast period again).
6. Precautions and Tips for a Healthy Keto Diet
Being on a keto diet can be very challenging. The keto diet is high in fat and low in carbohydrates, which means that it requires a higher caloric intake than usual. While the diet can be effective, there are some risks to take on a keto diet.
That may not sound like much of a problem, but there are some key precautions to keep in mind if you’re starting your own keto diet.
Overeating and weight gain
If you’re looking to drastically lower your weight, you may want to consider making gradual adjustments when going on the Keto Diet. As a general rule of thumb, if you have been on a low-carbohydrate diet for more than two weeks, it’s best to start off slowly by reducing the number of carbohydrates that you eat. It is also recommended not to go overboard and overdo it by eating too many carbohydrates at once when starting out on the keto diet.
While there is no exact science behind this advice, the general idea behind having fewer carbohydrates in your system at one time will give your body time to adjust itself before any negative effects are noticed. This will allow you to maintain a healthy weight long after going off the Keto Diet plan!
Staying Healthy while Going On A Keto Diet
If you’re new to the Keto Diet or if you don’t know how long it takes for your body to adjust itself when following this type of diet plan, then staying healthy and avoiding any potential complications maybe even more important than losing weight! It is essential that those who are going onto the Ketogenic Diet understand how long their bodies take to adapt themselves after going off of this type of dietary plan and how long it takes them before they reach their ideal weight set point! The more time that goes by without any fluctuations being made in your body weight number, then sooner or later (depending on how rapidly your metabolism responds), then food cravings will kick back into gear and you will begin craving foods again once again!
When it comes down to it though, everyone has different metabolisms so what works for one person may not work for another…the best way I can think of describing this phenomenon is that as far as how long my metabolism takes before adjusting itself back down from one day being way too high (usually after 2 days) vs another day being way too low (usually after 3 days). I have found that my typical day usually averages
7. Conclusion
This post is a brief summary of the keto diet and the benefits it can provide. The keto diet has already been around for quite some time and is becoming more popular as more people become aware of its health benefits.
This diet is known to be low in carbohydrates with an emphasis on healthy fats. This review article also provides an overview of the benefits of keto, including weight loss, improved mental clarity, and lowered cholesterol levels.
The keto diet focuses on fat intake and is not recommended for those that are severely obese or have diabetes. It does not include any grains or sugar or starchy vegetables or foods such as potatoes or pasta. While many people can maintain a healthy weight through this diet program, there are risks associated with it, including:
1) Overweight While going on a low-carbohydrate diet may help you lose weight rapidly, this is not always the case. While having less fat may lead to weight loss, there are still many other factors that play a role in whether your weight will remain stable after going on this type of diet program. For example:
2) High cholesterol Levels of cholesterol can be affected by changes in your body’s metabolism and fat intake as well as by your blood pressure. High blood pressure and high cholesterol levels do not usually go hand in hand but they do interact with one another to affect your blood pressure levels. Therefore if you have high blood pressure but low cholesterol levels then it would be difficult for you to lose weight which would require lowering your blood pressure first before lowering your cholesterol levels (not a recommended way). However, if you have gone through a phase where you’ve lost weight very fast without much effort then losing some more weight would not require any specific changes in your lifestyle at all; such as reducing carbs or increasing protein consumption.
3) Cardiovascular disease As stated above, high blood pressure often goes hand in hand with decreasing your chances of maintaining a stable body weight which leads to cardiovascular disease (CVD). However, there are some people who have gone through periods where they maintained their stable body weight without managing their CVD symptoms despite having high blood pressure due to their heavy calorie consumption. Therefore CVD symptoms may need to be controlled before someone can go on this type of program.
Thanks for reading this blog please share and comment.
For more diet plan
|
https://medium.com/@hopegurru/what-is-the-keto-diet-and-how-to-start-a-keto-diet-c7cdef588a3e
|
[]
|
2021-12-31 18:14:33.388000+00:00
|
['Ketogenic Diet', 'Ketogenic', 'Keto', 'Ketosis', 'Keto Diet']
|
Title keto diet start keto dietContent keto diet start keto diet Hopegurru Dec 31 2021·9 min read www hopegurrucom 1 Keto Diet keto diet allornothing high fat low carb diet promoted many celebrity keto diet claimed help lose weight without exercise without losing muscle mass also used mean weight loss maintenance low carbohydrate ketogenic diet involves limiting carbohydrate sugar le 50 gram per day achieved eating lowcarbohydrate diet typically consuming 20 gram net carbohydrate per meal word zero net carbs sugar starch source carbohydrate Injecting large amount carbohydrate body lead dumping glucose bloodstream via glycogen storage andor gluconeogenesis mechanism behind type weight reduction believed suppression appetite via secretion gastric inhibitory polypeptide stomach resulting increased food intake decreased food expenditure result supported research human volunteer well animal model “ketogenic” aspect come ketosis metabolic state blood sugar level extremely low due lack glucose intake resulting elevated level ketone 2 Foods Allowed many diet weight loss may thinking “A diet must something short death sentence” truth diet simply don’t work lose weight keto diet become favorite many celebrity including Halle Berry Kim Kardashian found success losing weight following diet called Keto ketogenic diet keto diet allows eat fat minimizing carbohydrate may seem difficult first stick follow rule find work Click 3 Benefits Keto Diet keto diet popular weightloss plan eliminates need carbohydrate proponent claim help overweight people lose weight lowering body’s insulin level providing source fatburning protein article titled “The Ketogenic Diet Stepbystep Guide Giving Sugar” author J Kavoussi Salahudeen explain eliminating carbohydrate diet lead increase amount free fatty acid generated body free fatty acid burned energy presence ketone body present low concentration bloodstream process called ketosis Ketones also shown suppress hunger induce feeling fullness downside going keto diet le control portion size you’re used eating large meal may tempted eat intended especially trying lose weight fast 4 Ketogenic Diet Safe secret ketogenic diet popular diet among celebrity Many successful losing weight least maintaining weight loss highfat lowcarb diet Although health consequence associated diet safe beneficial way lose weight without unhealthy side effect associated diet lowfat diet Ketogenic diet high fat low carbohydrate able burn fat effectively diet keto diet effective way lose weight you’re trying achieve ideal body composition Keto also help achieve goal feeling full sooner reduces appetite downside diet cause minor side effect like constipation nausea headache However side effect completely manageable follow simple guideline following keto diet Ketosis Diet Better One thing many people tend forget every time eat something containing carbs sugar you’re adding calorie ultimately lead weight gain body keep extra calorie fat process burning extra calorie exercise simply eating something healthy like vegetable help keep calorie intake within certain range don’t go daily calorie expenditure limit usually around 1500 calorie per day also need consider many carbohydrate meal typically five hour eating carbs cause blood sugar spike lead anxiety generally lead craving carbs sugar you’ve Atkins type low carb diet even recently switched chance carb content food steadily increased time it’s level what’s typically found normal American family’s meal plan described three meal per day one person plus snack throughout day could seven day per week summer month started eating three meal per day time Monday roll around happens often you’ll already eaten two meal maybe three restaurant meal That’s good Since body require 5 Start Keto Diet Plan keto diet lowcarb highfat diet based concept use fat stored body help regulate blood sugar idea behind body running ketone burn fat fuel instead carbohydrate feel le hungry eat fewer calorie sound great theory thing know dive headfirst world keto thing keep mind start journey road weight loss must careful carbohydrate intake ketosis can’t eat carbs state become stored fat good news many u able maintain weight even without eating massive amount carbs time However using sugar substitute like Splenda aspartame aka “Nutrasweet” make sure removed trace product diet starting keto diet Even don’t plan go back onto sugar aspartame immediately leaving ketosis still best consume product day following leaving ketosis body enough time break energy people think idea going ketosis via fasting much different many people intensive weight loss program lowcarbohydrate diet even standard lowfat diet case individual essentially fasting “ketogenic” — albeit toward end fast usually eat substantial amount food often including carbohydrate opinion it’s necessary strict restricting carb intake fasting long doesn’t interfere sleep schedule bodily function well avoiding alcohol consumption believe people survive without restricting carb intake fasting many day least prior beginning “ketogenic” phase begin begin consuming carbs enduring fast period may last anywhere 2–6 day depending hard push preparation starting fast period completed intense workout hopefully finished intense workout within 24 hour prior beginning fast period 6 Precautions Tips Healthy Keto Diet keto diet challenging keto diet high fat low carbohydrate mean requires higher caloric intake usual diet effective risk take keto diet may sound like much problem key precaution keep mind you’re starting keto diet Overeating weight gain you’re looking drastically lower weight may want consider making gradual adjustment going Keto Diet general rule thumb lowcarbohydrate diet two week it’s best start slowly reducing number carbohydrate eat also recommended go overboard overdo eating many carbohydrate starting keto diet exact science behind advice general idea behind fewer carbohydrate system one time give body time adjust negative effect noticed allow maintain healthy weight long going Keto Diet plan Staying Healthy Going Keto Diet you’re new Keto Diet don’t know long take body adjust following type diet plan staying healthy avoiding potential complication maybe even important losing weight essential going onto Ketogenic Diet understand long body take adapt going type dietary plan long take reach ideal weight set point time go without fluctuation made body weight number sooner later depending rapidly metabolism responds food craving kick back gear begin craving food come though everyone different metabolism work one person may work another…the best way think describing phenomenon far long metabolism take adjusting back one day way high usually 2 day v another day way low usually 3 day found typical day usually average 7 Conclusion post brief summary keto diet benefit provide keto diet already around quite time becoming popular people become aware health benefit diet known low carbohydrate emphasis healthy fat review article also provides overview benefit keto including weight loss improved mental clarity lowered cholesterol level keto diet focus fat intake recommended severely obese diabetes include grain sugar starchy vegetable food potato pasta many people maintain healthy weight diet program risk associated including 1 Overweight going lowcarbohydrate diet may help lose weight rapidly always case le fat may lead weight loss still many factor play role whether weight remain stable going type diet program example 2 High cholesterol Levels cholesterol affected change body’s metabolism fat intake well blood pressure High blood pressure high cholesterol level usually go hand hand interact one another affect blood pressure level Therefore high blood pressure low cholesterol level would difficult lose weight would require lowering blood pressure first lowering cholesterol level recommended way However gone phase you’ve lost weight fast without much effort losing weight would require specific change lifestyle reducing carbs increasing protein consumption 3 Cardiovascular disease stated high blood pressure often go hand hand decreasing chance maintaining stable body weight lead cardiovascular disease CVD However people gone period maintained stable body weight without managing CVD symptom despite high blood pressure due heavy calorie consumption Therefore CVD symptom may need controlled someone go type program Thanks reading blog please share comment diet planTags Ketogenic Diet Ketogenic Keto Ketosis Keto Diet
|
187,959 |
How to Calculate Macros on Keto Diet
|
Calculating your daily keto macros is now more convenient since there are a lot of Keto macro calculators that you can use online.
For a more accurate calculation, you may look for a Ketogenic calculator that includes your age, BMI, weight, gender, your sets of activities for the day, and your calorie intake.
The common ratios of a Ketogenic diet’s macronutrients breakdown are 5–10% carbohydrates, 15–25% protein, and 65–75% fat.
Below are some amazing Keto Diet /Weight loss plans for you
1 The Ultimate Keto Meal Plan
2 Keto After 50
3 Keto Desserts
4 The Essential Keto Cookbook
5 The Keto Snacks Cookbook
Now let’s begin looking at how you can calculate your Keto macros.
Carbohydrates
5–10% Carbohydrates equates to approximately 20–50 grams of carbs per day. Since the Ketogenic diet is a low-carb one, you will also have to keep your carb intake low. What you can do is eat your carbs separately.
Before getting your total number of carbs, you need to first compute your Total Daily Energy Expenditure(TDE E). Remember that, as mentioned above, you will have to record your set of activities also. That set of activities will equate to your TDE E. By then, you will have to multiply it by your total number of calories which will have to look like this:
TDE E x Total % of calories / 4 = Grams of carbs per day
You may also try this calculation;
Total number of calorie’s, x (Desire percentage of carbs) / 4 = Total number of carbs
For instance, your total calorie’s, intake is 2,000, and you wish to keep your carb intake at 5% only per day.
2,000 x 0.05 = 100
100 / 4 = 25
Your total carb intake daily will be 25 grams.
You may also look for a standard online Keto calculator that can help you as you compute your daily carb intake.
Protein
If you are new to the Ketogenic diet and have a lightly active lifestyle, the estimated grams per pound of lean mass will range from 0.8–1.0 However, if you are into bodybuilding, you might need 1.0–1.2 grams per pound of lean mass.
You should have a general idea of what your body goal is, and then use that to get your ranges that determine the amount of protein you need.
Let’s say you want to maintain your body weight at 110 pounds, your body mass will roughly need 70–88 grams of protein per day.
If you want to compute the total number of calories from that amount of protein, calculate 70–88 grams of protein multiplied by 4 to give you the total number of calories from protein.
Fat,
doing a Ketogenic diet, will require your body to consume 70–80% of calories. To know your total amount of fat needed, you will have to sum up your total number of protein with your total number of carbs and then deduct 100 from the end answer. The most recent numbers will be your total number of fat needed.
You might get varying results whenever you try to compute for your total number of fat. This may be because of your varying body mass also. However, you will have to adjust your macros from time to time.
Your total number of fat might even shock you at first. But do not worry. As stated above, you will be needing 65–75% of fat in order to stay in Ketosis.
Know your Keto Macros,
You can be your very own Ketogenic macro calculator. However, the calculation of your Keto macros above may not be 100% accurate. If you wish to have it double-checked, you can consult an online Keto macro calculator.
Since going on a Ketogenic diet will also make you lose weight, you will also have to check and adjust your macros to make your daily macro intake more conducive for your current body mass
Disclaimer: I don’t represent the E-book/Course shown in my article, it is for educational purposes only. Use it at your own risk.
AFFILIATE DISCLOSURE: This article may contain affiliate links, which means that if you click on any of the product links, I may receive a small commission.
Below are some amazing Keto Diet /Weight loss plans for you
1 The Ultimate Keto Meal Plan
2 Keto After 50
3 Keto Desserts
4 The Essential Keto Cookbook
5 The Keto Snacks Cookbook
|
https://medium.com/@lappy.722/how-to-calculate-macros-on-keto-diet-e1f65f41d870
|
['Priyanka Ma']
|
2021-12-20 13:16:26.950000+00:00
|
['Ketogenic Diet', 'Diet', 'Ketogenic', 'Keto', 'Keto Diet']
|
Title Calculate Macros Keto DietContent Calculating daily keto macro convenient since lot Keto macro calculator use online accurate calculation may look Ketogenic calculator includes age BMI weight gender set activity day calorie intake common ratio Ketogenic diet’s macronutrients breakdown 5–10 carbohydrate 15–25 protein 65–75 fat amazing Keto Diet Weight loss plan 1 Ultimate Keto Meal Plan 2 Keto 50 3 Keto Desserts 4 Essential Keto Cookbook 5 Keto Snacks Cookbook let’s begin looking calculate Keto macro Carbohydrates 5–10 Carbohydrates equates approximately 20–50 gram carbs per day Since Ketogenic diet lowcarb one also keep carb intake low eat carbs separately getting total number carbs need first compute Total Daily Energy ExpenditureTDE E Remember mentioned record set activity also set activity equate TDE E multiply total number calorie look like TDE E x Total calorie 4 Grams carbs per day may also try calculation Total number calorie’s x Desire percentage carbs 4 Total number carbs instance total calorie’s intake 2000 wish keep carb intake 5 per day 2000 x 005 100 100 4 25 total carb intake daily 25 gram may also look standard online Keto calculator help compute daily carb intake Protein new Ketogenic diet lightly active lifestyle estimated gram per pound lean mass range 08–10 However bodybuilding might need 10–12 gram per pound lean mass general idea body goal use get range determine amount protein need Let’s say want maintain body weight 110 pound body mass roughly need 70–88 gram protein per day want compute total number calorie amount protein calculate 70–88 gram protein multiplied 4 give total number calorie protein Fat Ketogenic diet require body consume 70–80 calorie know total amount fat needed sum total number protein total number carbs deduct 100 end answer recent number total number fat needed might get varying result whenever try compute total number fat may varying body mass also However adjust macro time time total number fat might even shock first worry stated needing 65–75 fat order stay Ketosis Know Keto Macros Ketogenic macro calculator However calculation Keto macro may 100 accurate wish doublechecked consult online Keto macro calculator Since going Ketogenic diet also make lose weight also check adjust macro make daily macro intake conducive current body mass Disclaimer don’t represent EbookCourse shown article educational purpose Use risk AFFILIATE DISCLOSURE article may contain affiliate link mean click product link may receive small commission amazing Keto Diet Weight loss plan 1 Ultimate Keto Meal Plan 2 Keto 50 3 Keto Desserts 4 Essential Keto Cookbook 5 Keto Snacks CookbookTags Ketogenic Diet Diet Ketogenic Keto Keto Diet
|
187,960 |
What do beginners eat on keto diet?
|
9 Steps Beginners Should Take Before Trying the Keto Diet
Photo by Lily Banse on Unsplash
>> Click Here To Secure Your Free Copy Of The Essential Keto Cookbook
Are you ready to make the switch to a high-fat, low-carb diet? Here are ten things you should know to avoid problems and increase your chances of success.
The ketogenic diet — a high-fat and very low carb eating plan — can be tough to start. After all, it’s likely a radical departure from the way you’re eating now (a typical standard American diet is high in carbohydrates and processed foods). But many people are trying the keto diet, which puts your body in a state of ketosis. That’s what happens when your body’s carb-burning switch flips to a fat-burning one, a change that can cause weight loss and has even been credited with controlling type 2 diabetes, a small past study suggests. (1)
How do you go about stocking your fridge and mentally preparing for the big change that’s coming? Consider this your step-by-step instruction manual.
Photo by Nadine Primeau on Unsplash
1.Understand which foods you’ll eat and which you’ll avoid on the ketogenic diet.
You’ll be drastically reducing carbs if you stick to a keto food plan. Start with 20 to 30 grams of carbohydrates per day, according to Kristen Mancinelli, RD, a dietitian in New York City and author of The Ketogenic Diet: A Scientifically Proven Approach to Fast, Healthy Weight Loss.
Also make sure that you know what foods have mostly carbs, fat, and protein, so you can make the right choices. For instance, it’s not just bread, pasta, chips, cookies, candy, and ice cream that contain carbs. Beans may contain protein, but they’re also very high in carbohydrates. Fruit and veggies also mostly contain carbs. The only foods that don’t contain carbs are meat (protein) and pure fats, like butter and oils (including olive oil and coconut oil).
2. Examine Your Fat Relationship — Keto Requires a Lot of It!
“People are terrified of being obese because they’ve been taught it’ll kill them,” Mancinelli explains. What’s perplexing is that today’s research is still mixed. According to an article published in June 2018 in BMJ, some studies suggest that replacing saturated fat with polyunsaturated fat (and avoiding unhealthy trans fat) is important for reducing heart disease risk, while others suggest that total fat and types of fat aren’t linked to cardiovascular problems. (2) Deciding how to eat gets more difficult.
It’s important to remember that food is more than a single vitamin, and the entire quality of the diet is what matters, according to the scientists. (They however add that more research is needed to determine the long-term health advantages and hazards of high-fat, low-carb diets.)
Start making tiny changes to what you eat every day to prepare for a high-fat diet, which can be uncomfortable at first, she recommends, such as getting a burger on lettuce leaves and substituting green vegetables for fries.
>> Click Here To Secure Your Free Copy Of The Essential Keto Cookbook
Choose a nonstarchy vegetable to accompany your meal instead of potatoes or rice. Increase the amount of oil used in your cooking, such as olive or avocado oil. Realize that past dieting behaviors, such as grilling a basic skinless chicken breast, won’t work on a keto diet since you won’t receive enough fat.
“Start gradually reducing carbs and increasing fat intake. “A ketogenic diet won’t work for you if you’re terrified of fat,” she explains.
3. Change Your Protein Perspective — This Is a Moderate-Protein Diet
One of the most prevalent misconceptions regarding the keto diet is that you may consume as much protein as you want. This is not true. But this isn’t just a carb-counting diet; you also need to restrict your protein intake, according to Ginger Hultin, a registered dietitian in Seattle who is also a spokeswoman for the Academy of Nutrition and the owner of Ginger Hultin Nutrition.
ChampagneNutrition is a brand of Champagne. Protein can be turned to glucose, so consuming too much of it can knock you out of ketosis. Instead of the other way around, think of your ratios as a little bit of meat topped with a substantial amount of fat.
>> Click Here To Secure Your Free Copy Of The Essential Keto Cookbook
4. Sharpen your culinary skills to prepare fresh foods, as high-carb processed foods aren’t allowed on the Keto diet.
Look through a number of keto websites and cookbooks to find delicious keto-approved recipes. Mancinelli suggests locating four to five meals that include ingredients you know you’ll enjoy. “That way, you’re not stuck wondering what to eat and resorting to carbs,” she explains.
5. Try Bulletproof Coffee, which is one of the best keto-friendly beverages on the market.
This drink, which is made by combining coconut oil and butter into your coffee, can help to hold your hunger at bay, giving you time to plan your next meal, according to Mancinelli.
Just keep in mind that coconut oil has the potential to raise LDL (or “bad”) cholesterol levels, so if you have heart disease or are at risk for it due to family or personal health history, you should probably avoid this drink. To be on the safe side, consult your physician. (3)
6. Discuss your weight-loss goals with your family while on the diet.
Inform them of your plans. Because you might not be able to consume what they’re eating during family mealtimes, you’ll want to prepare them (and yourself) for your new habits. You can reassure them that this diet is only temporary because it is usually followed for three to six months.
If you’re met with resistance, say, “I’ve done my research, I’ve determined it’s safe, and I really want to try this,” as Mancinelli suggests. They don’t have to agree with what you’re doing, but it helps if they support you. According to a study published in the journal Obesity in September 2014, having the support of friends and coworkers helped dieters lose weight and keep it off for two years. (4) It also doesn’t hurt if everyone understands your keto diet intentions, since they’ll be less inclined to promote workplace sweets or recommend splitting a side of fries at dinner.
7. Be aware of potential side effects (such as the ‘Keto Flu’).
Despite all of the benefits of a ketogenic diet (such as weight loss), there is one major negative effect to be aware of: the keto flu.
The keto flu is a term used to describe the period following the initiation of a ketogenic diet when your body adjusts to using fat for energy. “Some individuals are fine with it, while others are miserable,” Mancinelli says.
You may feel exceedingly lethargic in your limbs for the first week or ten days. It may appear impossible to walk upstairs. It’s possible that you’ll have mental fog. Because of the reduction in fiber consumption, keto frequently causes constipation or diarrhea.
As a result, choose a start date when your week isn’t jam-packed with responsibilities and obligations; pick a leisurely period when you can rest as needed. In a similar vein, you’ll want to ease into activity for the first week or two while your body adjusts to burning fat rather than carbohydrates for fuel.
8. Boost Your Electrolytes to Avoid or Minimize Keto Side Effects
Mancinelli notes that when you’re in ketosis, your kidneys expel more water and electrolytes. Make sure you’re receiving enough salt and potassium to keep your body running smoothly. Consume nonstarchy vegetables such as asparagus, kale, bell peppers, and arugula, as well as salted bone broth.
105 Delicious Healthy Recipes [Free]
You Gotta Try These Amazing Recipes
Hi,
If you love delicious and healthy recipes, then you’re gonna love what I’ve got for you today.
That’s because my friend Louise has just released a brand new edition of her popular cookbook.
It’s called the Essential Keto Cookbook, and it has 105 mouth-watering recipes.
And while these recipes are designed for people on a Keto diet, they’re actually ideal for anyone who wants to eat healthy.
Each recipe is free of sugar, gluten, dairy, grains, and processed foods. (Basically anything that people can have intolerances to.)
Now, you might think that recipes without any of these ingredients couldn’t possibly taste good…
And normally you’d be right.
But Louise has an uncanny ability to create recipes that taste amazing with only the healthiest of ingredients.
I’m talking about recipes like:
Ginger spice cookies
Fiery buffalo wings
Chocolate coffee coconut truffles
Guacamole burgers
Coconut chicken curry
Peppermint patties
Slow cooker beef stew
Chocolate chia pudding
Many, many more
And you know what the best part is?
You can prove it to yourself by picking up her cookbook for free.
Because she’s a friend…
Louise has set aside a limited number of free copies of the Essential Keto Cookbook for my readers.
This is an actual physical book that she’ll send to your house. (All she asks is that you cover the small shipping fee.)
And since the first edition sold over 50000 copies…
I wouldn’t expect these free copies she’s set aside to last very long at all.
That means if you’d like to secure your copy, it’s crucial that you do so right away.
>> Click Here To Secure Your Free Copy Of The Essential Keto Cookbook
|
https://medium.com/@jdidiwahid22/what-do-beginners-eat-on-keto-diet-23db41842c39
|
[]
|
2021-12-25 09:46:19.059000+00:00
|
['Ketogenic Diet', 'Keto Diet', 'Cookbooks', 'Keto']
|
Title beginner eat keto dietContent 9 Steps Beginners Take Trying Keto Diet Photo Lily Banse Unsplash Click Secure Free Copy Essential Keto Cookbook ready make switch highfat lowcarb diet ten thing know avoid problem increase chance success ketogenic diet — highfat low carb eating plan — tough start it’s likely radical departure way you’re eating typical standard American diet high carbohydrate processed food many people trying keto diet put body state ketosis That’s happens body’s carbburning switch flip fatburning one change cause weight loss even credited controlling type 2 diabetes small past study suggests 1 go stocking fridge mentally preparing big change that’s coming Consider stepbystep instruction manual Photo Nadine Primeau Unsplash 1Understand food you’ll eat you’ll avoid ketogenic diet You’ll drastically reducing carbs stick keto food plan Start 20 30 gram carbohydrate per day according Kristen Mancinelli RD dietitian New York City author Ketogenic Diet Scientifically Proven Approach Fast Healthy Weight Loss Also make sure know food mostly carbs fat protein make right choice instance it’s bread pasta chip cooky candy ice cream contain carbs Beans may contain protein they’re also high carbohydrate Fruit veggie also mostly contain carbs food don’t contain carbs meat protein pure fat like butter oil including olive oil coconut oil 2 Examine Fat Relationship — Keto Requires Lot “People terrified obese they’ve taught it’ll kill them” Mancinelli explains What’s perplexing today’s research still mixed According article published June 2018 BMJ study suggest replacing saturated fat polyunsaturated fat avoiding unhealthy trans fat important reducing heart disease risk others suggest total fat type fat aren’t linked cardiovascular problem 2 Deciding eat get difficult It’s important remember food single vitamin entire quality diet matter according scientist however add research needed determine longterm health advantage hazard highfat lowcarb diet Start making tiny change eat every day prepare highfat diet uncomfortable first recommends getting burger lettuce leaf substituting green vegetable fry Click Secure Free Copy Essential Keto Cookbook Choose nonstarchy vegetable accompany meal instead potato rice Increase amount oil used cooking olive avocado oil Realize past dieting behavior grilling basic skinless chicken breast won’t work keto diet since won’t receive enough fat “Start gradually reducing carbs increasing fat intake “A ketogenic diet won’t work you’re terrified fat” explains 3 Change Protein Perspective — ModerateProtein Diet One prevalent misconception regarding keto diet may consume much protein want true isn’t carbcounting diet also need restrict protein intake according Ginger Hultin registered dietitian Seattle also spokeswoman Academy Nutrition owner Ginger Hultin Nutrition ChampagneNutrition brand Champagne Protein turned glucose consuming much knock ketosis Instead way around think ratio little bit meat topped substantial amount fat Click Secure Free Copy Essential Keto Cookbook 4 Sharpen culinary skill prepare fresh food highcarb processed food aren’t allowed Keto diet Look number keto website cookbook find delicious ketoapproved recipe Mancinelli suggests locating four five meal include ingredient know you’ll enjoy “That way you’re stuck wondering eat resorting carbs” explains 5 Try Bulletproof Coffee one best ketofriendly beverage market drink made combining coconut oil butter coffee help hold hunger bay giving time plan next meal according Mancinelli keep mind coconut oil potential raise LDL “bad” cholesterol level heart disease risk due family personal health history probably avoid drink safe side consult physician 3 6 Discuss weightloss goal family diet Inform plan might able consume they’re eating family mealtime you’ll want prepare new habit reassure diet temporary usually followed three six month you’re met resistance say “I’ve done research I’ve determined it’s safe really want try this” Mancinelli suggests don’t agree you’re help support According study published journal Obesity September 2014 support friend coworkers helped dieter lose weight keep two year 4 also doesn’t hurt everyone understands keto diet intention since they’ll le inclined promote workplace sweet recommend splitting side fry dinner 7 aware potential side effect ‘Keto Flu’ Despite benefit ketogenic diet weight loss one major negative effect aware keto flu keto flu term used describe period following initiation ketogenic diet body adjusts using fat energy “Some individual fine others miserable” Mancinelli say may feel exceedingly lethargic limb first week ten day may appear impossible walk upstairs It’s possible you’ll mental fog reduction fiber consumption keto frequently cause constipation diarrhea result choose start date week isn’t jampacked responsibility obligation pick leisurely period rest needed similar vein you’ll want ease activity first week two body adjusts burning fat rather carbohydrate fuel 8 Boost Electrolytes Avoid Minimize Keto Side Effects Mancinelli note you’re ketosis kidney expel water electrolyte Make sure you’re receiving enough salt potassium keep body running smoothly Consume nonstarchy vegetable asparagus kale bell pepper arugula well salted bone broth 105 Delicious Healthy Recipes Free Gotta Try Amazing Recipes Hi love delicious healthy recipe you’re gonna love I’ve got today That’s friend Louise released brand new edition popular cookbook It’s called Essential Keto Cookbook 105 mouthwatering recipe recipe designed people Keto diet they’re actually ideal anyone want eat healthy recipe free sugar gluten dairy grain processed food Basically anything people intolerance might think recipe without ingredient couldn’t possibly taste good… normally you’d right Louise uncanny ability create recipe taste amazing healthiest ingredient I’m talking recipe like Ginger spice cooky Fiery buffalo wing Chocolate coffee coconut truffle Guacamole burger Coconut chicken curry Peppermint patty Slow cooker beef stew Chocolate chia pudding Many many know best part prove picking cookbook free she’s friend… Louise set aside limited number free copy Essential Keto Cookbook reader actual physical book she’ll send house asks cover small shipping fee since first edition sold 50000 copies… wouldn’t expect free copy she’s set aside last long mean you’d like secure copy it’s crucial right away Click Secure Free Copy Essential Keto CookbookTags Ketogenic Diet Keto Diet Cookbooks Keto
|
187,961 |
Biggest mistakes in ketogenic dieting
|
The Keto diet is best known for the fact that you can lose a lot of weight very quickly. The keto diet means eating a high percentage of fat, with minimal carbohydrate intake. Sometimes, even when you follow all the rules, you just can't lose weight. That's why you need to know the most common mistakes that make it impossible to lose weight quickly and efficiently. These are the mistakes you should avoid when you are on a keto diet. Disclaimer: There may be some affiliate links.
1. You start unprepared with the KETO diet
Although we have all heard that the keto diet is very effective, that you can lose up to 10 kilograms a month, you should be careful with this. Before you start with the keto diet, you need to know in detail which foods you can and which foods you must not consume. If you are not r
You need sweets, but you don't know what dessert substitutes you can use when you're on a keto diet.eady enough to go on a keto diet, you can get a counter-effect, even gaining extra pounds. It usually happens that: - You have for need sweets, but you don't know what dessert substitutes you can use when you're on a keto diet.
- You will continue to snack on unhealthy foods and foods that you should not eat when you are on a keto diet, because you may not have planned your meals well enough.
- The pounds will not go down, may even gain weight. Instead, be well informed before you go on a keto diet, follow groups of people who are also on a keto diet, if you see that you do not like something, correct or seek advice.
(THE BEST SELLING KETO DIET SYSTEM FOR 50+ YEAR OLDS)
2. Insufficient intake of vitamin B
Vitamin B is best found in whole grains, and when there is not enough of it, you can feel a drop in energy, feel tired and slow down the weight loss process. But, you can get vitamin B from foods that are allowed on the keto diet, such as meat, eggs, dairy products, seeds and nuts, as well as dark green vegetables such as spinach and broccoli. If you still don't feel the effects, you can check with your doctor to start using vitamin B supplements.
3. Too many carbs
The most common mistake on a keto diet is to eat too many carbohydrates. Probably not intentionally, because many foods would not even think they contain carbohydrates, and yet they are in quantities that are not acceptable if you are on a keto diet. To enter the state of ketosis, carbohydrates must be reduced to a minimum. Only then will your body start burning fat instead of glucose and only then will you start losing weight. If you are not sure how many grams of carbohydrates a food contains, check it before consuming it.
4. Too much protein
When the body consumes a lot of protein, a small amount is converted into glucose. Therefore, it may happen that you will reduce the chances of entering a state of ketosis. You don't just have to eat bacon and steak. The main goal of the keto diet is to use healthy fats, such as nut butter, olive oil, avocado. Therefore, you should limit your protein intake, and have some form of healthy fat with every meal.
For those who have a sweet tooth, we recommend “Keto Desserts”
5. Insufficient intake of fiber
The keto diet aims to reduce the intake of sugar and carbohydrates as much as possible, so you probably won't get enough fiber. Fiber is found in whole grains and fruits, and these are foods that are not allowed on the keto diet. However, fiber is essential for regulating hunger and providing enough energy. When we eat very little fiber, it can lead to a feeling of hunger, so you overeat later. Therefore, it is recommended that you eat a lot of vegetables, especially dark greens or take supplements, in order to provide your body with a sufficient intake of fiber.
6. Leptin resistance
Leptin is a hormone that controls fat. It informs the brain when the organism is full, so that it stops eating. Leptin is produced by fat cells and is mainly responsible for how many calories you consume, how much you consume, and how much fat you have in your body. Leptin resistance occurs when you have a lot of leptin, but the brain no longer receives messages. Then you are constantly nibbling or overeating, so you are constantly gaining weight. Causes of leptin resistance can be:
- Not enough sleep
- Too much junk food
- Overeating
- Stress
Leptin resistance can be overcame with the Keto diet.
7. The “Curse’’ of the Google
Most people go on a keto diet by checking a couple of articles on Google to see that we are allowed to eat bacon, butter and dark chocolate. However, that is not enough. It is also necessary to understand: - How many calories can you take in a day to lose weight
- Which foods contain hidden sugars, and which are sugar-free, and yet delicious
- Vegetables, dairy products and butter are allowed, but you must keep track of how many grams you eat
- A good keto diet plan improves the quality of sleep and provides the body with the minerals and vitamins it needs
That’s when “The Essential Keto Cookbook” comes in the story.
The Essential Keto Cookbook comes with 100+ Keto recipes including breakfast, appetizers, entrees, desserts, drinks, and snacks. Net-carb, fat, protein, and calorie count for every recipe. Enjoy recipes like Creamy Breakfast Porridge, Fiery Buffalo Wings, Mini Burgers, Jalapeño Corn Bread, Fish Tacos, Popcorn Shrimp, and tons more.
|
https://medium.com/@danilociric4/seven-biggest-mistakes-in-keto-dietting-fa1659383538
|
[]
|
2021-12-22 14:56:39.322000+00:00
|
['Ketogenic Diet', 'Weight Loss', 'Keto Recipes', 'Keto', 'Keto Diet']
|
Title Biggest mistake ketogenic dietingContent Keto diet best known fact lose lot weight quickly keto diet mean eating high percentage fat minimal carbohydrate intake Sometimes even follow rule cant lose weight Thats need know common mistake make impossible lose weight quickly efficiently mistake avoid keto diet Disclaimer may affiliate link 1 start unprepared KETO diet Although heard keto diet effective lose 10 kilogram month careful start keto diet need know detail food food must consume r need sweet dont know dessert substitute use youre keto dieteady enough go keto diet get countereffect even gaining extra pound usually happens need sweet dont know dessert substitute use youre keto diet continue snack unhealthy food food eat keto diet may planned meal well enough pound go may even gain weight Instead well informed go keto diet follow group people also keto diet see like something correct seek advice BEST SELLING KETO DIET SYSTEM 50 YEAR OLDS 2 Insufficient intake vitamin B Vitamin B best found whole grain enough feel drop energy feel tired slow weight loss process get vitamin B food allowed keto diet meat egg dairy product seed nut well dark green vegetable spinach broccoli still dont feel effect check doctor start using vitamin B supplement 3 many carbs common mistake keto diet eat many carbohydrate Probably intentionally many food would even think contain carbohydrate yet quantity acceptable keto diet enter state ketosis carbohydrate must reduced minimum body start burning fat instead glucose start losing weight sure many gram carbohydrate food contains check consuming 4 much protein body consumes lot protein small amount converted glucose Therefore may happen reduce chance entering state ketosis dont eat bacon steak main goal keto diet use healthy fat nut butter olive oil avocado Therefore limit protein intake form healthy fat every meal sweet tooth recommend “Keto Desserts” 5 Insufficient intake fiber keto diet aim reduce intake sugar carbohydrate much possible probably wont get enough fiber Fiber found whole grain fruit food allowed keto diet However fiber essential regulating hunger providing enough energy eat little fiber lead feeling hunger overeat later Therefore recommended eat lot vegetable especially dark green take supplement order provide body sufficient intake fiber 6 Leptin resistance Leptin hormone control fat informs brain organism full stop eating Leptin produced fat cell mainly responsible many calorie consume much consume much fat body Leptin resistance occurs lot leptin brain longer receives message constantly nibbling overeating constantly gaining weight Causes leptin resistance enough sleep much junk food Overeating Stress Leptin resistance overcame Keto diet 7 “Curse’’ Google people go keto diet checking couple article Google see allowed eat bacon butter dark chocolate However enough also necessary understand many calorie take day lose weight food contain hidden sugar sugarfree yet delicious Vegetables dairy product butter allowed must keep track many gram eat good keto diet plan improves quality sleep provides body mineral vitamin need That’s “The Essential Keto Cookbook” come story Essential Keto Cookbook come 100 Keto recipe including breakfast appetizer entree dessert drink snack Netcarb fat protein calorie count every recipe Enjoy recipe like Creamy Breakfast Porridge Fiery Buffalo Wings Mini Burgers Jalapeño Corn Bread Fish Tacos Popcorn Shrimp ton moreTags Ketogenic Diet Weight Loss Keto Recipes Keto Keto Diet
|
187,962 |
The Keto Snacks Cookbook
|
Most “Keto” Snack Recipes Still Contain a Bunch of Terrible Ingredients
Just because a food is low in carbs does not mean that it’s automatically good for you…
Plenty of Keto snack recipes still contain ingredients that I would never choose to eat.
Many common “keto” ingredients (like cheese, dairy, and seed oils) are highly inflammatory or sometimes very high in carbs.
And if you really want to feel great, you’ve got to pay attention to more than just how much sugar is in your food.
100% of the recipes in this cookbook are ALSO gluten-free, Paleo, low-inflammatory, and dairy-free. All recipes contain:
ZERO grains
ZERO artificial sweeteners
ZERO processed foods
ZERO legumes
ZERO dairy
ZERO nut or seed oils
So you’re not just losing weight and eating tasty food, you’re also healing your body.
Delicious 100% Keto Baked Snacks That Taste Just Like the “Real Thing”
My friends and family thought I was crazy to cut out all carbs and sugar.
So whenever they’d come over, I wanted to have snacks for them that seemed just like the non-keto versions. It wasn’t easy, though…
I worked for months to create incredible “sweet” keto snacks that taste as good as or better than the original.
Sweet, baked treats like:
Almond Flour Cookies with Lemon Zest
Chocolate Brownies
Cinnamon Donut Balls
“Cornbread” Muffins
Mini Pecan Pies
Blueberry muffins
and more!
Claim Your FREE Physical Copy of The Essential Keto Snacks Cookbook Today! << CLICK HERE
|
https://medium.com/@TWK999/the-keto-snacks-cookbook-3315352b6b20
|
[]
|
2021-12-16 09:58:24.497000+00:00
|
['Diet', 'Books', 'Fitness', 'Keto', 'Cook']
|
Title Keto Snacks CookbookContent “Keto” Snack Recipes Still Contain Bunch Terrible Ingredients food low carbs mean it’s automatically good you… Plenty Keto snack recipe still contain ingredient would never choose eat Many common “keto” ingredient like cheese dairy seed oil highly inflammatory sometimes high carbs really want feel great you’ve got pay attention much sugar food 100 recipe cookbook ALSO glutenfree Paleo lowinflammatory dairyfree recipe contain ZERO grain ZERO artificial sweetener ZERO processed food ZERO legume ZERO dairy ZERO nut seed oil you’re losing weight eating tasty food you’re also healing body Delicious 100 Keto Baked Snacks Taste Like “Real Thing” friend family thought crazy cut carbs sugar whenever they’d come wanted snack seemed like nonketo version wasn’t easy though… worked month create incredible “sweet” keto snack taste good better original Sweet baked treat like Almond Flour Cookies Lemon Zest Chocolate Brownies Cinnamon Donut Balls “Cornbread” Muffins Mini Pecan Pies Blueberry muffin Claim FREE Physical Copy Essential Keto Snacks Cookbook Today CLICK HERETags Diet Books Fitness Keto Cook
|
187,963 |
Rich, Mouth-Watering Keto Fudge That Is MORE Delicious Than “Regular” Fudge
|
Hi there!
That chocolate fudge in the photo — is richer and creamier than almost any fudge I’ve ever had — it just melts in your mouth…
Best of all…
…It’s 100% Keto!
Each bite makes you completely forget you’re on a diet.
And if you have kids or grandkids, they’ll beg for “just one more piece”.
Whenever my friends or family taste this fudge, they’re shocked that it’s actually healthy…
It’s Not JUST Fudge…
How About Delicious Keto Cookies, Keto Pizza, & Even Keto Ice Cream?
Seriously… These are some of the most delicious cookies, pizza, and ice cream you can eat — not like the dry, bland “health” foods they sell at the store.
In addition to being yummy… each cookie, scoop of ice cream, or slice of pizza fuels your body with vitamins, minerals, & healthy fats.
Plus, every snack is 100% free from inflammatory ingredients and contains almost no carbs or sugars.
But even without sugar, these sweet snacks — like donuts, ice cream, and cookies — are sweet enough to satisfy any sugar craving…
And these snacks taste so good, you’ll never be tempted to cheat with non-Keto foods.
Most importantly, these Keto snacks have been tested in my own kitchen and by thousands of other women like you and me.
Rich, Mouth-Watering Keto Fudge That Is MORE Delicious Than “Regular” Fudge
MOST “healthy” chocolates taste absolutely awful.
The ones you buy at the store are usually chalky and gritty — not like real chocolate at all.
My keto chocolate fudge is smooth and rich, and isn’t grainy.
And the aroma in your kitchen is divine.
Plus, my pizza oozes with flavor and spices … Garlic. Onion. Oregano. Tomatoes. Arugula. And Pepperoni. So delicious!
And those are just a couple of the snacks in my brand new Keto cookbook — packed full of mouth-watering Keto recipes.
I personally developed each and every recipe, so I can promise you they’re absolutely delicious and easy to make.
Here’s Why My Essential Keto Snacks Cookbook is 100% FREE Today…
My publisher just released a completely new and updated version of my cookbook! (They haven’t even released it on Amazon yet.)
It now has ALL of my best keto snacks and treats, along with new images and complete nutritional information and carb count.
And the people who’ve gotten an early copy absolutely love the keto snacks and treats in the cookbook!
However…they forgot to print the barcode on the back of these copies and so we can’t sell them in stores. That’s why my publisher is allowing me to give away these copies for free to people like you.
People who appreciate good keto recipes, and want to eat delicious food and lose weight.
All I ask is this…
If you like the recipes, please tell someone about the book. A friend, a coworker, or maybe your neighbor or your sister.
That helps me out — but it also helps them eat amazing snacks and feel great.
Your friends and family will even thank you for showing them delicious recipes! This way, we can expose more people to the incredible benefits of eating delicious Keto snacks!
My Most Requested Keto Snacks …
After spending months in the kitchen, I decided to include ALL of my best Keto snacks recipes in the Essential Keto Snacks Cookbook.
Here are a few of the most popular recipes from the thousands of people who bought the original version:
|
https://medium.com/@creativity252585/rich-mouth-watering-keto-fudge-that-is-more-delicious-than-regular-fudge-e59b055ae220
|
[]
|
2021-12-31 21:32:45.255000+00:00
|
['Weight', 'Weightloos', 'Keto']
|
Title Rich MouthWatering Keto Fudge Delicious “Regular” FudgeContent Hi chocolate fudge photo — richer creamier almost fudge I’ve ever — melt mouth… Best all… …It’s 100 Keto bite make completely forget you’re diet kid grandkids they’ll beg “just one piece” Whenever friend family taste fudge they’re shocked it’s actually healthy… It’s Fudge… Delicious Keto Cookies Keto Pizza Even Keto Ice Cream Seriously… delicious cooky pizza ice cream eat — like dry bland “health” food sell store addition yummy… cookie scoop ice cream slice pizza fuel body vitamin mineral healthy fat Plus every snack 100 free inflammatory ingredient contains almost carbs sugar even without sugar sweet snack — like donut ice cream cooky — sweet enough satisfy sugar craving… snack taste good you’ll never tempted cheat nonKeto food importantly Keto snack tested kitchen thousand woman like Rich MouthWatering Keto Fudge Delicious “Regular” Fudge “healthy” chocolate taste absolutely awful one buy store usually chalky gritty — like real chocolate keto chocolate fudge smooth rich isn’t grainy aroma kitchen divine Plus pizza ooze flavor spice … Garlic Onion Oregano Tomatoes Arugula Pepperoni delicious couple snack brand new Keto cookbook — packed full mouthwatering Keto recipe personally developed every recipe promise they’re absolutely delicious easy make Here’s Essential Keto Snacks Cookbook 100 FREE Today… publisher released completely new updated version cookbook haven’t even released Amazon yet best keto snack treat along new image complete nutritional information carb count people who’ve gotten early copy absolutely love keto snack treat cookbook However…they forgot print barcode back copy can’t sell store That’s publisher allowing give away copy free people like People appreciate good keto recipe want eat delicious food lose weight ask this… like recipe please tell someone book friend coworker maybe neighbor sister help — also help eat amazing snack feel great friend family even thank showing delicious recipe way expose people incredible benefit eating delicious Keto snack Requested Keto Snacks … spending month kitchen decided include best Keto snack recipe Essential Keto Snacks Cookbook popular recipe thousand people bought original versionTags Weight Weightloos Keto
|
187,964 |
Exipure: The Tropical Secret For Healthy Weight Loss
|
I am interducing you the Exipure metabolism boosting supplement.
The count of people struggling with obesity has been higher than at any other time in the 21st century. Lethargic lifestyle, propensity for poor eating and unscheduled hours of work are the main reasons for unwanted weight gain. Experts say that almost 50% of Americans are obese. Variables that influence your well-being include stress, hormonal discomfort, aggravation, lack of activity, and powerless sleep.
Hence, the requirement for an all-natural supplement is truly outstanding. The Exipure supplement is the safest, most powerful, and most viable method. to address the rationalization of individual well-being proactively.
Exipure is one of the newest extraordinary tropical supplements of 2021. It is a superior weight loss pill that professes to work and supports a healthier weight loss approach. The pills help burn fat and help you get in shape.
According to Exipure’s logical research, low levels of brown fat tissue (BAT) are typical of every overweight man and woman. In this Exipure review, we will reveal the truth to you by discovering the Exipure ingredients, side effects, utilisation, and actual Exipure customer reviews . So, read the full article and familiarise yourself with all aspects of the weight management formula.
What is Exipure?
Exipure is a recently shipped, pristine, all-natural restrictive amalgam of weight loss items.
These ingredients burn more calories and adjust the levels of brown fat in the body. The main driver from the creators of Exipure behind excessive weight gain is levels of soft brown fat tissue (BAT). These natural pills target common brown fatty tissue (BAT) levels and destroy stubborn fat deposits. Helps you get fitter.
According to an NCBI study, BAT is viable to combat girth. It implies that low levels of BAT in your body can trigger undesirable fat and robustness. People with high BAT levels are bound to be slim. These higher levels of BAT can help burn a more significant amount of calories in the body.
Lower BAT levels are the true underlying factor for obesity. Some overweight people.
Try a strict diet and exercise schedule, and nothing happens. On the other hand, thin people have a fat burning heater inside. They can eat anything and stay fit. The brown fat tissue works every minute and develops a calorie-burning process. It ensures you lose weight.
How does Exipure work?
You can get in shape by keeping your caloric intake under control. First, you need to track an enchantment to lose weight.
The facts confirm that there is no convenient solution to losing weight. You need to get rid of more calories than you eat. Exipure does this and ensures fast weight loss results. In addition, it helps to stimulate brown fatty tissues .
The makers of Exipure are not essentially straightforward on how their formula works to improve brown fat tissue. But its ingredients are genuinely backed by science.
Workouts or muscle building are often helpful in helping to grill fat tissue. Additionally, it can help your body's BAT levels by devouring fat and improving BAT levels. The people behind Exipure confirm that ingredients like ginseng, kudzu, and holy basil can help raise brown fat levels in the body. It is a fundamental criterion to burn fat effectively.
SPECIAL PROMOTION: Get Exipure at the lowest discounted price online [US, CA, UK, IE, AU, NZ]!
What are the ingredients in Exipure?
The ingredients in Exipure are the real stars of the weight loss supplement. So we need to present them comprehensively as they decide the ultimate feasibility of supplements for burning fat, enhancing energy, and supporting Exipure's BATs.
From perilla leaf and kudzu root to propolis, Korean white ginseng and amur plug bark, every ingredient in Exipure is sourced from Cat Ba Island (a small tropical island off the coast of Vietnam).
It is an exceptional equation, never seen before.
Perilla leaves (Perilla frutescens):
Perilla leaves are known as Perilla frutescens. These are widely used in Chinese medicine. In Exipure, Perilla frutescens is essential for maintaining healthy cholesterol levels, BAT and mental well-being. It is a calming and antioxidant agent. The herb is antihypersensitive.
Kudzu (Pueraria Lobata):
Kudzu is rich in cellular reinforcements. Lowers the risk of fever, diabetes, cold, and coronary heart disease. The mitigating properties help relieve discomfort and decrease free revolutions.
Holy basil (Ocimum sanctum):
This phenomenal spice offers numerous benefits. These include reducing stress, improving mental capacity, and helping with joint agony. Plus, it maintains optimal pulse and sugar levels when you take it routinely.
Korean White Ginseng (Panax ginseng):
This is a powerful ingredient. Supports brown fat tissue and causes weight loss. Also, according to studies, Korean white ginseng helps build energy levels, fight sluggishness, maintain immunity, and lower oxidative pressure.
Amur plug bark (Phellodendron amurense):
Amur cork bark improves stomach well-being and combats weight gain. This natural hold reduces bulging and edema, two important purposes behind being overweight. Also, it helps lift brown fat tissue.
Quercetin (Quercetum):
Quercetin supports brown fat tissue and helps you get in shape. Helps maintain healthy circulatory tension and keep up with glucose levels. In addition, it has anti-aging properties and helps you feel constantly young. In addition, it keeps the skin, cells, tissues and muscles strong and alive.
Propolis:
Propolis contains pinocembrin, an exceptional component that maintains glucose and cell reinforcements. The soothing and antimicrobial properties help to heal wounds, fight aggravation, develop and improve body cells.
Oleuropein (Olea europaea):
Oleuropein is known to improve the amount of brown adipose tissue (BAT) in the body. Accelerates weight loss. Shrinks fat from fat cells and helps you eliminate intestinal fat and fat from the most demanding regions. Helps you lose weight, maintains healthy ducts, and controls cholesterol. Plus, it restores your digestion to keep it running steadily.
(LIMITED SUPPLIES)
>>Click Here<< and order Exipure pills at a special discounted price today!
Does Science Endorse Exipure Supplement?
Each of the eight fascinating ingredients in the Exipure supplement does not have to be responsible for working on brown fat tissue (BAT) levels. However, each element plays its role in the weight loss process. Exipure is the ultimate dietary supplement. There is no evidence from any clinical exam or peer-reviewed research on the website. Nonetheless, the compelling ingredients are backed by proven weight loss studies.
Listed below is the part of the logic test references that are given on the Exipure official website:
There is a review that was circulated in 2019 regarding berberine ingredients. According to him, berberine improves levels of brown fat tissue (BAT) in people. In addition, it disperses metabolic energy.
Ultimately, it channels chill-free thermogenesis, boosts energy, and accelerates weight loss.
A 2017 review on resveratrol and quercetin claims that the combination of these two ingredients provides higher levels of BAT. As a result, it is helpful in reducing fat accumulation.
Another review claims that higher levels of brown fat tissue (BAT) improve energy synthesis.
In this 2004 study, scientists observed that BAT is helpful in turning on lipids and glucose in tissue or mitochondria. It favors the burning of fat and calories.
What are the benefits of the Exipure supplement?
When you look at the customer reviews of the Exipure supplement, you will find several advantages.
Exipure triggers thermogenesis and transforms your body into a fat burning machine.
Expands the action of brown fatty tissue.
The supplement causes further weight loss.
Expands metabolic rate, lowers desire, and builds satiety levels.
The pills develop insulin sensitivity and suppress the creation of unsaturated fats.
Lowers cholesterol and fat levels.
The formula reduces the accumulation of additional fat.
It makes you eat less and establishes a feeling of fullness.
Each Exipure capsule is 100% natural and is GMO-free.
There are no side effects.
The pills are made in the USA.
>>CLICK HERE AND ORDER NOW<<
Lowest Price Guaranteed
Old User Complaints and Consumer Reviews:
The Exipure review sections contain some genuine references from real life changing Exipure users. Let's review these customer reviews.
The absolute first review is from Lauren, a woman who has lost 35 pounds with the help of Exipure.
She confirms that she was initially terrified about leaving her home. I used to think that I could barely fit in the seats or travel by transport in broad daylight. However, currently, he weighs 35 pounds and displays a more attractive appearance and certainty. She feels more upbeat.
Cassie started taking Exipure steadily four months ago. He has disintegrated 40 pounds while still eating his favorite food. She's wearing four dresses and she feels so real in herself. She is not currently stressed about how her peers will view her.
Where to buy Exipure pills and prices in US, CA, UK, IE, AU, NZ?
The cost of Exipure pills starts from $ 59.
Below is the list of evaluation packages:
Essential package: $ 59 for a bottle of Exipure
Most popular: $ 147 for three bottles of Exipure
Best price: $ 234 for six bottles of Exipure
To discuss how Exipure works, you can start with a container bottle. However, I suggest you go for a more extensive package if you are trying to save more.
Additionally, Exipure is available in all major countries, mainly the United States, United Kingdom, Canada, Ireland, Australia, South Africa, and New Zealand .
The Bottom Line!
Exipure is one of the most incredible weight loss supplements. Contains eight quirky ingredients. Its main emphasis is on the main extreme weight driver. The supplement tries to change negative thinking about yourself and provides you with a wonderful development plan.
You don't lose money because every order is covered with a 180-day unconditional refund promise.
Exipure is a powerful BAT-assisting supplement that has never been introduced before. It is an effective way to eliminate fat from the abdomen, activate metabolic capacity and discover energy. As of now, this brown fat based supplement has helped a large number of people.
GET YOUR DISCOUNTED PACKAGE
>>CLICK HERE<<
All The Best
Free Bonus of 3 Keto Diet Recipes Books (Physical Books)
The Essential Keto Cookbook (Physical) - Free + Shipping
>>CLAIM NOW<<
The physical version of the Essential Keto Cookbook with 100+ Keto recipes including breakfast, appetizers, entrees, desserts, drinks, and snacks. Net-carb, fat, protein, and calorie count for every recipe. Enjoy recipes like Creamy Breakfast Porridge, Fiery Buffalo Wings, Mini Burgers, Jalapeño Corn Bread, Fish Tacos, Popcorn Shrimp, and tons more.
The book is 100% FREE to buyers, they just have to pay for shipping. Limited quantities while supplies last.
⭐ The Keto Snacks Cookbook (Physical) - Free+Shipping ⭐
>>CLAIM NOW<<
⭐⭐ Brand New Free+Shipping Keto Offer ⭐⭐ from the creators of the crazy popular Essential Keto Cookbook.
The Keto Snacks Cookbook is filled with 78+ Keto-friendly recipes, including:
Chocolate Fudge
Chicken Nuggets
Meatball Pizza Bites
Mini Pecan Pies
Cookies
and more... all 100% Keto!
The book is 100% FREE to buyers, they just have to pay for shipping. Limited quantities while supplies last.
3. Keto Desserts
>>CLAIM NOW<<
KETO BREAKTHROUGH FOR MEN & WOMEN OVER AGE 50
Enjoy Delicious, Sugar-Free, Low-Carb Desserts and Still Be On Keto
|
https://medium.com/@inderrr1111/exipure-the-tropical-secret-for-healthy-weight-loss-ef2e2a4250f3
|
['Inder Singh']
|
2021-12-24 04:49:01.571000+00:00
|
['Ketogenic Diet', 'Keto', 'Keto Recipe', 'Weightloss Foods', 'Weight Loss Tips']
|
Title Exipure Tropical Secret Healthy Weight LossContent interducing Exipure metabolism boosting supplement count people struggling obesity higher time 21st century Lethargic lifestyle propensity poor eating unscheduled hour work main reason unwanted weight gain Experts say almost 50 Americans obese Variables influence wellbeing include stress hormonal discomfort aggravation lack activity powerless sleep Hence requirement allnatural supplement truly outstanding Exipure supplement safest powerful viable method address rationalization individual wellbeing proactively Exipure one newest extraordinary tropical supplement 2021 superior weight loss pill professes work support healthier weight loss approach pill help burn fat help get shape According Exipure’s logical research low level brown fat tissue BAT typical every overweight man woman Exipure review reveal truth discovering Exipure ingredient side effect utilisation actual Exipure customer review read full article familiarise aspect weight management formula Exipure Exipure recently shipped pristine allnatural restrictive amalgam weight loss item ingredient burn calorie adjust level brown fat body main driver creator Exipure behind excessive weight gain level soft brown fat tissue BAT natural pill target common brown fatty tissue BAT level destroy stubborn fat deposit Helps get fitter According NCBI study BAT viable combat girth implies low level BAT body trigger undesirable fat robustness People high BAT level bound slim higher level BAT help burn significant amount calorie body Lower BAT level true underlying factor obesity overweight people Try strict diet exercise schedule nothing happens hand thin people fat burning heater inside eat anything stay fit brown fat tissue work every minute develops calorieburning process ensures lose weight Exipure work get shape keeping caloric intake control First need track enchantment lose weight fact confirm convenient solution losing weight need get rid calorie eat Exipure ensures fast weight loss result addition help stimulate brown fatty tissue maker Exipure essentially straightforward formula work improve brown fat tissue ingredient genuinely backed science Workouts muscle building often helpful helping grill fat tissue Additionally help body BAT level devouring fat improving BAT level people behind Exipure confirm ingredient like ginseng kudzu holy basil help raise brown fat level body fundamental criterion burn fat effectively SPECIAL PROMOTION Get Exipure lowest discounted price online US CA UK IE AU NZ ingredient Exipure ingredient Exipure real star weight loss supplement need present comprehensively decide ultimate feasibility supplement burning fat enhancing energy supporting Exipures BATs perilla leaf kudzu root propolis Korean white ginseng amur plug bark every ingredient Exipure sourced Cat Ba Island small tropical island coast Vietnam exceptional equation never seen Perilla leaf Perilla frutescens Perilla leaf known Perilla frutescens widely used Chinese medicine Exipure Perilla frutescens essential maintaining healthy cholesterol level BAT mental wellbeing calming antioxidant agent herb antihypersensitive Kudzu Pueraria Lobata Kudzu rich cellular reinforcement Lowers risk fever diabetes cold coronary heart disease mitigating property help relieve discomfort decrease free revolution Holy basil Ocimum sanctum phenomenal spice offer numerous benefit include reducing stress improving mental capacity helping joint agony Plus maintains optimal pulse sugar level take routinely Korean White Ginseng Panax ginseng powerful ingredient Supports brown fat tissue cause weight loss Also according study Korean white ginseng help build energy level fight sluggishness maintain immunity lower oxidative pressure Amur plug bark Phellodendron amurense Amur cork bark improves stomach wellbeing combat weight gain natural hold reduces bulging edema two important purpose behind overweight Also help lift brown fat tissue Quercetin Quercetum Quercetin support brown fat tissue help get shape Helps maintain healthy circulatory tension keep glucose level addition antiaging property help feel constantly young addition keep skin cell tissue muscle strong alive Propolis Propolis contains pinocembrin exceptional component maintains glucose cell reinforcement soothing antimicrobial property help heal wound fight aggravation develop improve body cell Oleuropein Olea europaea Oleuropein known improve amount brown adipose tissue BAT body Accelerates weight loss Shrinks fat fat cell help eliminate intestinal fat fat demanding region Helps lose weight maintains healthy duct control cholesterol Plus restores digestion keep running steadily LIMITED SUPPLIES Click order Exipure pill special discounted price today Science Endorse Exipure Supplement eight fascinating ingredient Exipure supplement responsible working brown fat tissue BAT level However element play role weight loss process Exipure ultimate dietary supplement evidence clinical exam peerreviewed research website Nonetheless compelling ingredient backed proven weight loss study Listed part logic test reference given Exipure official website review circulated 2019 regarding berberine ingredient According berberine improves level brown fat tissue BAT people addition disperses metabolic energy Ultimately channel chillfree thermogenesis boost energy accelerates weight loss 2017 review resveratrol quercetin claim combination two ingredient provides higher level BAT result helpful reducing fat accumulation Another review claim higher level brown fat tissue BAT improve energy synthesis 2004 study scientist observed BAT helpful turning lipid glucose tissue mitochondrion favor burning fat calorie benefit Exipure supplement look customer review Exipure supplement find several advantage Exipure trigger thermogenesis transforms body fat burning machine Expands action brown fatty tissue supplement cause weight loss Expands metabolic rate lower desire build satiety level pill develop insulin sensitivity suppress creation unsaturated fat Lowers cholesterol fat level formula reduces accumulation additional fat make eat le establishes feeling fullness Exipure capsule 100 natural GMOfree side effect pill made USA CLICK ORDER Lowest Price Guaranteed Old User Complaints Consumer Reviews Exipure review section contain genuine reference real life changing Exipure user Lets review customer review absolute first review Lauren woman lost 35 pound help Exipure confirms initially terrified leaving home used think could barely fit seat travel transport broad daylight However currently weighs 35 pound display attractive appearance certainty feel upbeat Cassie started taking Exipure steadily four month ago disintegrated 40 pound still eating favorite food Shes wearing four dress feel real currently stressed peer view buy Exipure pill price US CA UK IE AU NZ cost Exipure pill start 59 list evaluation package Essential package 59 bottle Exipure popular 147 three bottle Exipure Best price 234 six bottle Exipure discus Exipure work start container bottle However suggest go extensive package trying save Additionally Exipure available major country mainly United States United Kingdom Canada Ireland Australia South Africa New Zealand Bottom Line Exipure one incredible weight loss supplement Contains eight quirky ingredient main emphasis main extreme weight driver supplement try change negative thinking provides wonderful development plan dont lose money every order covered 180day unconditional refund promise Exipure powerful BATassisting supplement never introduced effective way eliminate fat abdomen activate metabolic capacity discover energy brown fat based supplement helped large number people GET DISCOUNTED PACKAGE CLICK Best Free Bonus 3 Keto Diet Recipes Books Physical Books Essential Keto Cookbook Physical Free Shipping CLAIM physical version Essential Keto Cookbook 100 Keto recipe including breakfast appetizer entree dessert drink snack Netcarb fat protein calorie count every recipe Enjoy recipe like Creamy Breakfast Porridge Fiery Buffalo Wings Mini Burgers Jalapeño Corn Bread Fish Tacos Popcorn Shrimp ton book 100 FREE buyer pay shipping Limited quantity supply last ⭐ Keto Snacks Cookbook Physical FreeShipping ⭐ CLAIM ⭐⭐ Brand New FreeShipping Keto Offer ⭐⭐ creator crazy popular Essential Keto Cookbook Keto Snacks Cookbook filled 78 Ketofriendly recipe including Chocolate Fudge Chicken Nuggets Meatball Pizza Bites Mini Pecan Pies Cookies 100 Keto book 100 FREE buyer pay shipping Limited quantity supply last 3 Keto Desserts CLAIM KETO BREAKTHROUGH MEN WOMEN AGE 50 Enjoy Delicious SugarFree LowCarb Desserts Still KetoTags Ketogenic Diet Keto Keto Recipe Weightloss Foods Weight Loss Tips
|
187,965 |
Don’t Be Fooled by this Common (and Deadly) myth about Bread… What You Don’t Notice CAN Hurt You!
|
Don’t Be Fooled by this Common
(and Deadly) myth about Bread…
What You Don’t Notice CAN Hurt You! Somashreebanik Dec 23, 2021·2 min read
You’re probably familiar with Celiac Disease. It is the most serious — and often life-threatening — sensitivity to grains that contain gluten.
Many who suffer from this condition cannot consume even the slightest speck of wheat without severe digestive pain… and other embarrassing symptoms.
Other illnesses, like Crohn’s and inflammatory bowel disease, also result in debilitating cramping, bloating, and other digestive distress when wheat is consumed.
This leads many people to believe that as long as you can eat bread without belly problems — then you must be in the clear… no harm done!
Do not be fooled by this dangerous myth!
The truth is nearly 50% of newly-diagnosed celiac patients have no digestive symptoms!
In other words, half of the people who are EXTREMELY sensitive to wheat can still consume it without the typical “stomach problems”.
The bottom line is…
Even if you feel “just fine” after eating bread, every bite is causing silent damage to your gut — and quietly setting you up for serious disease!
Dr. Alessio Fasano is a professor of medicine and distinguished researcher, with more than 240 peer-reviewed papers to his credit.
To know about other reasons that bread can hurt you,
Kindly read the full article at: https://bit.ly/3sCJsmu
|
https://medium.com/@somashreebanik9/dont-be-fooled-by-this-common-and-deadly-myth-about-bread-what-you-don-t-notice-can-hurt-you-57f3a2ebc5f0
|
[]
|
2021-12-23 17:09:44.762000+00:00
|
['Weight Loss', 'Health', 'Keto', 'Bread', 'Recipe']
|
Title Don’t Fooled Common Deadly myth Bread… Don’t Notice Hurt YouContent Don’t Fooled Common Deadly myth Bread… Don’t Notice Hurt Somashreebanik Dec 23 2021·2 min read You’re probably familiar Celiac Disease serious — often lifethreatening — sensitivity grain contain gluten Many suffer condition cannot consume even slightest speck wheat without severe digestive pain… embarrassing symptom illness like Crohn’s inflammatory bowel disease also result debilitating cramping bloating digestive distress wheat consumed lead many people believe long eat bread without belly problem — must clear… harm done fooled dangerous myth truth nearly 50 newlydiagnosed celiac patient digestive symptom word half people EXTREMELY sensitive wheat still consume without typical “stomach problems” bottom line is… Even feel “just fine” eating bread every bite causing silent damage gut — quietly setting serious disease Dr Alessio Fasano professor medicine distinguished researcher 240 peerreviewed paper credit know reason bread hurt Kindly read full article httpsbitly3sCJsmuTags Weight Loss Health Keto Bread Recipe
|
187,966 |
The Essential Keto Cookbook
|
The Essential Keto Cookbook with more than 100 Effortless Recipes!
Do you think that it is hard to begin the Keto venture all alone?
Would you like to appreciate yummy food without feeling hungry or unmotivated?
The Keto Diet is extraordinary for the “one size fits all” approach and permits you a simple variation to your particular necessities. This keto cookbook gives the resources to engage everybody to foster an adaptable methodology plan, offering numerous choices while managing the limits of the standard ketogenic diet. And all that without forfeiting on Taste or Quality!!
This simple to explore keto cookbook has in excess of 100 foolproof recipes, for example,
• Ginger Spice Cookies
• Keto Lasagna
• Searing Buffalo Wings
• Jalapeño “Corn” Bread
• Chocolate Biscotti
• Exquisite Italian Crackers
• Mexican Tacos
Guacamole Burgers
Obviously, all recipes are 100% keto (sans sugar, low-carb, sans gluten, without grain, paleo, sans dairy, and vegetable-free) and 100% flavorful.
👉 👉 👉 Get the Essential Keto CookBook
This awesome Keto cookbook will deal with your scant cooking time, increment your craving and obligation to the Keto way of life and show you the least demanding and most delicious way towards a practical WEIGHT-LOSS and a BETTER LIFE while being on the keto.
It procured a top deal on Amazon as well. Here look at some reviews:
👉 👉 👉 Get the Essential Keto CookBook
Give yourselves the best present and begin appreciating life once more!
This book can inspire each reader, all readers. The creator presents insider facts that poor person been uncovered up to this point. Try not to miss it, since this book is very instructing, and opens new skylines, there are relatively few books like this. Perusing this book will expand your knowledge in fostering your latent capacity.
#keto #ketodiet #health #healthandwellness #cooking #food #life #weightloss #howtoloseweight
|
https://medium.com/@orkhannasirli/review-the-essential-keto-cookbook-4bbc09be3045
|
['Orkhan Nasirli']
|
2022-01-24 17:47:19.530000+00:00
|
['Weight Loss', 'Health', 'Food', 'Keto', 'Cooking']
|
Title Essential Keto CookbookContent Essential Keto Cookbook 100 Effortless Recipes think hard begin Keto venture alone Would like appreciate yummy food without feeling hungry unmotivated Keto Diet extraordinary “one size fit all” approach permit simple variation particular necessity keto cookbook give resource engage everybody foster adaptable methodology plan offering numerous choice managing limit standard ketogenic diet without forfeiting Taste Quality simple explore keto cookbook excess 100 foolproof recipe example • Ginger Spice Cookies • Keto Lasagna • Searing Buffalo Wings • Jalapeño “Corn” Bread • Chocolate Biscotti • Exquisite Italian Crackers • Mexican Tacos Guacamole Burgers Obviously recipe 100 keto sans sugar lowcarb sans gluten without grain paleo sans dairy vegetablefree 100 flavorful 👉 👉 👉 Get Essential Keto CookBook awesome Keto cookbook deal scant cooking time increment craving obligation Keto way life show least demanding delicious way towards practical WEIGHTLOSS BETTER LIFE keto procured top deal Amazon well look review 👉 👉 👉 Get Essential Keto CookBook Give best present begin appreciating life book inspire reader reader creator present insider fact poor person uncovered point Try miss since book instructing open new skyline relatively book like Perusing book expand knowledge fostering latent capacity keto ketodiet health healthandwellness cooking food life weightloss howtoloseweightTags Weight Loss Health Food Keto Cooking
|
187,967 |
Keto Dessert No Bake Recipe for 2022! CHOCOLATE CHEESECAKE RECIPE.
|
Simple Step by Step Recipe
An easy keto no bake chocolate cheesecake recipe with 20 Minute Prep! Keto no bake low carb chocolate cheesecake has just 5 ingredients in the crust and 4 in the filling.
I first made low carb keto cheesecake a couple years ago, but it’s still the most popular low carb keto dessert recipe . Many of you have been asking me for a keto low carb chocolate cheesecake, and I’ve also gotten a few requests for a no-bake version. So, I did both.
Here it is the low carb no bake chocolate cheesecake recipe you’ve been waiting for!
HOW TO MAKE CHOCOLATE CHEESECAKE WITH COCOA POWDER
The process for how to make keto no bake chocolate cheesecake is super simple, and it’s actually the same whether you’re making a regular or low carb chocolate cheesecake. It’s just 2 basic layers:
Chocolate Cheesecake Crust — Many regular recipes use oreos, but for a keto chocolate cheesecake crust, we use a combination of almond flour, cocoa powder, sweetener, butter and vanilla. Mix it all together, press into the pan, and chill to set. Chocolate Cheesecake Filling — This is a simple mix of cream cheese, unsweetened chocolate, powdered sweetener, and vanilla. It requires some melting and beating to get it the right consistency (details on the recipe card below!), then just pour it into the crust and chill again to set.
Here are a few tips as you make it:
If you forget to leave your cream cheese out at room temperature, you can heat it gently to soften it.
Do not overheat the chocolate when melting it. Otherwise, it might seize.
When mixing the chocolate with the cream cheese, make sure the chocolate is no longer hot but warm is okay. Work fairly quickly so that it doesn’t start to solidify.
If the filling sits too long, it will get thick. If this happens, you can microwave it for 30 seconds, and stir to soften it up. Do not overheat, or it might split.
Just to give you an idea, here are what the different steps look like…
No bake chocolate cheesecake crust:
Filling when it’s all mixed together:
Filling after transferring to the pan and smoothing over:
KETO CHOCOLATE CHEESECAKE SUBSTITUTIONS
There are a few common questions I get about substitutions when you make keto no bake low carb chocolate cheesecake. Here are those answers for you:
CAN YOU USE COCONUT FLOUR?
You can’t use coconut flour to replace almond flour 1-to-1. The result would be very dry.
If you want to make a coconut flour crust, try using the crust from these cupcakes and make the filling the way this recipe says. You’d need to bake the crust in that case.
Otherwise, if you are nut-free, you can try replacing the almond flour with sunflower seed meal.
CAN YOU USE OTHER SWEETENERS?
Yes, you can. Check the sweetener conversion calculator for the amount to use.
CAN YOU MAKE NO BAKE CHOCOLATE CHEESECAKE DAIRY-FREE AND PALEO?
Probably. Replace the butter in the crust with coconut oil, and replace the cream cheese with dairy-free cream cheese substitute. I haven’t tried this to verify that it works, but don’t see any reason that it would not.
CAN YOU MAKE THE KETO NO BAKE CHEESECAKE FILLING WITH COCOA POWDER?
In general, I don’t recommend it. Although you could try, it is more prone to being dry and less smooth. Unsweetened chocolate works much better. Save the cocoa powder for the crust!
WHAT TOPPINGS TO USE?
I drizzled my chocolate cheesecake with melted chocolate and topped it with raspberries. Feel free to add a little sugar-free whipped cream if you’d like, too.
HOW TO STORE LOW CARB CHOCOLATE CHEESECAKE
This keto no bake chocolate cheesecake recipe stores very well. It will keep about as long as cream cheese would in the fridge, at least a week.
However, occasionally the erythritol will crystallize sooner, which affects the smooth texture. To be on the safe side, if you want to make the cheesecake ahead for an occasion, up to 3 days ahead is best.
CAN YOU FREEZE NO BAKE CHOCOLATE CHEESECAKE?
Yes, you can! Wrap the keto no bake chocolate cheesecake in plastic wrap, followed by 2 layers of foil. Then, place in the freezer. Be gentle with it so that it does not break or crack.
To serve, thaw the cheesecake in the refrigerator overnight. You can let it sit at room temperature afterward if you prefer it softer and less cold.
|
https://medium.com/@ditch_witch13/keto-dessert-no-bake-recipe-for-2022-chocolate-cheesecake-recipe-1ab21897f24e
|
['Effa Zack']
|
2021-12-29 10:27:55.304000+00:00
|
['Keto Dessert Recipes', 'Cheese Cake Recipe', 'No Bake Recipes', 'Keto', 'Chocolate Cake Recipe']
|
Title Keto Dessert Bake Recipe 2022 CHOCOLATE CHEESECAKE RECIPEContent Simple Step Step Recipe easy keto bake chocolate cheesecake recipe 20 Minute Prep Keto bake low carb chocolate cheesecake 5 ingredient crust 4 filling first made low carb keto cheesecake couple year ago it’s still popular low carb keto dessert recipe Many asking keto low carb chocolate cheesecake I’ve also gotten request nobake version low carb bake chocolate cheesecake recipe you’ve waiting MAKE CHOCOLATE CHEESECAKE COCOA POWDER process make keto bake chocolate cheesecake super simple it’s actually whether you’re making regular low carb chocolate cheesecake It’s 2 basic layer Chocolate Cheesecake Crust — Many regular recipe use oreo keto chocolate cheesecake crust use combination almond flour cocoa powder sweetener butter vanilla Mix together press pan chill set Chocolate Cheesecake Filling — simple mix cream cheese unsweetened chocolate powdered sweetener vanilla requires melting beating get right consistency detail recipe card pour crust chill set tip make forget leave cream cheese room temperature heat gently soften overheat chocolate melting Otherwise might seize mixing chocolate cream cheese make sure chocolate longer hot warm okay Work fairly quickly doesn’t start solidify filling sits long get thick happens microwave 30 second stir soften overheat might split give idea different step look like… bake chocolate cheesecake crust Filling it’s mixed together Filling transferring pan smoothing KETO CHOCOLATE CHEESECAKE SUBSTITUTIONS common question get substitution make keto bake low carb chocolate cheesecake answer USE COCONUT FLOUR can’t use coconut flour replace almond flour 1to1 result would dry want make coconut flour crust try using crust cupcake make filling way recipe say You’d need bake crust case Otherwise nutfree try replacing almond flour sunflower seed meal USE SWEETENERS Yes Check sweetener conversion calculator amount use MAKE BAKE CHOCOLATE CHEESECAKE DAIRYFREE PALEO Probably Replace butter crust coconut oil replace cream cheese dairyfree cream cheese substitute haven’t tried verify work don’t see reason would MAKE KETO BAKE CHEESECAKE FILLING COCOA POWDER general don’t recommend Although could try prone dry le smooth Unsweetened chocolate work much better Save cocoa powder crust TOPPINGS USE drizzled chocolate cheesecake melted chocolate topped raspberry Feel free add little sugarfree whipped cream you’d like STORE LOW CARB CHOCOLATE CHEESECAKE keto bake chocolate cheesecake recipe store well keep long cream cheese would fridge least week However occasionally erythritol crystallize sooner affect smooth texture safe side want make cheesecake ahead occasion 3 day ahead best FREEZE BAKE CHOCOLATE CHEESECAKE Yes Wrap keto bake chocolate cheesecake plastic wrap followed 2 layer foil place freezer gentle break crack serve thaw cheesecake refrigerator overnight let sit room temperature afterward prefer softer le coldTags Keto Dessert Recipes Cheese Cake Recipe Bake Recipes Keto Chocolate Cake Recipe
|
187,968 |
It’s Time To Take Your Weight Loss To The Next Level
|
Ketosis is a popular diet nowadays that many people are turning to for weight loss. It’s an effective technique because it forces your body into using fats as fuel, which indirectly helps with melting unwanted pounds and having slimmer muscles. This means no more high-carb intake; instead you can enjoy moderate proteins alongside higher amounts of dietary fat (known commonly on Keto Diet).
It can be tough to stay on the keto diet, especially if you don’t have enough time or motivation. Luckily there are some quick solutions out there for us!
One way to lose weight is by eating low-carb and taking keto diet pills for weight loss while on this type of regimen will help you feel fuller quicker, which in turn reduces food intake naturally.
Keto pills which is the most rapid and easy way of losing weight. Keto advanced weight loss pills increase the levels of ketones in the blood. Keto capsules only work when you are following a restricted ketogenic diet. A ketogenic diet does a lot more than just simulate Ketone production. It helps in lowering the circulation of insulin and glucose providing benefit to the ketones.
Keto Supplements
Many people are looking for a way to lose weight and feel healthier. Introducing keto advanced weight loss capsules, which have been shown time after time as the most effective natural method of improving your health in just 30 days. These products can help you drop pounds rapidly while increasing energy levels.
When your body is in the process of converting fats into energy, it starts doing so through a synthetic substance called beta-hydroxybutyrate (BHB). Nowadays there are many different types and brands available in the store these come with minimal side effects.
Another example of a Keto supplement is MCT oil. MCT oil is extracted from coconut oil, palm oil, and some other dairy products. MCT oil provides a feeling of fullness when added to the food. It releases two kinds of hormones in the body, peptide YY, and leptin. It consists of fewer calories in comparison to other oils such as olive oil, avocados, and nuts. It is best for converting ketones and is also good for your gut.
Keto advanced weight loss supplement help you stay in ketosis for a longer period of time, which may lead to weight loss. They also contain important minerals such as magnesium and sodium that can only be found on supplements. Keto pills are cheap. The best part? You can eat them anywhere because they’re easy to carry.
How Do Supplements Work?
The supplements make it easier for the body to enter ketosis faster, by using fat as a form of energy. This is because instead carbs are burning and this causes you to lose weight quickly.
Keto weight loss capsules help to achieve the state of the process faster as compared to the keto diet. It helps in boosting the metabolism and burning more calories even when you are at rest. Taking both Keto weight loss pill and the keto diet can help you achieve your weight loss goals faster than just the keto diet alone.
Farmity Keto Capsules for Weight Loss
Keto capsules for weight loss products provide ingredients that help with fat burning and decrease appetite, allowing you to burn more calories than before while maintaining your mental well-being in an improved state. It’s perfect for anyone looking for healthy ways to improve physical appearances by controlling cravings all day long.
It has a uniquely powerful patent-pending formula with the highest grade of natural ingredients, organic, vegetarian, gluten-free, dairy-free, and GMO-free. You can use these capsules anytime you need a burst of energy or mental clarity.
Benefits of Using Keto Weight Management Pill
Increases the Metabolism
The farmity keto capsule is an excellent way to increase metabolism, and lose weight. It contains Garcinia Cambogia and green tea extract, which work together as an appetite suppressant while limiting your intake on unhealthy fats. These capsules have been shown in studies as one of the most effective ways for people looking at cutting calories or maintaining their current diet while still enjoying a well-balanced nutrition plan that will keep them energized throughout each day’s activities.
Reduces Overall Body Fat
The Farmity keto capsule is the perfect way to ensure you maintain your weight and avoid cravings. This product will help combat those pesky food temptations that often lead people into an unhealthy lifestyle, which in turn can cause them additional stress on top of their already hectic daily schedule! The key ingredients are all-natural fruits with no artificial colors or flavors — just clean eating goodness without any harmful chemicals added so it tastes as good if not better than anything else out there today.
Fights Against Carbohydrates
The Farmity keto capsule fights against carbohydrates, which are the enemy of weight loss. Carbs stimulate your appetite and slow down fat burning while also raising blood sugar levels.
Improves Mental Health
Farmity keto capsules are designed to improve mental health and provide a sense of calm. The ingredients in Farmity Keto include: green tea and green coffee beans (which has been shown as effective anxiety relief), garcinia powder extract which helps boost energy levels while also improving focus. Study suggested that green tea consumption increases dopamine and serotonin, which have been linked to reducing symptoms of depression.
Ingredients Present in Farmity Keto Capsules
Garcinia Cambogia: It is the best effective ingredient of the supplement. It helps in losing several pounds of weight in just one week.
Green Tea Extract: It works with the metabolic rate and also increases the energy level.
Green Coffee Beans: It may also promote blood sugar regulation, improve health markers, such as blood pressure and cholesterol, and provide antioxidants.
MCT Powder: Consuming MCTs can help reduce your overall intake of calories throughout the day.
Conjugated Linoleic Acid: It is also a popular dietary supplement helping people maintain weight; retain lean muscle mass, and control type 2 diabetes.
Directions & Safety
Pregnant and lactating females should strictly avoid using keto capsules.
Children below the age of 18 years should take this supplement only with physician advice.
Patients with known medical ailments i.e. kidney, liver, and cardiac disorders should take this supplement under physician advice
Farmity Keto capsules are prohibited for women with hormonal imbalances like breast cancer, ovarian cancer, etc.
Two Capsules daily before breakfast with a glass of warm water or lemon water. Also, take a proper keto-friendly diet and do exercise daily.
Where to Buy Best Keto Supplement in India?
Buy the best Farmity Keto Advanced Weight Loss Supplement in India online from Amazon and Flipkart at the best price and enjoy the amazing shipping services, convenient payment method. Avail incredible health benefits of taking Keto weight loss capsules for women & men.
|
https://medium.com/@heeb/its-time-to-take-your-weight-loss-to-the-next-level-a299d814c7fa
|
['Heebs Healthcare']
|
2021-12-18 06:39:32.363000+00:00
|
['Ketogenic Diet', 'Ketogenic', 'Keto', 'Ketosis', 'Keto Diet']
|
Title It’s Time Take Weight Loss Next LevelContent Ketosis popular diet nowadays many people turning weight loss It’s effective technique force body using fat fuel indirectly help melting unwanted pound slimmer muscle mean highcarb intake instead enjoy moderate protein alongside higher amount dietary fat known commonly Keto Diet tough stay keto diet especially don’t enough time motivation Luckily quick solution u One way lose weight eating lowcarb taking keto diet pill weight loss type regimen help feel fuller quicker turn reduces food intake naturally Keto pill rapid easy way losing weight Keto advanced weight loss pill increase level ketone blood Keto capsule work following restricted ketogenic diet ketogenic diet lot simulate Ketone production help lowering circulation insulin glucose providing benefit ketone Keto Supplements Many people looking way lose weight feel healthier Introducing keto advanced weight loss capsule shown time time effective natural method improving health 30 day product help drop pound rapidly increasing energy level body process converting fat energy start synthetic substance called betahydroxybutyrate BHB Nowadays many different type brand available store come minimal side effect Another example Keto supplement MCT oil MCT oil extracted coconut oil palm oil dairy product MCT oil provides feeling fullness added food release two kind hormone body peptide YY leptin consists fewer calorie comparison oil olive oil avocado nut best converting ketone also good gut Keto advanced weight loss supplement help stay ketosis longer period time may lead weight loss also contain important mineral magnesium sodium found supplement Keto pill cheap best part eat anywhere they’re easy carry Supplements Work supplement make easier body enter ketosis faster using fat form energy instead carbs burning cause lose weight quickly Keto weight loss capsule help achieve state process faster compared keto diet help boosting metabolism burning calorie even rest Taking Keto weight loss pill keto diet help achieve weight loss goal faster keto diet alone Farmity Keto Capsules Weight Loss Keto capsule weight loss product provide ingredient help fat burning decrease appetite allowing burn calorie maintaining mental wellbeing improved state It’s perfect anyone looking healthy way improve physical appearance controlling craving day long uniquely powerful patentpending formula highest grade natural ingredient organic vegetarian glutenfree dairyfree GMOfree use capsule anytime need burst energy mental clarity Benefits Using Keto Weight Management Pill Increases Metabolism farmity keto capsule excellent way increase metabolism lose weight contains Garcinia Cambogia green tea extract work together appetite suppressant limiting intake unhealthy fat capsule shown study one effective way people looking cutting calorie maintaining current diet still enjoying wellbalanced nutrition plan keep energized throughout day’s activity Reduces Overall Body Fat Farmity keto capsule perfect way ensure maintain weight avoid craving product help combat pesky food temptation often lead people unhealthy lifestyle turn cause additional stress top already hectic daily schedule key ingredient allnatural fruit artificial color flavor — clean eating goodness without harmful chemical added taste good better anything else today Fights Carbohydrates Farmity keto capsule fight carbohydrate enemy weight loss Carbs stimulate appetite slow fat burning also raising blood sugar level Improves Mental Health Farmity keto capsule designed improve mental health provide sense calm ingredient Farmity Keto include green tea green coffee bean shown effective anxiety relief garcinia powder extract help boost energy level also improving focus Study suggested green tea consumption increase dopamine serotonin linked reducing symptom depression Ingredients Present Farmity Keto Capsules Garcinia Cambogia best effective ingredient supplement help losing several pound weight one week Green Tea Extract work metabolic rate also increase energy level Green Coffee Beans may also promote blood sugar regulation improve health marker blood pressure cholesterol provide antioxidant MCT Powder Consuming MCTs help reduce overall intake calorie throughout day Conjugated Linoleic Acid also popular dietary supplement helping people maintain weight retain lean muscle mass control type 2 diabetes Directions Safety Pregnant lactating female strictly avoid using keto capsule Children age 18 year take supplement physician advice Patients known medical ailment ie kidney liver cardiac disorder take supplement physician advice Farmity Keto capsule prohibited woman hormonal imbalance like breast cancer ovarian cancer etc Two Capsules daily breakfast glass warm water lemon water Also take proper ketofriendly diet exercise daily Buy Best Keto Supplement India Buy best Farmity Keto Advanced Weight Loss Supplement India online Amazon Flipkart best price enjoy amazing shipping service convenient payment method Avail incredible health benefit taking Keto weight loss capsule woman menTags Ketogenic Diet Ketogenic Keto Ketosis Keto Diet
|
187,969 |
Lose Weight & Feel Great
|
With The Smart Keto Lifestyle
Keto Smart is an all-in-one keto guide that teaches you how to lose weight and feel great.
The keto diet has never been more popular. Keto Smart introduces you to the keto diet and how it works, then gives you actionable advice on following the keto diet.
Is Keto Smart worth the price? What will you learn in Keto Smart? Find out everything you need to know about this diet guide today in our review.
What is Keto Smart?
Keto Smart is a keto diet guide sold exclusively online through GetKetogenicSmart.com.
The diet guide contains comprehensive advice on following the keto diet, losing weight with keto, and eating the best keto foods.
Priced at $45, Keto Smart is entirely digital. You receive instant access to the guide and all bonus materials as soon as the website processes your payment. You can start your keto diet immediately and begin losing a significant amount of weight.
The keto diet, for those out of the loop, is a high-fat, low-carb diet. The diet has existed for decades, but it has become particularly popular in recent years. Today, many people have lost significant amounts of weight while following the keto diet — including people who have had limited success with other diets.
What Will You Learn in Keto Smart?
Keto Smart teaches you everything you need to know to begin the keto diet, follow the keto diet, and lose weight through the keto diet.
The guide contains recipes, scientific evidence, weight loss tips, and practical strategies. There are also exercise guides, shopping lists, and other information.
All of this information is delivered in PDF format. You can read Keto Smart on any internet-connected device. Once you buy the guide, it’s yours to use however you like.
Some of the core features of Keto Smart include:
Weight loss tips
Healthy keto tips
How to start, stay, and live the keto diet
How to maximize the health benefits of the keto diet, including the fat burning, weight loss, and energy benefits linked to the keto diet
What to eat when following the keto diet, including keto-friendly breakfasts, lunches, dinners, and desserts anyone can make at home
Overall, the makers of Keto Smart describe their eBook as “the most comprehensive yet crisp resource for helping you start, stay on & follow a keto lifestyle,” giving you the weight loss results you deserve.
Keto Smart Recipes
This bonus eBook includes 25 top-rated keto recipes, including ice cream, cheesecake, and other tasty foods you would not normally eat while following a diet. Keto Smart Recipes includes shopping lists, step-by-step recipe guides, ketosis-boosting meals, and more.
Here’s what you’ll learn inside Keto Smart Recipes:
All-day keto meal plans
In-depth preparation guide
Storage and re-use instructions
Nutritional info per serving
Everything you need to make keto-friendly breakfasts, lunches, dinners, and desserts
Just like the core Keto Smart Guide, Keto Smart Recipes delivers all of this information in easy-to-read PDF format.
Email: [email protected]
Final Word
Keto Smart is a diet, and recipe guide sold online through GetKetogenicSmart.com. The guide comes in the form of two eBooks for $45.
By buying Keto Smart today, you can discover all the information you need to start the keto diet, start making keto recipes, and begin losing weight with keto diet strategies. The guide contains practical tips for anyone new to the keto diet.
Keto Smart contains information to what you can find for free online, and the book does not seem to be written by doctors, nutritionists, or anyone with unique insight into keto dieting.
However, Keto Smart is backed by a 60-day refund policy. You can request a complete refund within 60 days if you’re unhappy with Keto Smart for any reason — and you don’t even need to return the eBooks to qualify for a refund.
(CLICK HERE) To Receive Keto Smart with an Exclusive Discount Price from GetKetogenicSmart.com
|
https://medium.com/@Fitness.health/lose-weight-feel-great-7f9659035dd0
|
['Patrick Vinchee']
|
2021-12-26 16:41:01.891000+00:00
|
['Diet', 'Health', 'Fitness', 'Keto', 'Lose Weight']
|
Title Lose Weight Feel GreatContent Smart Keto Lifestyle Keto Smart allinone keto guide teach lose weight feel great keto diet never popular Keto Smart introduces keto diet work give actionable advice following keto diet Keto Smart worth price learn Keto Smart Find everything need know diet guide today review Keto Smart Keto Smart keto diet guide sold exclusively online GetKetogenicSmartcom diet guide contains comprehensive advice following keto diet losing weight keto eating best keto food Priced 45 Keto Smart entirely digital receive instant access guide bonus material soon website process payment start keto diet immediately begin losing significant amount weight keto diet loop highfat lowcarb diet diet existed decade become particularly popular recent year Today many people lost significant amount weight following keto diet — including people limited success diet Learn Keto Smart Keto Smart teach everything need know begin keto diet follow keto diet lose weight keto diet guide contains recipe scientific evidence weight loss tip practical strategy also exercise guide shopping list information information delivered PDF format read Keto Smart internetconnected device buy guide it’s use however like core feature Keto Smart include Weight loss tip Healthy keto tip start stay live keto diet maximize health benefit keto diet including fat burning weight loss energy benefit linked keto diet eat following keto diet including ketofriendly breakfast lunch dinner dessert anyone make home Overall maker Keto Smart describe eBook “the comprehensive yet crisp resource helping start stay follow keto lifestyle” giving weight loss result deserve Keto Smart Recipes bonus eBook includes 25 toprated keto recipe including ice cream cheesecake tasty food would normally eat following diet Keto Smart Recipes includes shopping list stepbystep recipe guide ketosisboosting meal Here’s you’ll learn inside Keto Smart Recipes Allday keto meal plan Indepth preparation guide Storage reuse instruction Nutritional info per serving Everything need make ketofriendly breakfast lunch dinner dessert like core Keto Smart Guide Keto Smart Recipes delivers information easytoread PDF format Email supportketogenicsmartcom Final Word Keto Smart diet recipe guide sold online GetKetogenicSmartcom guide come form two eBooks 45 buying Keto Smart today discover information need start keto diet start making keto recipe begin losing weight keto diet strategy guide contains practical tip anyone new keto diet Keto Smart contains information find free online book seem written doctor nutritionist anyone unique insight keto dieting However Keto Smart backed 60day refund policy request complete refund within 60 day you’re unhappy Keto Smart reason — don’t even need return eBooks qualify refund CLICK Receive Keto Smart Exclusive Discount Price GetKetogenicSmartcomTags Diet Health Fitness Keto Lose Weight
|
187,970 |
The ultimate list of keto diet do’s and dont’s
|
If you’re talking about dieting or losing weight, you’ll almost obviously come across the ketogenic, or keto, diet.
That’s because the keto diet has become one of the most popular ways to lose weight and improve health around the world.
According to studies, adopting this low-carb, high-fat diet can help you lose weight and even improve illnesses like type 2 diabetes and cognitive decline.
This article discusses what foods to consume and avoid on the keto diet, as well as a eight week keto meal plan to get you started.
Here’s what you might know about the do’s and don’ts of the Keto Diet.
Foods to Eat here on Keto Diet:
Keto-Friendly Foods
These foods are ideal for a low-carb diet.
Fruits
When adopting a keto diet, you should limit your intake of fruits that are high in sugars or carbohydrates. Organic berries and avocados (yes, they’re fruit!) are fantastic on a keto diet, but keep your berry intake minimal to prevent ingesting too many sugars.
Vegetables
We don’t usually think of veggies as high-glycemic foods, but there are some that are, as well as some that are low glycemic. Here are a few examples of low-glycemic vegetables:
Broccoli
Summer squash
Zucchini
Cauliflower
Brussels sprouts
Celery
Cucumbers
Asparagus
Mushrooms
Cabbage
Lettuce
Artichokes
Bell peppers
Eggplant
Onions
Leafy greens, like arugula, kale, and spinach
Olives (not overly processed)
Because carbs break down during cooking, the longer veggies are cooked, the higher their glycemic index. That is why cooked veggies like onions and beets get sweeter.
Fats
Despite the fact that keto foods are heavy in fat, not all fats are created equal. It is beneficial to examine labels to verify that fats are of excellent quality, such as the following:
Avocado oil
Grass-fed ghee or butter
Extra virgin olive oil
MCT oil (medium-chain triglycerides)
Virgin coconut oil
Pasture-raised egg yolk
Bacon fat (no-sugar-added bacon)
Protein
High fat consumption is one of the features of current keto diets, not necessarily high protein consumption, therefore protein does not need to make up the majority of your diet. Around 20% protein is a reasonable starting point for the keto diet, but this may vary based on your own goals.
Consider consuming meat pieces with natural fat levels rather to those that have been trimmed or treated to remove fat. Also, make sure all of your meats are grass-fed, including organ meats, eggs, dark-meat chicken, and beef. High-quality salmon and other fatty fish are also good sources of protein, but watch your portion size.
Legumes, Nuts and Seeds
Legumes, nuts, and seeds are carefully avoided on a keto diet. You can include small amounts of raw nuts, such as almonds, cashews, and walnuts, as well as their flours, but be mindful of your intake. Coconut is a fantastic keto food that can be enjoyed in a variety of ways (coconut flour pancakes, anyone?).
Condiments
Avoiding processed condiments is one of the most difficult aspects of transitioning to a keto diet. Everything from ketchup to salad dressing contains filler ingredients and sugars that will not induce ketosis in your body.
Fortunately, there are a plethora of delicious garnishing options for keto foods. Here are a few examples:
*Apple cider vinegar (ACV): Excellent for salad dressings and other uses.
*Coconut aminos are an excellent substitute for soy sauce, teriyaki sauce, and salad dressings. It’s lightly sweet and goes well with foods that benefit from extra seasoning, such as cauliflower rice.
*Spices: Most fresh herbs and spices can be enjoyed on a regular basis. Use salt sparingly, as with any healthy diet.
Do you want to try a keto-friendly meal? For lunch, try a salad with bitter arugula greens, a hard-boiled egg, avocado, olives, free-range grilled chicken or grass-fed steak, and a delicious homemade dressing.
Foods to Avoid
It’s important to know what you can eat on a keto diet, but it’s also vital to know what you should avoid, especially some common foods you might not think of.
Fruits
|
https://medium.com/@ksuneelkumarreddy1/the-ultimate-list-of-keto-diet-dos-and-dont-s-404d04b5264b
|
['K Suneel Kumar Reddy']
|
2021-12-31 14:17:15.754000+00:00
|
['Ketogenic Diet', 'Weight Loss', 'Fitness', 'Keto', 'Keto Diet']
|
Title ultimate list keto diet do’s dont’sContent you’re talking dieting losing weight you’ll almost obviously come across ketogenic keto diet That’s keto diet become one popular way lose weight improve health around world According study adopting lowcarb highfat diet help lose weight even improve illness like type 2 diabetes cognitive decline article discus food consume avoid keto diet well eight week keto meal plan get started Here’s might know do’s don’ts Keto Diet Foods Eat Keto Diet KetoFriendly Foods food ideal lowcarb diet Fruits adopting keto diet limit intake fruit high sugar carbohydrate Organic berry avocado yes they’re fruit fantastic keto diet keep berry intake minimal prevent ingesting many sugar Vegetables don’t usually think veggie highglycemic food well low glycemic example lowglycemic vegetable Broccoli Summer squash Zucchini Cauliflower Brussels sprout Celery Cucumbers Asparagus Mushrooms Cabbage Lettuce Artichokes Bell pepper Eggplant Onions Leafy green like arugula kale spinach Olives overly processed carbs break cooking longer veggie cooked higher glycemic index cooked veggie like onion beet get sweeter Fats Despite fact keto food heavy fat fat created equal beneficial examine label verify fat excellent quality following Avocado oil Grassfed ghee butter Extra virgin olive oil MCT oil mediumchain triglyceride Virgin coconut oil Pastureraised egg yolk Bacon fat nosugaradded bacon Protein High fat consumption one feature current keto diet necessarily high protein consumption therefore protein need make majority diet Around 20 protein reasonable starting point keto diet may vary based goal Consider consuming meat piece natural fat level rather trimmed treated remove fat Also make sure meat grassfed including organ meat egg darkmeat chicken beef Highquality salmon fatty fish also good source protein watch portion size Legumes Nuts Seeds Legumes nut seed carefully avoided keto diet include small amount raw nut almond cashew walnut well flour mindful intake Coconut fantastic keto food enjoyed variety way coconut flour pancake anyone Condiments Avoiding processed condiment one difficult aspect transitioning keto diet Everything ketchup salad dressing contains filler ingredient sugar induce ketosis body Fortunately plethora delicious garnishing option keto food example Apple cider vinegar ACV Excellent salad dressing us Coconut amino excellent substitute soy sauce teriyaki sauce salad dressing It’s lightly sweet go well food benefit extra seasoning cauliflower rice Spices fresh herb spice enjoyed regular basis Use salt sparingly healthy diet want try ketofriendly meal lunch try salad bitter arugula green hardboiled egg avocado olive freerange grilled chicken grassfed steak delicious homemade dressing Foods Avoid It’s important know eat keto diet it’s also vital know avoid especially common food might think FruitsTags Ketogenic Diet Weight Loss Fitness Keto Keto Diet
|
187,971 |
5 Keto Tips for Beginners
|
Starting a new diet is never easy. While making your health a priority is a worthy goal, it can get overwhelming at times especially on Keto where you might have to deal with the symptoms of the dreaded Keto flu. With these five Keto tips for beginners, you’ll be able to kick-start your health journey in the best way possible.
What is the Keto Diet?
Before diving into these easy Keto tips for beginners, we should discuss what exactly the Keto diet is. Without getting too technical, the Ketogenic or the “Keto” diet is a high-fat, high-protein, low-carb diet.
The reason it’s called the Ketogenic diet is because after eating like this, your body will enter a state called ketosis where your body will start making ketones to use in place of the missing carbs.
People on the Keto diet often notice significant weight loss, a curbed appetite, increased energy, and even lowered blood pressure! These five tips will make jump starting your keto diet a breeze.
1. Avoid Dirty Keto
There is a right way to do the Keto diet, and there is a wrong way. The wrong way is known as dirty Keto. What do we mean by that? Well, we’re talking lots of butter and cheese. Instead of using your daily carbs on nutrient dense veggies, you use it for a sugary treat. You pound diet sodas, and you often find yourself in the drive-thru ordering a cheeseburger with no bun.
The best way to avoid this situation is by planning. Make a list of the healthy fats you should be eating every day (avocados, nuts, olive oil, chia seeds) and have them handy! Plan out your carbs, and expect them to come from low-sugar fruits and leafy greens.
2. Incorporate Exercise
The first few days of this diet can be tough, especially if you’re experiencing symptoms like nausea, dizziness, and weakness. Don’t opt for your normal soul cycle class or hit the weights at the gym. Instead try to incorporate a little light exercise into your daily routine like walking or some gentle yoga.
This exercise can contribute to a quicker transition by aiding your body in burning through your glycogen stores. Once you’re fully in ketosis, you can amp up your exercise again. You might notice that you actually have more energy during your workouts than you did before!
3. Prep Your Body
Switching from a high carbohydrate diet to a high fat diet can be a shock on your body. Jumping right into it can be a sure fire way to feel the full wrath of the Keto flu.
Prep your body by incorporating more fat up to seven days before the diet. Start eating avocado or including more olive oil in your daily meals. This will make the transition a lot easier, and it will successfully prepare your digestive system, liver, and gallbladder for the adjustment.
4. Get Some Sleep
Study after study has shown that the quantity and quality of your sleep affects how much weight you’ll lose! The best way to kick-start this diet is by simply getting some good shut eye.
But sure, get enough sleep? That’s a lot easier said than done. The Centres for Disease Control estimates that 1/3 of Americans are sleep deprived. A healthy adult should be getting 7–9 hours, but who the heck has time for that?!
It’s up to you to make the time, and you will because it’s important. A few ways to get better sleep are by putting down all screens one hour before bed, making sure your room is completely dark and at a temperature of around 65°F, and by sticking to a schedule.
Pick a time to always go to bed and wake up. If this is something like 10pm to 6am, ALWAYS do it, even on the weekends.
5. Don’t Give Up!
Stick to this diet for a minimum of four weeks to see the real benefits. It can be hard when you have the Keto flu in the beginning, but know that it doesn’t last forever.
This diet in particular requires a certain amount of time because your body has to fully become Keto adapted. You might even find that you have to adjust the amount of carbs and fat you consume. You might need 5% of your calories from carbs… or you might actually need 10%! It’s important to listen to your body and make changes as needed. Click here to access the Keto recipes guide for beginners!!
|
https://medium.com/@raphaelpaul.853/5-keto-tips-for-beginners-45e754c9ddca
|
['Robert K. Ncube']
|
2021-12-14 21:52:25.862000+00:00
|
['Weight Loss', 'Vegan', 'Fitness', 'Keto', 'Keto Diet']
|
Title 5 Keto Tips BeginnersContent Starting new diet never easy making health priority worthy goal get overwhelming time especially Keto might deal symptom dreaded Keto flu five Keto tip beginner you’ll able kickstart health journey best way possible Keto Diet diving easy Keto tip beginner discus exactly Keto diet Without getting technical Ketogenic “Keto” diet highfat highprotein lowcarb diet reason it’s called Ketogenic diet eating like body enter state called ketosis body start making ketone use place missing carbs People Keto diet often notice significant weight loss curbed appetite increased energy even lowered blood pressure five tip make jump starting keto diet breeze 1 Avoid Dirty Keto right way Keto diet wrong way wrong way known dirty Keto mean Well we’re talking lot butter cheese Instead using daily carbs nutrient dense veggie use sugary treat pound diet soda often find drivethru ordering cheeseburger bun best way avoid situation planning Make list healthy fat eating every day avocado nut olive oil chia seed handy Plan carbs expect come lowsugar fruit leafy green 2 Incorporate Exercise first day diet tough especially you’re experiencing symptom like nausea dizziness weakness Don’t opt normal soul cycle class hit weight gym Instead try incorporate little light exercise daily routine like walking gentle yoga exercise contribute quicker transition aiding body burning glycogen store you’re fully ketosis amp exercise might notice actually energy workout 3 Prep Body Switching high carbohydrate diet high fat diet shock body Jumping right sure fire way feel full wrath Keto flu Prep body incorporating fat seven day diet Start eating avocado including olive oil daily meal make transition lot easier successfully prepare digestive system liver gallbladder adjustment 4 Get Sleep Study study shown quantity quality sleep affect much weight you’ll lose best way kickstart diet simply getting good shut eye sure get enough sleep That’s lot easier said done Centres Disease Control estimate 13 Americans sleep deprived healthy adult getting 7–9 hour heck time It’s make time it’s important way get better sleep putting screen one hour bed making sure room completely dark temperature around 65°F sticking schedule Pick time always go bed wake something like 10pm 6am ALWAYS even weekend 5 Don’t Give Stick diet minimum four week see real benefit hard Keto flu beginning know doesn’t last forever diet particular requires certain amount time body fully become Keto adapted might even find adjust amount carbs fat consume might need 5 calorie carbs… might actually need 10 It’s important listen body make change needed Click access Keto recipe guide beginnersTags Weight Loss Vegan Fitness Keto Keto Diet
|
187,972 |
KETO ACTIVES : THE BEST SUPPLEMENT FOR WEIGHT MANAGEMENT 2021
|
Keto Actives is a food supplement supporting weight loss. We specifically recommend it to those on the ketogenic diet. It contains 8 components combined in one foolproof supplement, which helps in the reduction of fatty tissue and stops its storage. Moreover, Keto Actives helps in maintaining the proper cholesterol and sugar blood levels. The supplement is also recommended for those persons with an excessive appetite, as the extracts and minerals included in it suppress hunger.
Keto Actives boosts energy, increases stamina and concentration, thanks to which it is very effective in the period of adapting to ketosis. When using the capsules in addition to the diet, the first effects will be visible in just a few weeks.
KETO ACTIVES :
Recommended for people on a keto diet,
Supports the metabolism and storage reduction of fats,
Reduces snacking urges and sudden hunger attacks,
Provides energy for training.
Keto Actives is a modern dietary supplement that helps you lose weight even when it comes to the most difficult parts of your body. It may get you in shape and is guaranteed to make you feel better!
You’ll lose weight from your waist! As much as a few centimetres per month!
You have more energy for your daily exercises!
You can go on a healthy diet without making sacrifices!
Your body opts for nutritional ketosis!
100% Natural Ingredients!
ForsLean® - Indian nettle root extract [10% forskolin] - acting as a non-adrenal adenylyl cyclase stimulator, it promotes the breaking up of fats. Studies have shown the supportive role of forskolin in reducing body fat and maintaining lean body mass. After 12 weeks of 250 mg of ForsLean® subjects saw a significant decrease in body weight and fat content and a significant increase in lean body mass compared to a placebo.
Clarinol®, conjugated linoleic acid (CLA) - linoleic acid (LA) helps maintain normal blood cholesterol levels. Studies have shown that CLA accelerates fat burning in obese people; it likewise supports slimming of the legs and reduces the waist to hip ratio. Research has shown that adding CLA as a supplement is enough to see positive changes that are independent of a diet and exercise regimen.
Natural anhydrous caffeine - increases concentration and endurance, and also minimises fatigue after physical activity.
Bitter orange fruit extract - promotes lipid metabolism and weight control. Use impacts digestive system function.
Black pepper fruit extract - supports the secretion of digestive juices, increases the absorption of nutrients, regulates bowel movements.
Ashwagandha root extract - helps control weight, has a beneficial effect on energy levels.
Capsicum extract - enables weight management and provides an ideal equilibrium for the digestive system.
Chromium - maintains normal blood glucose levels, affects the metabolism of macro-nutrients.
Take advantage of the power of the keto diet and ketones and grab KETO ACTIVES!
|
https://medium.com/@diab.marketing21/keto-actives-the-best-supplement-for-weight-management-2021-6d97e39035ad
|
['Nutri Profits']
|
2021-12-24 14:05:46.111000+00:00
|
['Keto Supplement', 'Keto Diet For Weight Loss', 'Keto', 'Keto Actives', 'Keto Diet']
|
Title KETO ACTIVES BEST SUPPLEMENT WEIGHT MANAGEMENT 2021Content Keto Actives food supplement supporting weight loss specifically recommend ketogenic diet contains 8 component combined one foolproof supplement help reduction fatty tissue stop storage Moreover Keto Actives help maintaining proper cholesterol sugar blood level supplement also recommended person excessive appetite extract mineral included suppress hunger Keto Actives boost energy increase stamen concentration thanks effective period adapting ketosis using capsule addition diet first effect visible week KETO ACTIVES Recommended people keto diet Supports metabolism storage reduction fat Reduces snacking urge sudden hunger attack Provides energy training Keto Actives modern dietary supplement help lose weight even come difficult part body may get shape guaranteed make feel better You’ll lose weight waist much centimetre per month energy daily exercise go healthy diet without making sacrifice body opts nutritional ketosis 100 Natural Ingredients ForsLean® Indian nettle root extract 10 forskolin acting nonadrenal adenylyl cyclase stimulator promotes breaking fat Studies shown supportive role forskolin reducing body fat maintaining lean body mass 12 week 250 mg ForsLean® subject saw significant decrease body weight fat content significant increase lean body mass compared placebo Clarinol® conjugated linoleic acid CLA linoleic acid LA help maintain normal blood cholesterol level Studies shown CLA accelerates fat burning obese people likewise support slimming leg reduces waist hip ratio Research shown adding CLA supplement enough see positive change independent diet exercise regimen Natural anhydrous caffeine increase concentration endurance also minimises fatigue physical activity Bitter orange fruit extract promotes lipid metabolism weight control Use impact digestive system function Black pepper fruit extract support secretion digestive juice increase absorption nutrient regulates bowel movement Ashwagandha root extract help control weight beneficial effect energy level Capsicum extract enables weight management provides ideal equilibrium digestive system Chromium maintains normal blood glucose level affect metabolism macronutrients Take advantage power keto diet ketone grab KETO ACTIVESTags Keto Supplement Keto Diet Weight Loss Keto Keto Actives Keto Diet
|
187,973 |
The Keto Diet Can Help You Obtain (and maintain!) A Healthy Weight !
|
The keto diet is excellent for losing fat and keeping it off. For example, a meta-analysis of 13 randomized controlled trials concluded that:
“Individuals assigned to a VLCKD [very low carbohydrate ketogenic diet] achieve a greater weight loss than those assigned to an LFD [low-fat diet] in the long term; hence, a VLCKD may be an alternative tool against obesity.
What’s more, randomized controlled trials found that the keto diet produces up to three times as much weight loss as a high-carb, low-fat diet.[2-3]
In other words, if you want to lean down but are sick and tired of failing your weight loss attempts, the keto diet may be the key to a slim figure.
Read More Information Click Here My Official Website
the keto diet boosts brain function
When going keto, most people experience an improvement in their brain function and mental clarity.
The keto diet supports your brain in various ways and for various reasons. A major reason is that ketosis enhances mitochondrial functioning. [6]
Researchers believe ketosis stimulates the formation of new mitochondria in your brain, especially in your hippocampus. [7] This aids your mental clarity, memory, and energy levels.
the keto diet can help manage or even reverse diabetes
Many studies show minimizing carb intake benefits people with diabetes. In fact, the keto diet was the standard diabetes treatment before the discovery of injectable insulin.
Consider the following:
Research published in Annals of Internal Medicine found that when type 2 diabetics went low-carb for two weeks, they improved insulin sensitivity by up to 75%.
And another study involving 21 individuals with type 2 diabetes found that seven of them could stop their diabetes medication within 16 weeks of going keto.
Proof you can quickly transform your body
If you’re like most people, you’re at least tickled by the idea of being able to walk around with a lean figure that turns heads wherever you go.
Now, I’m not saying this custom meal plan will sculpt your body into the best shape of your life overnight. It takes time and effort to lose fat and “tone up” your body.
But I will say that they’ve designed this custom meal plan service to help men and women all over the world turn their lives around and take charge of their health and figure.
To show how effective the meal plans are, here's what real clients have to say:
“As of today I've lost 35 pounds, I have no hunger pangs and mentally I feel sharp as a pin. This is definitely going to become a 'way of life' for me as it's so easy to follow…
“All my meals are planned out for me and I even get a downloadable shopping list with all the ingredients I need for the weekly shop so it really is a doddle.”
–Katy Thompson, UK
“I'm 4 weeks into my custom keto diet plan and I've lost 14 pounds which I must say is pretty incredible, it's actually amazing watching my body transform into something I am actually proud of rather than something I have always tried to cover up.”
Here’s exactly what you’ll get with your custom keto meal plan
Do you want to lose weight but can't seem to create a long-lasting change?
Have you read books and articles and watched videos on how to follow a keto diet, but aren't sure how to put all the pieces together?
Or do you know how to follow a keto diet, but struggle with following through due to a lack of structure?
I get it!
While it sounds simple to follow and succeed on a keto diet, it’s not easy. It takes effort, it takes grit, and it takes preparation.
As you’d expect, this isn’t your run-of-the-mill “here are some recipes brought together from random blogs” meal plan many nutrition ‘gurus’ sell for way too much money.
Instead, we’ll provide you with all the tools you need to reach your ideal body weight and health goals in an effective, convenient, cost-efficient, and enjoyable manner.
|
https://medium.com/@sumanmaketr9335/the-keto-diet-can-help-you-obtain-and-maintain-a-healthy-weight-6fcb7ec92170
|
['Suman Bharti']
|
2021-12-27 14:14:04.322000+00:00
|
['Diet', 'Belly Fat', 'Weight Loss', 'Fat Loss', 'Keto']
|
Title Keto Diet Help Obtain maintain Healthy Weight Content keto diet excellent losing fat keeping example metaanalysis 13 randomized controlled trial concluded “Individuals assigned VLCKD low carbohydrate ketogenic diet achieve greater weight loss assigned LFD lowfat diet long term hence VLCKD may alternative tool obesity What’s randomized controlled trial found keto diet produce three time much weight loss highcarb lowfat diet23 word want lean sick tired failing weight loss attempt keto diet may key slim figure Read Information Click Official Website keto diet boost brain function going keto people experience improvement brain function mental clarity keto diet support brain various way various reason major reason ketosis enhances mitochondrial functioning 6 Researchers believe ketosis stimulates formation new mitochondrion brain especially hippocampus 7 aid mental clarity memory energy level keto diet help manage even reverse diabetes Many study show minimizing carb intake benefit people diabetes fact keto diet standard diabetes treatment discovery injectable insulin Consider following Research published Annals Internal Medicine found type 2 diabetic went lowcarb two week improved insulin sensitivity 75 another study involving 21 individual type 2 diabetes found seven could stop diabetes medication within 16 week going keto Proof quickly transform body you’re like people you’re least tickled idea able walk around lean figure turn head wherever go I’m saying custom meal plan sculpt body best shape life overnight take time effort lose fat “tone up” body say they’ve designed custom meal plan service help men woman world turn life around take charge health figure show effective meal plan here real client say “As today Ive lost 35 pound hunger pang mentally feel sharp pin definitely going become way life easy follow… “All meal planned even get downloadable shopping list ingredient need weekly shop really doddle” –Katy Thompson UK “Im 4 week custom keto diet plan Ive lost 14 pound must say pretty incredible actually amazing watching body transform something actually proud rather something always tried cover up” Here’s exactly you’ll get custom keto meal plan want lose weight cant seem create longlasting change read book article watched video follow keto diet arent sure put piece together know follow keto diet struggle following due lack structure get sound simple follow succeed keto diet it’s easy take effort take grit take preparation you’d expect isn’t runofthemill “here recipe brought together random blogs” meal plan many nutrition ‘gurus’ sell way much money Instead we’ll provide tool need reach ideal body weight health goal effective convenient costefficient enjoyable mannerTags Diet Belly Fat Weight Loss Fat Loss Keto
|
187,974 |
Keto Diet: How to Stay on the Ketogenic Diet and Not Lose Your Mind.
|
Herbed Balsamic Chicken
The ketogenic diet has become the go-to diet for weight loss and general health. This is because it is rich in healthy fats that are known to be beneficial for cardiovascular health, while also being low in carbs that are linked to diabetes, obesity, and high blood pressure.
It’s no surprise that this diet has taken off so quickly. However, sticking to the keto diet can be difficult!
The most common side effects of the keto diet include feeling hungry or tired. There are many foods on the keto diet that people may not enjoy eating. In addition, sticking to a strict schedule can make it hard to socialize with friends or eat out with coworkers.
To make your experience with the keto diet less frustrating, read on for tips from experts about how you can stay on the keto diet without losing your mind!
Get My Free Cookbook Showing You The Best 21 Keto Recipes You Need To Try!
How to Stay on the Keto Diet
There are many ways to make your keto diet more enjoyable. The first is to find keto-friendly recipes that are delicious.
Lots of people find the keto diet easier when they have delicious, pre-made food options.
If you don’t like eating eggs for breakfast, try making a keto omelette with mushrooms, bacon or ham, and cheese. It’s much more appetizing than eggs, and this will help you stick to the keto diet!
Another way to avoid feeling hungry is by eating snacks between meals. For example, if you’re craving something sweet after lunch but don’t want to break your diet, try eating some berries or an avocado with cinnamon instead of cake. This will satisfy your sweet tooth without breaking your ketosis!
Brussels Sprouts with Garlic & Goat Cheese
Get My Free Cookbook Showing You The Best 21 Keto Recipes You Need To Try!
Staying Motivated with the Ketogenic Diet
Motivation is key to sticking with any diet, but it can be especially difficult when following the keto diet.
Whether you are trying to lose weight or just stay healthy, don’t give up! There are ways to make staying motivated easier.
First, remember why you wanted to try the keto diet in the first place. The keto diet is not only good for weight loss, but it also has many other health benefits — it’s heart-healthy and has been shown to lower blood pressure. It also provides a lot of energy and makes people feel more focused. So remember your goal!
Another way to stay motivated on the keto diet is by being creative with your food options — there are lots of delicious foods that are low in carbs or high in fat that will keep you satisfied while meeting your nutritional needs. And if you’re busy or traveling, there are plenty of apps that provide keto-friendly meal plans and recipes at your fingertips!
The ketogenic diet can be hard at times, but with these tips from experts, hopefully it won’t seem so challenging anymore!
Get My Free Cookbook Showing You The Best 21 Keto Recipes You Need To Try!
What to Expect From the Keto Diet
The keto diet is a high-fat, low-carbohydrate diet that includes a significant amount of protein. If you’ve been wondering what to expect from the keto diet, here are a few things you should know:
The keto diet can help with weight loss by reducing your cravings for carbs and sugar.
The keto diet forces you to eat less calories each day because it’s difficult to overeat on high-quality fats.
You will likely experience an increase in energy because the keto diet provides more fatty acids and decreases carbs which can lead to lethargy.
How to Find Recipes for the Keto Diet
It can be difficult to continually eat the same foods from day to day. That’s why it’s a good idea to have a variety of recipes that you enjoy for keto.
The internet is full of keto recipes that are easy and tasty, so feel free to search for ones that you’ll enjoy!
If you’re looking for keto-friendly desserts, there are plenty of options. For instance, you can make a peanut butter chocolate fat bomb or a low carb raspberry cheesecake.
If you want something quick and simple, try making some chicken lettuce wraps or one of our favorite lunch ideas: Low Carb Tuna Sandwich.
Get My Free Cookbook Showing You The Best 21 Keto Recipes You Need To Try!
Conclusion
The ketogenic diet can be hard to maintain mentally, but with these steps you’ll be able to stay keto and not lose your mind.
The first step is to commit to the diet for at least 30 days. This is key to getting the body used to ketosis which is what makes it work. Once your body is used to ketosis, your cravings will subside and you won’t feel as terrible.
The next step is to find recipes that are designed for the keto diet. These can be found online or in cookbooks.
The final step is to stay motivated. The first week or two of the diet will be the hardest but once you get past this, it becomes much easier. You can do this!
|
https://medium.com/@yanis.chilla1/keto-diet-how-to-stay-on-the-ketogenic-diet-and-not-lose-your-mind-2ca1654d74d4
|
['Anis Chilla']
|
2021-12-27 01:40:43.589000+00:00
|
['Ketogenic Diet', 'Healthy Foods', 'Healthy Lifestyle', 'Keto', 'Lose Weight']
|
Title Keto Diet Stay Ketogenic Diet Lose MindContent Herbed Balsamic Chicken ketogenic diet become goto diet weight loss general health rich healthy fat known beneficial cardiovascular health also low carbs linked diabetes obesity high blood pressure It’s surprise diet taken quickly However sticking keto diet difficult common side effect keto diet include feeling hungry tired many food keto diet people may enjoy eating addition sticking strict schedule make hard socialize friend eat coworkers make experience keto diet le frustrating read tip expert stay keto diet without losing mind Get Free Cookbook Showing Best 21 Keto Recipes Need Try Stay Keto Diet many way make keto diet enjoyable first find ketofriendly recipe delicious Lots people find keto diet easier delicious premade food option don’t like eating egg breakfast try making keto omelette mushroom bacon ham cheese It’s much appetizing egg help stick keto diet Another way avoid feeling hungry eating snack meal example you’re craving something sweet lunch don’t want break diet try eating berry avocado cinnamon instead cake satisfy sweet tooth without breaking ketosis Brussels Sprouts Garlic Goat Cheese Get Free Cookbook Showing Best 21 Keto Recipes Need Try Staying Motivated Ketogenic Diet Motivation key sticking diet especially difficult following keto diet Whether trying lose weight stay healthy don’t give way make staying motivated easier First remember wanted try keto diet first place keto diet good weight loss also many health benefit — it’s hearthealthy shown lower blood pressure also provides lot energy make people feel focused remember goal Another way stay motivated keto diet creative food option — lot delicious food low carbs high fat keep satisfied meeting nutritional need you’re busy traveling plenty apps provide ketofriendly meal plan recipe fingertip ketogenic diet hard time tip expert hopefully won’t seem challenging anymore Get Free Cookbook Showing Best 21 Keto Recipes Need Try Expect Keto Diet keto diet highfat lowcarbohydrate diet includes significant amount protein you’ve wondering expect keto diet thing know keto diet help weight loss reducing craving carbs sugar keto diet force eat le calorie day it’s difficult overeat highquality fat likely experience increase energy keto diet provides fatty acid decrease carbs lead lethargy Find Recipes Keto Diet difficult continually eat food day day That’s it’s good idea variety recipe enjoy keto internet full keto recipe easy tasty feel free search one you’ll enjoy you’re looking ketofriendly dessert plenty option instance make peanut butter chocolate fat bomb low carb raspberry cheesecake want something quick simple try making chicken lettuce wrap one favorite lunch idea Low Carb Tuna Sandwich Get Free Cookbook Showing Best 21 Keto Recipes Need Try Conclusion ketogenic diet hard maintain mentally step you’ll able stay keto lose mind first step commit diet least 30 day key getting body used ketosis make work body used ketosis craving subside won’t feel terrible next step find recipe designed keto diet found online cookbook final step stay motivated first week two diet hardest get past becomes much easier thisTags Ketogenic Diet Healthy Foods Healthy Lifestyle Keto Lose Weight
|
187,975 |
⚡️The Ultimate Keto Meal Plan Review (How to Ultimate keto mail plan 2021)⚡️
|
What The Ultimate Keto Meal Plan
Keto diets mainly contain the drastic reduction of 1’s carbohydrate consumption, and replacing it with fat. Reducing the carb content material like this places the frame in a metabolic kingdom known as ketosis.
In this nation, your body is capable of effectively burn fats for power. It can also convert fat in the liver into ketones. This facilitates supply power for the mind.
You have come to the proper vicinity if you are seeking out records at The Ultimate Keto Meal Plan. She has visible the benefits it gives, including the wonders it has done for her buddies and different humans in her lifestyles.
Many of the people who’ve tried this diet have noticed results within four weeks. But as is the case with many diets, the keto weight loss program isn’t for the faint-hearted, as it can be pretty tough to comply with. Many people can’t put together the food recommended at domestic because of their issue, making it impossible to exercise it.
However, Claudia hopes to make it viable for extra human beings to exercise this food plan by way of supplying a manual based totally on the whole thing she has found out over the years. Her manual comes as a condensed form of the keto weight loss program comprising easy meal plans. Those who follow her hints shouldn’t have a hard time adapting to the weight loss plan
Claudia has developed a recognition of being a female with the high-quality The Ultimate Keto Meal Plan on-line. Those who’ve followed her directions don’t have anything however proper things to say approximately them, as they’ve all controlled to reap their desired our bodies. What’s greater, they get to look consequences while not having to consume poor-tasting ingredients.
Click here to more information
The 30-Day Ketogenic Meal Plan: What Is It?
The Ketogenic meal plan developed by way of Claudia has turn out to be a favourite with many human beings worldwide, way to its shape and teachings. Researchers agree with that the keto food regimen, which recommends eating a low-carb, and excessive-fats diet offers the high-quality weight reduction answer. It’s also best for the ones laid low with situations such as diabetes and epilepsy.
Ketogenic food have also been useful to individuals affected by situations such as most cancers and Alzheimer’s. The meals typically make certain that someone doesn’t ingest more than fifty grams of carbohydrates consistent with day. Its traits are useful for your health in more approaches than one.
While this weight loss program has been relatively a hit, mainly to folks who can follow it to the stop, many have said failing due to its strict guidelines. Luckily, you not have to worry about this, thanks to Claudia’s condensed Keto meal plan. The 30-day Ketogenic plan will provide you with a step-through-step manual on what you want to do to obtain your dreams.
Everyone who tries these dishes will instantly fall in love with them, irrespective of whether or not they’re into the keto weight-reduction plan or now not. By following her meal plans, we’ve got observed a upward push in our power levels. Additionally, we have additionally pronounced a trendy development in our standard health. The applications are intended to provide her followers a better way of losing weight.
Claudia has ensured they are flawlessly balanced with the aid of presenting examples, commands, and a list of elements for every meal. Fortunately, it covers greater than 3 chapters filled with breakfast, lunch, and dinner recipes.
Click here to more information
Benefits of Subscribing to the 30-Day Ketogenic Meal Plan
Access to a thirty-day easy meal plan. Each plan comes with detailed commands which can be clean to comply with.
The Ultimate Keto Meal Plan has been formulated with the aid of Claudia Caldwell, a renowned bestseller looking to proportion her understanding of the keto weight loss plan with the relaxation of the world.
The Ultimate Keto Meal Plan is comprehensive and features examples of some of the food you may put together.
The Ultimate Keto Meal Plan allows your body to get right into a state of ketosis. Ketosis is seemed because the number one metabolic process on your frame, which lets in it to burn fats speedy.
Click here to more information
What’s Included inside the Ketogenic Meal Plan?
The Ultimate Keto Meal Plan by using Claudia Caldwell: Subscribers gets instant access to the 30-day ketogenic meal plan. The plan may be downloaded in your smartphone, tablet, or laptop. Ensure you follow all the steps recommended inside the meal, and you’ll begin to word results inside some weeks.
Comprehensive Grocery Ready Food List: As the name indicates, that is a grocery list supposed for use via folks that would like to keep training the keto eating regimen. It will allow them to shed pounds quicker and lead a more lively lifestyle.
In her The Ultimate Keto Meal Plan, Claudia will offer you with options to everyday carbs. One hundred Keto Carb Alternatives: Most human beings have a difficult time staying far from carbs, mainly while stepping into ketosis. Carbs have a tendency to motive numerous cravings inside the body, making it tough to paste to the keto food plan. These options will make it less complicated to shrink these cravings, allowing your frame to stay in ketosis.
Access to the Keto Accelerator Masterclass refers to a sophisticated magnificence taught on line, which presents you with facts and strategies to accelerate the weight loss process. All its teachings pertain to the keto weight loss plan. It charges $299 to join the elegance, however you’ll advantage get admission to to it for free of charge when you buy the 30-day Ketogenic Meal Plan.
Click here to more information
This post contains affiliate links. if you use these links to by something we may earn a commission. thanks.”
|
https://medium.com/@waghraj33/%EF%B8%8Fthe-ultimate-keto-meal-plan-review-how-to-ultimate-keto-mail-plan-2021-%EF%B8%8F-9880726c65d6
|
['Helth']
|
2021-12-21 07:17:32.985000+00:00
|
['Ketogenic Diet', 'Ketogenic', 'Keto', 'Ketosis', 'Keto Diet']
|
Title ⚡️The Ultimate Keto Meal Plan Review Ultimate keto mail plan 2021⚡️Content Ultimate Keto Meal Plan Keto diet mainly contain drastic reduction 1’s carbohydrate consumption replacing fat Reducing carb content material like place frame metabolic kingdom known ketosis nation body capable effectively burn fat power also convert fat liver ketone facilitates supply power mind come proper vicinity seeking record Ultimate Keto Meal Plan visible benefit give including wonder done buddy different human lifestyle Many people who’ve tried diet noticed result within four week case many diet keto weight loss program isn’t fainthearted pretty tough comply Many people can’t put together food recommended domestic issue making impossible exercise However Claudia hope make viable extra human being exercise food plan way supplying manual based totally whole thing found year manual come condensed form keto weight loss program comprising easy meal plan follow hint shouldn’t hard time adapting weight loss plan Claudia developed recognition female highquality Ultimate Keto Meal Plan online who’ve followed direction don’t anything however proper thing say approximately they’ve controlled reap desired body What’s greater get look consequence consume poortasting ingredient Click information 30Day Ketogenic Meal Plan Ketogenic meal plan developed way Claudia turn favourite many human being worldwide way shape teaching Researchers agree keto food regimen recommends eating lowcarb excessivefats diet offer highquality weight reduction answer It’s also best one laid low situation diabetes epilepsy Ketogenic food also useful individual affected situation cancer Alzheimer’s meal typically make certain someone doesn’t ingest fifty gram carbohydrate consistent day trait useful health approach one weight loss program relatively hit mainly folk follow stop many said failing due strict guideline Luckily worry thanks Claudia’s condensed Keto meal plan 30day Ketogenic plan provide stepthroughstep manual want obtain dream Everyone try dish instantly fall love irrespective whether they’re keto weightreduction plan following meal plan we’ve got observed upward push power level Additionally additionally pronounced trendy development standard health application intended provide follower better way losing weight Claudia ensured flawlessly balanced aid presenting example command list element every meal Fortunately cover greater 3 chapter filled breakfast lunch dinner recipe Click information Benefits Subscribing 30Day Ketogenic Meal Plan Access thirtyday easy meal plan plan come detailed command clean comply Ultimate Keto Meal Plan formulated aid Claudia Caldwell renowned bestseller looking proportion understanding keto weight loss plan relaxation world Ultimate Keto Meal Plan comprehensive feature example food may put together Ultimate Keto Meal Plan allows body get right state ketosis Ketosis seemed number one metabolic process frame let burn fat speedy Click information What’s Included inside Ketogenic Meal Plan Ultimate Keto Meal Plan using Claudia Caldwell Subscribers get instant access 30day ketogenic meal plan plan may downloaded smartphone tablet laptop Ensure follow step recommended inside meal you’ll begin word result inside week Comprehensive Grocery Ready Food List name indicates grocery list supposed use via folk would like keep training keto eating regimen allow shed pound quicker lead lively lifestyle Ultimate Keto Meal Plan Claudia offer option everyday carbs One hundred Keto Carb Alternatives human being difficult time staying far carbs mainly stepping ketosis Carbs tendency motive numerous craving inside body making tough paste keto food plan option make le complicated shrink craving allowing frame stay ketosis Access Keto Accelerator Masterclass refers sophisticated magnificence taught line present fact strategy accelerate weight loss process teaching pertain keto weight loss plan charge 299 join elegance however you’ll advantage get admission free charge buy 30day Ketogenic Meal Plan Click information post contains affiliate link use link something may earn commission thanks”Tags Ketogenic Diet Ketogenic Keto Ketosis Keto Diet
|
187,976 |
How To Deal With The Keto Flu While Losing Weight
|
An Important Topic — We’re Sharing Our Tips
by Richard | Dec 21, 2021 | Ketogenic Diet, Weight Loss |
This article is from www.wholehealthemporium.com and may contain affiliate links.
The dreaded keto flu is a common occurrence when you’re first starting on the ketogenic diet.
It’s exciting that you’ve started your weight loss journey — and we’re proud of you!
But the keto flu can be concerning — it’s nothing to panic about.
While uncomfortable and mildly annoying, this is a natural reaction by the body. This is a normal process when becoming “keto adapted” when you suddenly minimize your carb intake drastically.
Some people like extra help to to get into ketosis, and lose weight — these can help.
What Is Keto Flu?
Harvard health describes keto flu as a group of symptoms that may appear two to seven days after starting a ketogenic diet.
The majority of people are used to a diet that’s mostly comprised of carbs followed by smaller portions of protein and an even smaller percentage of fat.
However, when you get on a ketogenic diet, you’ll be turning the tables on your diet and doing the total opposite.
80 to 90 percent of your daily calories will come from fat, and the remaining 10 percent will be from protein with a miniscule portion of carbs, if any.
This is something that will come as a shock to most people. The body is just not used to the diet.
Here are some of the keto flu symptoms you may experience while trying to make the change:
Body aches
Cramps
Difficulty concentrating/focusing
Dizziness/drowsiness
Fatigue
Insomnia
Irritability
Nausea
Stomach issues
Sugar cravings
Millions of people are addicted to sugar and carbs. So, weaning yourself off these foods is akin to quitting an addiction and going cold turkey. It’s inevitable to face some discomfort.
Is There Treatment For Keto Flu?
The good news is that the keto flu is only temporary.
You can look at our other article here for more information on the keto flu.
Within a week or two, your body will adapt and be able to function as normal with the higher fat intake and carb restriction.
It’s imperative that you stay the course and not throw in the towel because of the keto flu symptoms.
Quitting will mean that your weight loss will take longer and will be more difficult. So, endure the symptoms till your body adapts.
How To Avoid Keto Flu
One of the best ways to adopt the keto diet will be to ease into it instead of making the switch overnight.
You can start off with a low carb diet and give your body time to adjust.
Gradually, lower your carb intake and increase your intake of healthy fats until you’re on a keto diet.
This will give your body time to adapt and you can escape the keto flu symptoms.
Inch by inch, life’s a cinch. Yard by yard, life is hard. Go slow.
It’s also essential that you stay hydrated.
Drink sufficient water throughout the day and watch your caloric intake.
You should be at a daily caloric deficit of about 500 calories. You do not want to go too low.
Don’t cut both your carbs and fats. That’s a recipe for a weight loss plateau.
Instead, eat more healthy fats so that you’re meeting your calorie needs for the day.
Coping With The Keto Flu
Should you get the symptoms mentioned above, there are a few ways you can alleviate the discomfort.
Engage in exercise daily. This will improve your mood and get your blood pumping.
Keep the exercise relaxed and gentle, like a brisk walk or a leisurely swim.
Drink some bone broth or mix some Himalayan salt in water and drink.
he loss of sodium and electrolytes in your body could be causing some of the problems.
You may also wish to consume a magnesium supplement and eat foods that are rich in potassium (avocados, spinach, mushrooms, salmon, and nuts).
“You can combat the keto flu by staying hydrated, replacing electrolytes, getting plenty of sleep, avoiding strenuous activities, eating enough fat and cutting out carbs slowly over time.” Jillian Kubala, MS, RD
Adding certain superfoods are an excellent way to boost energy levels, without knocking you out of ketosis.
Conclusion
The keto flu is a myriad of symptoms of keto flu are not fully understood by doctors or healthcare professionals.
If you follow the pointers above, you’ll be able to avoid keto flu or at the very least, you’ll be able to mitigate the symptoms.
Stick to the plan and give your body time to adapt. Once you’ve found your footing with the keto diet, you’ll become a fat burning machine, and that’s when the fun starts.
Superfoods can make a world of difference in how you feel.
Thank you for reading!
Did you experience the keto flu? How did you cope with the symptoms?
Leave a comment below and share your thoughts with us!
© Copyright 2021 Whole Health Emporium. All Right Reserved.
Edited by Pauline D. and Richard Tracy
Works Cited
Campos, Marcelo. “What Is Keto Flu?” Harvard.edu. N.p., 18 Oct. 2018. Web. 24 Oct. 2021.
Kubala, Jillian, MS, and RD. “The Keto Flu: Symptoms and How to Get Rid of It.” Healthline.com. N.p., 3 Apr. 2018. Web. 24 Oct. 2021.
|
https://medium.com/@wholehealthemporium/how-to-deal-with-the-keto-flu-while-losing-weight-b3241229fe4c
|
['Whole Health Emporium']
|
2021-12-22 00:55:19.699000+00:00
|
['Weight Loss', 'Health', 'Healthcare', 'Keto', 'Weight Loss Tips']
|
Title Deal Keto Flu Losing WeightContent Important Topic — We’re Sharing Tips Richard Dec 21 2021 Ketogenic Diet Weight Loss article wwwwholehealthemporiumcom may contain affiliate link dreaded keto flu common occurrence you’re first starting ketogenic diet It’s exciting you’ve started weight loss journey — we’re proud keto flu concerning — it’s nothing panic uncomfortable mildly annoying natural reaction body normal process becoming “keto adapted” suddenly minimize carb intake drastically people like extra help get ketosis lose weight — help Keto Flu Harvard health describes keto flu group symptom may appear two seven day starting ketogenic diet majority people used diet that’s mostly comprised carbs followed smaller portion protein even smaller percentage fat However get ketogenic diet you’ll turning table diet total opposite 80 90 percent daily calorie come fat remaining 10 percent protein miniscule portion carbs something come shock people body used diet keto flu symptom may experience trying make change Body ache Cramps Difficulty concentratingfocusing Dizzinessdrowsiness Fatigue Insomnia Irritability Nausea Stomach issue Sugar craving Millions people addicted sugar carbs weaning food akin quitting addiction going cold turkey It’s inevitable face discomfort Treatment Keto Flu good news keto flu temporary look article information keto flu Within week two body adapt able function normal higher fat intake carb restriction It’s imperative stay course throw towel keto flu symptom Quitting mean weight loss take longer difficult endure symptom till body adapts Avoid Keto Flu One best way adopt keto diet ease instead making switch overnight start low carb diet give body time adjust Gradually lower carb intake increase intake healthy fat you’re keto diet give body time adapt escape keto flu symptom Inch inch life’s cinch Yard yard life hard Go slow It’s also essential stay hydrated Drink sufficient water throughout day watch caloric intake daily caloric deficit 500 calorie want go low Don’t cut carbs fat That’s recipe weight loss plateau Instead eat healthy fat you’re meeting calorie need day Coping Keto Flu get symptom mentioned way alleviate discomfort Engage exercise daily improve mood get blood pumping Keep exercise relaxed gentle like brisk walk leisurely swim Drink bone broth mix Himalayan salt water drink loss sodium electrolyte body could causing problem may also wish consume magnesium supplement eat food rich potassium avocado spinach mushroom salmon nut “You combat keto flu staying hydrated replacing electrolyte getting plenty sleep avoiding strenuous activity eating enough fat cutting carbs slowly time” Jillian Kubala MS RD Adding certain superfoods excellent way boost energy level without knocking ketosis Conclusion keto flu myriad symptom keto flu fully understood doctor healthcare professional follow pointer you’ll able avoid keto flu least you’ll able mitigate symptom Stick plan give body time adapt you’ve found footing keto diet you’ll become fat burning machine that’s fun start Superfoods make world difference feel Thank reading experience keto flu cope symptom Leave comment share thought u © Copyright 2021 Whole Health Emporium Right Reserved Edited Pauline Richard Tracy Works Cited Campos Marcelo “What Keto Flu” Harvardedu Np 18 Oct 2018 Web 24 Oct 2021 Kubala Jillian MS RD “The Keto Flu Symptoms Get Rid It” Healthlinecom Np 3 Apr 2018 Web 24 Oct 2021Tags Weight Loss Health Healthcare Keto Weight Loss Tips
|
187,977 |
The Keto Diet for Beginners
|
Usually, whilst you eat stuff with very high carb content material, your body converts it to glucose that’s the byproduct of carbohydrate metabolism. It also makes insulin; a hormone which promotes glucose absorption into the frame.
The Ultimate Keto Meal Plan — CLICK HERE
Here is wherein it gets thrilling. Glucose is the energy currency of the frame and the frame depends on it to drive all of its sports. Since glucose is the leader supply of electricity for the frame, your fat don’t get used. They really gather, leading to excess weight. But via decreasing the intake of carbohydrates, the frame is pushed right into a nation called ketosis.
Ketosis is a natural metabolic manner via which the frame produces ketones from fat. Now those ketones also can generate strength for the body just like carbohydrates. Hence, the goal of keto weight-reduction plan is to push the frame into ketosis which isn’t always achieved by starvation of energy but by using a discount in carbohydrate intake.
What Do I Eat on a Keto Diet ?
Looking forward to taking part in the very quality blessings from keto dieting? Here’s a small list of what to avoid and what to devour:
Avoid
Starch: Rice, pasta, potatoes, bread, porridge and so on.
Whole grain merchandise: Wheats, cereals, corn etc.
Sugar: Honey, maple syrup, agave etc.
Tubers: Potatoes, yams and many others.
Legumes: Beans and lentils
Low-fats Yoghurt
You Can Eat
Meat
Eggs
Fish and sea ingredients
Natural fats and high-fats sauces
Vegetables growing above the floor include — Cauliflower, cabbage, avocado, broccoli and zucchini.
High fats dairy products
Nuts and seeds
A slight quantity of berries
Benefits of a Ketogenic Diet
The metabolic transfer that brings about ketosis comes with severa fitness, bodily and mental blessings, a number of which we will discover here.
Weight Loss
Ketogenic weight-reduction plans tend to convert the body to a fat-burning gadget by means of using your frame fat as a strength source. This brings approximately an obvious decline in weight which is almost usually the aim of going keto. But losing excess weight might be only a portion of the advantages.
Lowers Blood Glucose
Low carbohydrate consumption method low sugar tiers inside the body. It goes without announcing that ketogenic diets had been acknowledged to assist the body maintain quite low blood glucose and insulin levels. This is especially helpful for patients suffering from Type 2 diabetes.
Increased Concentration and Mental Focus
Our intellectual strength relies upon the amount of electricity to be had for the brain’s use. Thankfully, the mind can also use ketones as an opportunity to supply electricity when low on carbs. Do you want to live committed to completing your day by day duties with increased awareness? You probably already have an idea of what type of food to eat.
Management of Epilepsy
Ketogenic meals have shown to be pretty powerful inside the control of epilepsy in kids. Although it’s precise mechanism remains largely unknown, studies have proven a tremendous hyperlink among excessive-fat-low-carb consumption and the management of drug resistant epilepsy in youngsters.
It Keeps You Energetic
Keto weight-reduction plan is majorly approximately fat; which can be a long way greater powerful molecules to burn as gas in comparison to carbs. In reality, carbs burn quicker than fats, subsequently liberating electricity faster. However, they may no longer be very efficient in generating energy for the frame, each in volume and nice. While a gramme of carbohydrates generates about four energy of electricity while burnt, the identical quantity (1 gramme) of fat will generate approximately nine calories of strength that is more than twice what carbs can provide.
Keeps Your Appetite in Check
Increased urge for food for meals or starvation is one of the many drawbacks of a unique weight-reduction plan. However, low carb ingestion tends to reduce yearning for meals and for obvious motives. Fatty ingredients have a tendency to preserve the human body happy for a long time. Part of the motive for this is that it does not burn up quickly as is the case with carbohydrates.
Blood Pressure and Cholesterol Regulation
Elevated blood stress isn’t necessarily something you can experience yet it poses one of the most risky cardiovascular fitness threats nowadays. But the good information is that certain life-style modifications in addition to appropriate medication will assist deal with it.
In addition to exercise and associated activities, a lifestyle change that allows you to cope with your heart is a keto weight-reduction plan. One of the ways it does this is by improving the level of high density lipoprotein (HDL) or “true ldl cholesterol” at the same time as decreasing low density lipoprotein (LDL) or “awful ldl cholesterol” stages in the frame.
This facilitates dealing with cholesterol building up in coronary arteries (atherosclerosis) and other cardiovascular fitness troubles.
The Ultimate Keto Meal Plan — CLICK HERE
|
https://medium.com/@m-priya-paramashivam/the-keto-diet-for-beginners-441ed1789be
|
['Health Care']
|
2021-12-23 16:07:06.398000+00:00
|
['Ketogenic Diet', 'Weight Loss', 'Mental Health', 'Keto', 'Keto Diet']
|
Title Keto Diet BeginnersContent Usually whilst eat stuff high carb content material body convert glucose that’s byproduct carbohydrate metabolism also make insulin hormone promotes glucose absorption frame Ultimate Keto Meal Plan — CLICK wherein get thrilling Glucose energy currency frame frame depends drive sport Since glucose leader supply electricity frame fat don’t get used really gather leading excess weight via decreasing intake carbohydrate frame pushed right nation called ketosis Ketosis natural metabolic manner via frame produce ketone fat ketone also generate strength body like carbohydrate Hence goal keto weightreduction plan push frame ketosis isn’t always achieved starvation energy using discount carbohydrate intake Eat Keto Diet Looking forward taking part quality blessing keto dieting Here’s small list avoid devour Avoid Starch Rice pasta potato bread porridge Whole grain merchandise Wheats cereal corn etc Sugar Honey maple syrup agave etc Tubers Potatoes yam many others Legumes Beans lentil Lowfats Yoghurt Eat Meat Eggs Fish sea ingredient Natural fat highfats sauce Vegetables growing floor include — Cauliflower cabbage avocado broccoli zucchini High fat dairy product Nuts seed slight quantity berry Benefits Ketogenic Diet metabolic transfer brings ketosis come severa fitness bodily mental blessing number discover Weight Loss Ketogenic weightreduction plan tend convert body fatburning gadget mean using frame fat strength source brings approximately obvious decline weight almost usually aim going keto losing excess weight might portion advantage Lowers Blood Glucose Low carbohydrate consumption method low sugar tier inside body go without announcing ketogenic diet acknowledged assist body maintain quite low blood glucose insulin level especially helpful patient suffering Type 2 diabetes Increased Concentration Mental Focus intellectual strength relies upon amount electricity brain’s use Thankfully mind also use ketone opportunity supply electricity low carbs want live committed completing day day duty increased awareness probably already idea type food eat Management Epilepsy Ketogenic meal shown pretty powerful inside control epilepsy kid Although it’s precise mechanism remains largely unknown study proven tremendous hyperlink among excessivefatlowcarb consumption management drug resistant epilepsy youngster Keeps Energetic Keto weightreduction plan majorly approximately fat long way greater powerful molecule burn gas comparison carbs reality carbs burn quicker fat subsequently liberating electricity faster However may longer efficient generating energy frame volume nice gramme carbohydrate generates four energy electricity burnt identical quantity 1 gramme fat generate approximately nine calorie strength twice carbs provide Keeps Appetite Check Increased urge food meal starvation one many drawback unique weightreduction plan However low carb ingestion tends reduce yearning meal obvious motif Fatty ingredient tendency preserve human body happy long time Part motive burn quickly case carbohydrate Blood Pressure Cholesterol Regulation Elevated blood stress isn’t necessarily something experience yet pose one risky cardiovascular fitness threat nowadays good information certain lifestyle modification addition appropriate medication assist deal addition exercise associated activity lifestyle change allows cope heart keto weightreduction plan One way improving level high density lipoprotein HDL “true ldl cholesterol” time decreasing low density lipoprotein LDL “awful ldl cholesterol” stage frame facilitates dealing cholesterol building coronary artery atherosclerosis cardiovascular fitness trouble Ultimate Keto Meal Plan — CLICK HERETags Ketogenic Diet Weight Loss Mental Health Keto Keto Diet
|
187,978 |
Get Your Free Keto Cookbook: Simple Recipes to Start Your Keto Journey.
|
Photo by Brooke Lark on Unsplash
The book is 100% FREE to buyers, they just have to pay for shipping. Limited quantities while supplies last.
If you’ve been looking for a way to reach your weight loss goals, but given up because you couldn’t find a meal plan that worked for you, then this is the blog post for you. The keto diet is becoming increasingly popular and is an effective way to manage your weight and improve your overall health. With this free keto cookbook, we hope to provide you with easy, delicious recipes that will make sticking to the keto diet easier than ever before!
What is the keto diet?
The book is 100% FREE to buyers, they just have to pay for shipping. Limited quantities while supplies last.
The keto diet has grown in popularity because of its ability to effectively manage weight, improve insulin sensitivity, and reduce inflammation. The keto diet is a low-carbohydrate, high-fat diet that places the body into a state of ketosis. Ketosis occurs when the body does not have enough sugar (glucose) for energy production.
Ketones are formed by the liver to be used as an energy source instead of glucose. It’s important to note that this diet doesn’t cause your body to go into starvation mode or feel dramatic weight loss — it provides sustained weight loss over time.
The benefits of the keto diet
Photo by Jan Sedivy on Unsplash
The book is 100% FREE to buyers, they just have to pay for shipping. Limited quantities while supplies last.
The keto diet is becoming increasingly popular and is an effective way to manage your weight and improve your overall health. With this free keto cookbook, we hope to provide you with easy, delicious recipes that will make sticking to the keto diet easier than ever before!
One of the main reasons the keto diet has become so popular is because it does not exclude any food groups. You can eat all types of meats, seafood, vegetables, fruit, oils (healthy fats), nuts, seeds, low-carb dairy products, etc. Believe it or not, even some high-carb foods like beans are allowed on the keto diet! This reduces food boredom while still satisfying your appetite for variety.
Another great thing about the keto diet is that it forces you to lower your carbohydrate intake. By following a strict rule of eating 20 grams or less per day (except for some exceptions), you can expect to experience rapid weight loss since carbs are stored as fat in the body.
The downsides of the keto diet
While the keto diet offers many benefits, it also has downsides that are important to consider.
For one, the diet is very restrictive. The keto diet prohibits most carbs and sugars which can be difficult for people who need to eat more than just meat and vegetables. Additionally, the keto diet is hard to maintain in social settings or during travel because many foods that other people might eat aren’t allowed on this diet.
Additionally, transitioning to a ketogenic diet can be difficult for some people because of its restrictions on foods they’re used to eating. If you’re not used to eating this way, your body may take some time to adjust and it may cause side effects like fatigue or cravings as your body adjusts its fuel source from glucose to fat. However, these side effects don’t last long and can usually be prevented by following a well-formulated ketogenic plan and staying hydrated.
Photo by Total Shape on Unsplash
Getting started with keto recipes
If you’re just starting keto, it’s important to have a basic understanding of what you can and can’t eat. Thankfully, this free keto cookbook will provide a list of foods that are allowed on the keto diet.
Keto Diet 101: Foods You Can Eat
The following is a list of foods that are generally considered “keto-friendly.” This list includes vegetables, nuts and seeds, dairy products, meats, fish, fruits, and healthy oils.
Vegetables: all fresh or frozen without added sugar
Nuts and seeds: almonds, walnuts, pecans
Dairy products: fat-free or low-fat milk (plain or vanilla), egg whites
Meat: beef/lamb/turkey/venison (grass fed), pork tenderloin (lean), cheddar cheese (full fat)
Fish: salmon (wild caught), trout (wild caught), sardines
Fruit: avocado, blackberries, raspberries
Healthy oils: coconut oil*, olive oil*, avocado oil*
Choosing your ingredients
Before we get into the recipes, you should probably know a little bit about carbohydrates. If you’re not sure what they are or why they matter to your weight loss goals, take a look at this article.
Photo by Nathan Dumlao on Unsplash
The keto diet restricts many foods, but it’s designed to be an easy and sustainable way of eating. You can find high-quality keto products that provide you with the nutrients necessary for the body to function and still achieve results.
When it comes to picking ingredients, there are two things to keep in mind:
1) There is no wrong way to do keto! Experimenting with different ingredients helps you learn more about how your body responds to different foods.
2) Choose the best-quality ingredients that fit into your budget. Many people on keto complain about how expensive it is, but if you buy organic vegetables instead of frozen veggies, you will save money over time because these are less processed and have higher nutritional value.
Cooking tips for keto recipes
Whether you’re new to the keto diet or just looking for some inspiration, cooking tips will help you get the most out of your keto experience. Cooking for one? Try our single serving recipes! Maybe you’re in a rush and need something fast and easy. Our quick and easy recipes are perfect when you only have 30 minutes to spare! If you’re looking for a healthy alternative or trying to add more veggies into your diet, we’ve got plenty of vegetarian options as well!
Conclusion
The keto diet is proving to be one of the most popular diets of the century. If you’ve been on the fence about trying keto, this guide will help you get started. You’ll learn what keto is, how it works, and the benefits of this diet. Along with helpful recipes, you’ll be feeling energized and healthy in no time.
The book is 100% FREE to buyers, they just have to pay for shipping. Limited quantities while supplies last.
|
https://medium.com/@quickweightloss2021/get-your-free-keto-cookbook-simple-recipes-to-start-your-keto-journey-95662a8f4af8
|
[]
|
2021-12-24 15:17:50.972000+00:00
|
['Ketogenic Diet', 'Weight Loss', 'Ketogenic', 'Keto', 'Keto Diet']
|
Title Get Free Keto Cookbook Simple Recipes Start Keto JourneyContent Photo Brooke Lark Unsplash book 100 FREE buyer pay shipping Limited quantity supply last you’ve looking way reach weight loss goal given couldn’t find meal plan worked blog post keto diet becoming increasingly popular effective way manage weight improve overall health free keto cookbook hope provide easy delicious recipe make sticking keto diet easier ever keto diet book 100 FREE buyer pay shipping Limited quantity supply last keto diet grown popularity ability effectively manage weight improve insulin sensitivity reduce inflammation keto diet lowcarbohydrate highfat diet place body state ketosis Ketosis occurs body enough sugar glucose energy production Ketones formed liver used energy source instead glucose It’s important note diet doesn’t cause body go starvation mode feel dramatic weight loss — provides sustained weight loss time benefit keto diet Photo Jan Sedivy Unsplash book 100 FREE buyer pay shipping Limited quantity supply last keto diet becoming increasingly popular effective way manage weight improve overall health free keto cookbook hope provide easy delicious recipe make sticking keto diet easier ever One main reason keto diet become popular exclude food group eat type meat seafood vegetable fruit oil healthy fat nut seed lowcarb dairy product etc Believe even highcarb food like bean allowed keto diet reduces food boredom still satisfying appetite variety Another great thing keto diet force lower carbohydrate intake following strict rule eating 20 gram le per day except exception expect experience rapid weight loss since carbs stored fat body downside keto diet keto diet offer many benefit also downside important consider one diet restrictive keto diet prohibits carbs sugar difficult people need eat meat vegetable Additionally keto diet hard maintain social setting travel many food people might eat aren’t allowed diet Additionally transitioning ketogenic diet difficult people restriction food they’re used eating you’re used eating way body may take time adjust may cause side effect like fatigue craving body adjusts fuel source glucose fat However side effect don’t last long usually prevented following wellformulated ketogenic plan staying hydrated Photo Total Shape Unsplash Getting started keto recipe you’re starting keto it’s important basic understanding can’t eat Thankfully free keto cookbook provide list food allowed keto diet Keto Diet 101 Foods Eat following list food generally considered “ketofriendly” list includes vegetable nut seed dairy product meat fish fruit healthy oil Vegetables fresh frozen without added sugar Nuts seed almond walnut pecan Dairy product fatfree lowfat milk plain vanilla egg white Meat beeflambturkeyvenison grass fed pork tenderloin lean cheddar cheese full fat Fish salmon wild caught trout wild caught sardine Fruit avocado blackberry raspberry Healthy oil coconut oil olive oil avocado oil Choosing ingredient get recipe probably know little bit carbohydrate you’re sure matter weight loss goal take look article Photo Nathan Dumlao Unsplash keto diet restricts many food it’s designed easy sustainable way eating find highquality keto product provide nutrient necessary body function still achieve result come picking ingredient two thing keep mind 1 wrong way keto Experimenting different ingredient help learn body responds different food 2 Choose bestquality ingredient fit budget Many people keto complain expensive buy organic vegetable instead frozen veggie save money time le processed higher nutritional value Cooking tip keto recipe Whether you’re new keto diet looking inspiration cooking tip help get keto experience Cooking one Try single serving recipe Maybe you’re rush need something fast easy quick easy recipe perfect 30 minute spare you’re looking healthy alternative trying add veggie diet we’ve got plenty vegetarian option well Conclusion keto diet proving one popular diet century you’ve fence trying keto guide help get started You’ll learn keto work benefit diet Along helpful recipe you’ll feeling energized healthy time book 100 FREE buyer pay shipping Limited quantity supply lastTags Ketogenic Diet Weight Loss Ketogenic Keto Keto Diet
|
187,979 |
How the Ketogenic Diet and Intermittent Fasting Cured My Non-Diabetic Hypoglycemia
|
How the Ketogenic Diet and Intermittent Fasting Cured My Non-Diabetic Hypoglycemia
Photo by Rimma_Bondarenko.
Most people can relate to being “hangry”—that singular combination of hungry and angry. But if it happens to you frequently, paired with other more frantic symptoms, then it could be something more serious.
Some people can have low blood sugar without being diabetic. It’s called reactive hypoglycemia.
I have been the child on a road trip, fighting with my sister, screaming that I’m going to be sick unless we stop to eat, just hours after we already stopped to eat. I have been the girlfriend who is too shaky and stressed to pick a restaurant, that just gives up and eats an entire sleeve of crackers for dinner instead. I have quit mid-cooking dinner to go lie down because I felt so weak and exhausted, abandoning the dinner entirely.
All of these situations have one thing in common: they were the consequence of having low blood sugar.
Low blood sugar is not something you can ignore. A common treatment for diabetics is to eat something sugary for an instant boost. But if you have reactive hypoglycemia, that’s just a quick fix—as is, say, eating a sleeve of crackers. It will make you feel better in the short term but will compound your problems over time.
What I have is called “non-diabetic reactive hypoglycemia”, which basically means that my blood sugar drops, which make me feel sick a few hours after eating.
When I was a child, I had a lot of blood tests to try to see what was going on with my blood sugar. The doctors concluded through blood tests that I wasn’t diabetic, but we never got any real answers as to why I was feeling these hypoglycemic symptoms. I’m not a diabetic.
My parents still knew something was going wrong with me: I would complain of headaches and shakiness and would fall asleep for long periods of time, even though I never had an appetite. They remedied it with just making sure I had food every few hours, regardless of whether I felt hungry.
As an adult, I wanted to know more, so I went to the doctor where I was able to find out if I legitimately had something wrong with my blood sugar. They ordered me a mixed-meal tolerance test (MMTT). For this test, you don’t eat, and your blood glucose levels are monitored before and after you are given a beverage that contains a mix of carbohydrate, protein, and fat during a period of a few hours. It’s similar to the more common glucose tolerance test (GTT) where you fast and are then given a glucose-only solution, followed by blood glucose testing.
The results of the MMTT confirmed the diagnosis that I already suspected: non-diabetic, reactive hypoglycemia.
|
https://betterhumans.pub/how-the-ketogenic-diet-and-intermittent-fasting-cured-my-non-diabetic-hypoglycemia-841968623949
|
['Julia Odom']
|
2021-10-12 14:40:36.936000+00:00
|
['Intermittent Fasting', 'Health', 'Keto', 'Diabetes Prevention', 'Hypoglycemia']
|
Title Ketogenic Diet Intermittent Fasting Cured NonDiabetic HypoglycemiaContent Ketogenic Diet Intermittent Fasting Cured NonDiabetic Hypoglycemia Photo RimmaBondarenko people relate “hangry”—that singular combination hungry angry happens frequently paired frantic symptom could something serious people low blood sugar without diabetic It’s called reactive hypoglycemia child road trip fighting sister screaming I’m going sick unless stop eat hour already stopped eat girlfriend shaky stressed pick restaurant give eats entire sleeve cracker dinner instead quit midcooking dinner go lie felt weak exhausted abandoning dinner entirely situation one thing common consequence low blood sugar Low blood sugar something ignore common treatment diabetic eat something sugary instant boost reactive hypoglycemia that’s quick fix—as say eating sleeve cracker make feel better short term compound problem time called “nondiabetic reactive hypoglycemia” basically mean blood sugar drop make feel sick hour eating child lot blood test try see going blood sugar doctor concluded blood test wasn’t diabetic never got real answer feeling hypoglycemic symptom I’m diabetic parent still knew something going wrong would complain headache shakiness would fall asleep long period time even though never appetite remedied making sure food every hour regardless whether felt hungry adult wanted know went doctor able find legitimately something wrong blood sugar ordered mixedmeal tolerance test MMTT test don’t eat blood glucose level monitored given beverage contains mix carbohydrate protein fat period hour It’s similar common glucose tolerance test GTT fast given glucoseonly solution followed blood glucose testing result MMTT confirmed diagnosis already suspected nondiabetic reactive hypoglycemiaTags Intermittent Fasting Health Keto Diabetes Prevention Hypoglycemia
|
187,980 |
The 43+ health benefits of ketogenic dieting (in addition to weight loss)
|
For those unfamiliar, ketogenic dieting is any diet plan “low-carb” enough to switch your body into a state of producing and burning a significant amount of ketones, specifically acetoacetate (AcAc) and its derivatives beta-hydroxybutyrate (BHB) and acetone.
Click here to visit the most recent version of this article, and subscribe to my newsletter to follow along as I write about ketosis and other health science topics.
For those interested in background reading, I’ve previously written summary articles about the science of fat metabolism and ketosis here and here.
These molecules, especially AcAc and BHB, are used by the brain and other tissues for energy, and facilitate a number of health benefits that I’ll address below.
While the biological processes involved are extremely complex, I’d invite you to use this as the beginning of an important conversation for you and your doctor to explore together. Indeed, ketogenic dieting may or may not be appropriate for you, so please consult with your doctor before experimenting on yourself.
Click here to join my newsletter and I’ll keep you posted when I get new articles up (FYI: as a heads up, I also write about entrepreneurship and web development. I started writing about fat metabolism and ketogenic dieting here at KetoSchool out of pure hobby interest, as there are relatively few resources out there that teach the underlying science).
Focusing the brain (increased memory, cognition, clarity, and seizure control; less migraines)
Ketogenic diets were notably first used at the Mayo Clinic in the 1920s to treat children with epilepsy. While the exact mechanism of seizure prevention on a ketogenic diet is still a mystery, researchers believe it has something to do with the increased stability of neurons and up-regulation of brain mitochondria and mitochondrial enzymes.
Related to this research, some serious attention has been given to ketogenic dieting and Alzheimers Disease. Scientists have discovered increased cognition and enhanced memory in adults with impairments in these areas, and a growing body of research shows improvement at all stages of dementia. Ketosis has been shown to be effective against Parkinson’s disease as well.
For a broader audience of dieters, the often-reported side effects of increased mental clarity and focus and less frequent and less intense migraines are likely related to the more stable blood sugar and altered brain chemistry that improves memory and cognition as well.
Fighting some types of cancer
Dom D’Agostino’s lab published an article in 2014 entitled “Ketone supplementation decreases tumor cell viability and prolongs survival of mice with metastatic cancer.”
Here is important background from the abstract:
Cancer cells express an abnormal metabolism characterized by increased glucose consumption owing to genetic mutations and mitochondrial dysfunction. Previous studies indicate that unlike healthy tissues, cancer cells are unable to effectively use ketone bodies for energy. Furthermore, ketones inhibit the proliferation and viability of cultured tumor cells.
Here is a good overview article of recent animal studies, which includes this 2013 article from Dom’s lab:
Of course, please do not ignore your doctor’s advice when it comes to cancer treatment, but — like many of the topics addressed in this article — it may be helpful for you to bring up the conversation.
Preventing Heart Disease (lower blood pressure, lower triglycerides, better cholesterol profiles)
Again, related to the downstream effects of keeping blood glucose low and stable, ketogenic dieting helps keep blood pressure in check and lowers triglyceride levels.
While it may seem counterintuitive that eating a higher percentage of fat in your diet lowers triglycerides, it turns out that the consumption of excess carbs (especially fructose) is the key driver of increasing triglycerides.
And regarding HDL and LDL particles (which the body uses to move fat and cholesterol around), ketogenic dieting helps raise HDL (“good cholesterol”) and improve the profile of LDL (“bad cholesterol”).
Decreasing inflammation (which improves acne, arthritis, eczema, psoriasis, IBS, pain, etc…)
A Nature Medicine article last year found a likely mechanism behind what people have known for decades: ketogenic dieting is profoundly anti-inflammtory and helps with a host of related health problems.
The researchers found that “the anti-inflammatory effects of caloric restriction or ketogenic diets may be linked to BHB-mediated inhibition of the NLRP3 inflammasome.”
In other words, the key player in many inflammatory diseases is suppressed by BHB, which is one of the main ketones produced from a ketogenic diet.
Thus the implications on arthritis, acne, psoriasis, eczema, IBS, and other diseases involving inflammation and pain are significant enough that it is prompting more research attention.
Improving energy levels and sleep
By day 4 or 5 on a ketogenic diet, most people report an increase in general energy levels and a lack of cravings for carbs. The mechanism here involves both a stabilization of insulin levels and readily available source of energy for our brain and body tissues.
Sleep improvements are a bit more of a mystery. Studies have shown that ketogenic dieting improves sleep by decreasing REM and increasing slow-wave sleep patterns. While the exact mechanism is unclear, it likely is related to the complex biochemical shifts involving the brain’s use of ketones for energy combined with other body tissues directly burning fat.
Keeping uric acid levels in check (helping kidney function and preventing gout)
The most common cause of kidney stones and gout is elevated uric acid, calcium, oxalate, and phosphorus levels as result of a complex combination of unlucky genetics, dehydration, obesity, sugar consumption (especially fructose), and eating/drinking things with a lot of purines and alcohol (e.g. meat and beer).
An important caveat is that ketogenic diet temporarily raises uric acid levels — especially when dehydrated — but over time they come down:
…uric acid goes up promptly in the same time frame that ketones go up, but after 4–6 weeks, despite ketones staying up, uric acid starts to come back down. Based on these data and my clinical observations in thousands of patients, uric acid returns to or below pre-diet baseline within 6–12 weeks despite the person remaining is a state of nutritional ketosis.
Assisting gastrointestinal and gallbladder health (less heartburn and acid reflux, less risk for gallstones, improved digestion, less gas and bloating)
It is well known that grain-based foods, nightshade vegetables like potatoes and tomatoes, and sugary foods increase the likelihood of acid reflux and heartburn. Therefore, it’s not surprising that eating a low-carb diet improves these symptoms and actually confronts the root problems of inflammation, bacterial issues, and autoimmune responses.
Related to this, it is known that changes in diet rapidly and reproducibly alters the human gut microbiome. Dr. Eric Westman describes at length how a host of problems are significantly reduced or removed as a result of microbiome changes on a ketogenic diet.
…by taking away the carbohydrate in the food, I can pretty much fix every gastrointestinal problem that affects people today.
Research also shows that carbs in the diet is one of the key ingredients for gallstones. Somewhat counter-intuitively, eating a sufficient amount of fat when carb intake is down helps clear out the gallbladder and keep things running smoothly to prevent gallstones from forming.
Battling a wide variety of neurologic and metabolic diseases
Kristin W. Barañano, MD, PhD and Adam L. Hartman, MD published a review in 2008 discussing the potential mechanisms of how a ketogenic diet can treat the following diseases:
Serious attention is also being given to treating Multiple Sclerosis with a ketogenic diet based on similar mechanisms.
Assisting Women’s Health (increased fertility, stabilizing hormones)
An extensive review published in 2013 looked at the research and evidence of ketogenic diets enhancing fertility (long story short, it looks promising). Studies also show that Polycystic Ovary Syndrome (PCOS) can be treated effectively with low-carb dieting, which reduces or eliminates symptoms such as infrequent or prolonged menstrual periods, acne, and obesity.
Overall, keeping blood sugar levels low and stable, which results in lower overall levels of insulin in the blood, helps equilibrate and stabilize other hormone levels, especially in women. This naturally has downstream benefits on a wide variety of metabolic pathways related to insulin, such as hunger and energy utilization.
Helping the eyes (more stable vision; less risk for cataracts)
As any diabetic will tell you, it is well known that high blood sugar has a detrimental effect on eyesight and leads to an increased risk for cataracts. It’s therefore not surprising that keeping blood sugar levels low improves eye and vision health, as a gazillion people have shared online, and as related diabetes research has proven.
Gaining muscle and improving endurance
BHB, specifically, has been shown to promote muscle gain. Combined with tons of anecdotal evidence over the years, there is an entire movement behind bodybuilders using a ketogenic approach to gain more muscle and less fat (typically muscle gain also comes with fat gain, so there’s understandable attention being given toward preventing this).
In addition, Dr. Stephen Phinney and Dr. Jeff Volek have a number of papers published about ketogenic dieting for ultra-endurance athletes. In short, once these athletes are fully fat-adapted, there is evidence to suggest that mental and physical performance is significantly improved beyond a “normal” carbohydrate-rich diet.
And last but not least, curbing diabetes, obesity, and metabolic syndrome while sparing muscle loss
Of course, there are over 160 research papers currently on Pubmed with the words “diabetes” and “ketosis” or “ketogenic” in the title alone. It’s beyond clear that ketogenic dieting is extremely effective for many people with both type I and type II diabetes for all the reasons discussed above related to keeping blood sugar levels and insulin in check.
In addition, recent papers within the last few years investigating the effect of ketogenic dieting on obesity conclude that it’s an extremely effective way to not only lose fat, but spare muscle loss while curbing many disorders related to obesity as well (many of which have been discussed above), including the set of symptoms and risk factors known as Metabolic Syndrome (i.e. abdominal obesity, diabetes, hypertension, and elevated cholesterol)
—
For further reading, I would recommend this 2013 review article from the European Journal of Clinical Nutrition: Beyond weight loss: a review of the therapeutic uses of very-low-carbohydrate (ketogenic) diets
Author’s note: I want to stress again the importance of consulting with your doctor before you try ketogenic dieting. The more I study this area of science, the more I realize that every individual is extremely unique when it comes to health issues and there are a ton of reasons why you should NOT go full-on keto (especially if you are prone to kidney, heart, or gallbladder issues). That being said, for many people this form of eating is life changing, and the amount of scientific research supporting a ketogenic lifestyle is significantly increasing. Subscribe to my newsletter to stay posted when I publish new articles, and I’d appreciate any and all feedback/corrections on the content I’ve written above. Thanks! (Image credit)
|
https://ketoschool.com/the-43-health-benefits-of-ketogenic-dieting-in-addition-to-weight-loss-1e4ee4743f1f
|
['Will Little']
|
2020-07-25 16:19:24.818000+00:00
|
['Weight Loss', 'Health', 'Life Hacking', 'Keto', 'Nutrition']
|
Title 43 health benefit ketogenic dieting addition weight lossContent unfamiliar ketogenic dieting diet plan “lowcarb” enough switch body state producing burning significant amount ketone specifically acetoacetate AcAc derivative betahydroxybutyrate BHB acetone Click visit recent version article subscribe newsletter follow along write ketosis health science topic interested background reading I’ve previously written summary article science fat metabolism ketosis molecule especially AcAc BHB used brain tissue energy facilitate number health benefit I’ll address biological process involved extremely complex I’d invite use beginning important conversation doctor explore together Indeed ketogenic dieting may may appropriate please consult doctor experimenting Click join newsletter I’ll keep posted get new article FYI head also write entrepreneurship web development started writing fat metabolism ketogenic dieting KetoSchool pure hobby interest relatively resource teach underlying science Focusing brain increased memory cognition clarity seizure control le migraine Ketogenic diet notably first used Mayo Clinic 1920s treat child epilepsy exact mechanism seizure prevention ketogenic diet still mystery researcher believe something increased stability neuron upregulation brain mitochondrion mitochondrial enzyme Related research serious attention given ketogenic dieting Alzheimers Disease Scientists discovered increased cognition enhanced memory adult impairment area growing body research show improvement stage dementia Ketosis shown effective Parkinson’s disease well broader audience dieter oftenreported side effect increased mental clarity focus le frequent le intense migraine likely related stable blood sugar altered brain chemistry improves memory cognition well Fighting type cancer Dom D’Agostino’s lab published article 2014 entitled “Ketone supplementation decrease tumor cell viability prolongs survival mouse metastatic cancer” important background abstract Cancer cell express abnormal metabolism characterized increased glucose consumption owing genetic mutation mitochondrial dysfunction Previous study indicate unlike healthy tissue cancer cell unable effectively use ketone body energy Furthermore ketone inhibit proliferation viability cultured tumor cell good overview article recent animal study includes 2013 article Dom’s lab course please ignore doctor’s advice come cancer treatment — like many topic addressed article — may helpful bring conversation Preventing Heart Disease lower blood pressure lower triglyceride better cholesterol profile related downstream effect keeping blood glucose low stable ketogenic dieting help keep blood pressure check lower triglyceride level may seem counterintuitive eating higher percentage fat diet lower triglyceride turn consumption excess carbs especially fructose key driver increasing triglyceride regarding HDL LDL particle body us move fat cholesterol around ketogenic dieting help raise HDL “good cholesterol” improve profile LDL “bad cholesterol” Decreasing inflammation improves acne arthritis eczema psoriasis IBS pain etc… Nature Medicine article last year found likely mechanism behind people known decade ketogenic dieting profoundly antiinflammtory help host related health problem researcher found “the antiinflammatory effect caloric restriction ketogenic diet may linked BHBmediated inhibition NLRP3 inflammasome” word key player many inflammatory disease suppressed BHB one main ketone produced ketogenic diet Thus implication arthritis acne psoriasis eczema IBS disease involving inflammation pain significant enough prompting research attention Improving energy level sleep day 4 5 ketogenic diet people report increase general energy level lack craving carbs mechanism involves stabilization insulin level readily available source energy brain body tissue Sleep improvement bit mystery Studies shown ketogenic dieting improves sleep decreasing REM increasing slowwave sleep pattern exact mechanism unclear likely related complex biochemical shift involving brain’s use ketone energy combined body tissue directly burning fat Keeping uric acid level check helping kidney function preventing gout common cause kidney stone gout elevated uric acid calcium oxalate phosphorus level result complex combination unlucky genetics dehydration obesity sugar consumption especially fructose eatingdrinking thing lot purine alcohol eg meat beer important caveat ketogenic diet temporarily raise uric acid level — especially dehydrated — time come …uric acid go promptly time frame ketone go 4–6 week despite ketone staying uric acid start come back Based data clinical observation thousand patient uric acid return prediet baseline within 6–12 week despite person remaining state nutritional ketosis Assisting gastrointestinal gallbladder health le heartburn acid reflux le risk gallstone improved digestion le gas bloating well known grainbased food nightshade vegetable like potato tomato sugary food increase likelihood acid reflux heartburn Therefore it’s surprising eating lowcarb diet improves symptom actually confronts root problem inflammation bacterial issue autoimmune response Related known change diet rapidly reproducibly alters human gut microbiome Dr Eric Westman describes length host problem significantly reduced removed result microbiome change ketogenic diet …by taking away carbohydrate food pretty much fix every gastrointestinal problem affect people today Research also show carbs diet one key ingredient gallstone Somewhat counterintuitively eating sufficient amount fat carb intake help clear gallbladder keep thing running smoothly prevent gallstone forming Battling wide variety neurologic metabolic disease Kristin W Barañano MD PhD Adam L Hartman MD published review 2008 discussing potential mechanism ketogenic diet treat following disease Serious attention also given treating Multiple Sclerosis ketogenic diet based similar mechanism Assisting Women’s Health increased fertility stabilizing hormone extensive review published 2013 looked research evidence ketogenic diet enhancing fertility long story short look promising Studies also show Polycystic Ovary Syndrome PCOS treated effectively lowcarb dieting reduces eliminates symptom infrequent prolonged menstrual period acne obesity Overall keeping blood sugar level low stable result lower overall level insulin blood help equilibrate stabilize hormone level especially woman naturally downstream benefit wide variety metabolic pathway related insulin hunger energy utilization Helping eye stable vision le risk cataract diabetic tell well known high blood sugar detrimental effect eyesight lead increased risk cataract It’s therefore surprising keeping blood sugar level low improves eye vision health gazillion people shared online related diabetes research proven Gaining muscle improving endurance BHB specifically shown promote muscle gain Combined ton anecdotal evidence year entire movement behind bodybuilder using ketogenic approach gain muscle le fat typically muscle gain also come fat gain there’s understandable attention given toward preventing addition Dr Stephen Phinney Dr Jeff Volek number paper published ketogenic dieting ultraendurance athlete short athlete fully fatadapted evidence suggest mental physical performance significantly improved beyond “normal” carbohydraterich diet last least curbing diabetes obesity metabolic syndrome sparing muscle loss course 160 research paper currently Pubmed word “diabetes” “ketosis” “ketogenic” title alone It’s beyond clear ketogenic dieting extremely effective many people type type II diabetes reason discussed related keeping blood sugar level insulin check addition recent paper within last year investigating effect ketogenic dieting obesity conclude it’s extremely effective way lose fat spare muscle loss curbing many disorder related obesity well many discussed including set symptom risk factor known Metabolic Syndrome ie abdominal obesity diabetes hypertension elevated cholesterol — reading would recommend 2013 review article European Journal Clinical Nutrition Beyond weight loss review therapeutic us verylowcarbohydrate ketogenic diet Author’s note want stress importance consulting doctor try ketogenic dieting study area science realize every individual extremely unique come health issue ton reason go fullon keto especially prone kidney heart gallbladder issue said many people form eating life changing amount scientific research supporting ketogenic lifestyle significantly increasing Subscribe newsletter stay posted publish new article I’d appreciate feedbackcorrections content I’ve written Thanks Image creditTags Weight Loss Health Life Hacking Keto Nutrition
|
187,981 |
The 90-Day Ketogenic Diet & Intermittent Fasting Experiment: How Does It Work?
|
45 days into the experiment.
For the next 3 months, I decided to eat +160g of fat a day. Why would I do something this stupid, you ask? Because I am trying to get into the best shape of my life while increasing longevity.
Most of my life I have tried to find ways to optimize my body’s potential. Because of this, I have had the opportunity of trying numerous diets and training styles claiming to be the best.
If you have spent any time looking for a diet program on the internet, you know exactly what I am talking about. Every few years there’s some new miracle health secret being discussed or marketed all over social media sites like Facebook and Reddit. These fads even infiltrate top-level health forums and have fitness “gurus” swearing they are the answer to your prayers.
The ketogenic diet, however, is different. It has changed my life, and it deserves your attention. Not only has it helped me reduce my body fat and improved my cholesterol levels, but it also helped me feel more energetic in my day-to-day life and reduced my joint pain.
The ketogenic diet is a low-carb/high-fat diet that has been gaining popularity in recent years because of its very specific approach to controlling one’s weight.
The ketogenic diet certainly isn’t a “one-size-fits-all” solution, no diet is. However, since it has done wonders on my body, I am compelled to share more about it.
Because I had a lot of friends asking me about how I got in such great shape and why I looked/felt so healthy, I decided to perform an experiment and show others how this diet/lifestyle works. Providing a guide of sorts so other may test it out for themselves.
I also received a lot of pushback from friends who thought what I am doing is unhealthy.
I decided to do this study to show them that the program works and to dispel whatever misconception they have about the Keto diet and Intermittent Fasting.
At the end of the day, I am hoping that this study will inspire those who want to try the program to take action so they can experience a healthier and better life.
What is the Keto Diet:
Put simply; the ketogenic diet is a diet that is high in fat and very low in carbs which forces your body to start a process called nutritional ketosis. This means your body starts to burn stored fats for energy due to the lack of glucose in the bloodstream.
Glucose, also known as the body’s primary fuel source, is converted from carbohydrates. This is found in dozens of everyday food items — from white bread to fruits and vegetables.
Limiting these carb-rich foods to 25g a day is paramount to the ketogenic diet, but it doesn’t stop there.
To supply your body’s nutritional needs while maintaining ketosis, you will actually shift to eating high-fat foods with a moderate amount of protein. For example Fish, certain nuts, eggs, and most meat sources.
I use this Macro Calculator to figure out where my calories need to come from https://ketogains.com/ketogains-calculator/
Note: These macros are more of a guideline and not the rule.
As far as benefits go, the keto diet is usually applied with weight loss in mind. However, it is also shown to result in a number of benefits including increased energy levels, healthier inflammatory response, and improved blood sugar balance (among other things).
What is Intermittent Fasting:
For those who do not know what Intermittent Fasting (IF) is, it is basically a “cycle” between periods of fasting and healthy eating (NOT OVEREATING.)
A popular form of IF is the 16/8 method which entails fasting for 16 hours every day with an 8-hour eating window. Traditionally, during the fast you only consume water. However, some have been known to drink black coffee as there is some debate as to its effects on autophagy and fat loss.
I will be doing a full 24hrs worth of fasting before consuming my food. During every fast I will drink 3L of water so that I can keep my body hydrated and running efficiently.
With IF, insulin levels drop significantly — thus, accelerating the fat-burning mechanism of the body. It is also shown to reduce free radicals and boost the cellular repair processes in the body.
While there is undoubtedly more to IF than what I have mentioned, the above notes cover what you need to know for this study.
Combining the Keto Diet with Intermittent Fasting
By understanding their individual uses, you may think that the Keto diet and IF will be too taxing on the body when used together.
However, Based on my research, I believe that I have found the perfect way to piece them together into a single system and with the right implementation, one can incorporate the effects of being in ketosis with that of fasting.
For example, while gaining muscle mass is much harder with a ketogenic diet, IF solves this by improving the body’s insulin sensitivity, blood glucose regulation, and growth hormone production.
Fasting can also help your body achieve ketosis much faster.
Once you are in ketosis, it will be much easier to stick to your IF schedule since you will experience fewer hunger pains.
Remember that IF keeps your metabolism high, which helps you adapt quickly to your reduced carb intake.
Finally, being in ketosis while fasting allows your body to start using your body fat as a fuel source which leads to lower BF% and a leaner body overall.
If all these are proven to be true, then the Keto and IF combination would be a breakthrough.
With this 90-day Keto & IF experiment, I aim to affirm these claims by using my own body.
My Motivation
People commit to many diets and fitness routines for various reasons. Some do it to overcome physical concerns while others simply want to preserve good health.
My motivation for this routine is simple: I just want my passion and experiences to impact other people’s lives positively.
By acting as a “first-mover,” I hope to encourage readers to join the experiment and experience a healthier and better life.
I also want to help my medical friends and vegan followers to obtain a deeper understanding of how these practices affect the body.
Additionally, there’s a bonus for me as a biohacker looking to fully explore my body’s potential — as far as my DNA allows.
Without further ado, let’s get down to the nitty-gritty of the experiment.
Here’s the breakdown of the experiment:
Purpose:
To test my hypothesis that a high-fat diet, like the Keto diet, in conjunction with intermittent fasting can help fight high cholesterol, increase HDL, decrease body fat, decrease/eliminate joint pains, and accelerate muscle growth.
Objective Measurements:
Throughout this experiment, I will use the following key measurements to track my progress:
• Reductions in body fat percentage
• Increases in muscle mass
• Improvements in endurance and strength at the gym (See Google Sheets)
While I have calculated measurements of these pieces of information, I will be using DexaFit scans for confirmation purposes.
All of these will be recorded and tracked in Google Sheets and available once the experiment has concluded.
Start Date:
10/01/2017
Finish Date:
12/29/2017
Calorie Stats:
My BMR: 1697/cals
Calories Consumed (T/Th/Sat/Sun): 2196/cals
Calories Consumed (After 24hr Fast): 400cals
Resources:
I will be honest, coming across Ruled.me definitely made transitioning into this lifestyle a lot easier. They have been a huge resource around understanding certain aspects of the Ketogenic diet, and they provide a number of fun recipes that make food fun.
Another great resource has been Dominic D’Agostino (@DominicDAgosti2) and the work he is doing with the ketogenic diet. After hearing him speak on The Joe Rogan Podcast (Ep:994), I was excited to find more information from him.
I recommend both of these resources for anyone wanting to understand more about the ketogenic diet or trying to answer questions that they might have about the diet.
Process:
To summarize this experiment, I will be following the ketogenic diet for 90-days without taking a break. I will also be fasting for 24hrs on Mondays, Wednesdays, and Fridays. By the end of each 24 hours, I will workout and cap it off with a keto meal that only has 25 grams of carbs and a load of fat. On Tuesdays, Thursdays, Saturdays, and Sundays, I will be eating 3–4 meals.
The majority of my calories will be consumed on my non-workout days. On non-fasting days I will be consuming a normal amount of calories, as I am not looking to make up for the calories, I did not consume during my fast.
During the fast the only thing I will be consuming is water. No black coffee. No zero calorie foods or beverages. WATER ONLY.
Workout and Cardio:
On Mondays, I will be working out Back and Bi’s. On Wednesdays, I will be working out chest, Shoulders, and Triceps. On Fridays, I will be doing Legs.
My exercises follow a TUT (time under tension) style. Doing 4 sets of 12–8 reps starting with lighter weight and gradually increasing.
Speed is the name of the game with contracting/squeezing the muscle and slowing down when releasing the weight (similar to performing a negative rep.)
With a 60sec rest period. All workouts will consist of 6–9 exercises total based on the body part or parts that are being trained that day.
It is important to note that no variables are changing in regards to my workout, from before or during the experiment. This is the same training style I have used for the last couple years. The only things that change are the amount of weight at which I use. As my strength goes up, I go up in weight to keep the same type of rep range and difficulty.
At the end of every workout, I do 13 minutes of HIIT cardio.
To keep my energy levels up during strength training, I use a couple of pre-workout supplements: For energy and pump I take Naked Energy (It’s Keto Approved), and for strength and endurance I mix in a scoop of Julian Bakery exogenous ketones. I have found that this really takes my workouts to the next level. I always suggest getting these two supplements to anyone that wants to get into keto.
Why I Do Cardio After My Workout
I keep my cardio towards the end of a workout, always. I do this because I’ve learned that lifting before cardio is much better for fat loss and workout energy efficiency. It takes a lot of effort to move heavy weights, so I do not want to waste it all by running beforehand!
To achieve a ripped/lean look your body needs to use your stored fat as fuel. In order to do this, you must burn off your glycogen stores first. When you lift weights, you typically use glycogen as fuel. By lifting weights before cardio, you can burn the majority of your glycogen stores. Knocking out your cardio after you crush the weights will burn more fat!
If You Aren’t Tracking It, You Aren’t Measuring It
For the sake of this experiment, I decided to get some baseline data on the measurements I am tracking.
First of all, I got my blood tested to acquire the necessary information, such as my thyroid stimulating hormone, cholesterol, triglycerides, HDL, and LDL.
The next thing I did was obtain my DexaFit scans, which gave me data about my body fat percentage, muscle mass profile, and other physiological data.
Here are the results:
• Total Body Fat Percentage: 17.6% (translates to 8–9% BF using calipers)
• Total Mass: 164.4 lbs.
• Fat Tissue: 28.9 lbs.
• Lean Tissue: 128.8 lbs.
• BMC: 6.7 lbs.
• Visceral Fat: 0.37 lbs.
My Starting Pictures
|
https://medium.com/the-ketogenic-diet-and-intermintent-fasting-bible/the-90-day-ketogenic-diet-intermittent-fasting-experiment-how-does-it-work-d40e9a78f2f1
|
['Rand Owens']
|
2018-07-14 17:33:13.098000+00:00
|
['Weight Loss', 'Intermittent Fasting', 'Fat Loss', 'Keto', 'Nutrition']
|
Title 90Day Ketogenic Diet Intermittent Fasting Experiment WorkContent 45 day experiment next 3 month decided eat 160g fat day would something stupid ask trying get best shape life increasing longevity life tried find way optimize body’s potential opportunity trying numerous diet training style claiming best spent time looking diet program internet know exactly talking Every year there’s new miracle health secret discussed marketed social medium site like Facebook Reddit fad even infiltrate toplevel health forum fitness “gurus” swearing answer prayer ketogenic diet however different changed life deserves attention helped reduce body fat improved cholesterol level also helped feel energetic daytoday life reduced joint pain ketogenic diet lowcarbhighfat diet gaining popularity recent year specific approach controlling one’s weight ketogenic diet certainly isn’t “onesizefitsall” solution diet However since done wonder body compelled share lot friend asking got great shape lookedfelt healthy decided perform experiment show others dietlifestyle work Providing guide sort may test also received lot pushback friend thought unhealthy decided study show program work dispel whatever misconception Keto diet Intermittent Fasting end day hoping study inspire want try program take action experience healthier better life Keto Diet Put simply ketogenic diet diet high fat low carbs force body start process called nutritional ketosis mean body start burn stored fat energy due lack glucose bloodstream Glucose also known body’s primary fuel source converted carbohydrate found dozen everyday food item — white bread fruit vegetable Limiting carbrich food 25g day paramount ketogenic diet doesn’t stop supply body’s nutritional need maintaining ketosis actually shift eating highfat food moderate amount protein example Fish certain nut egg meat source use Macro Calculator figure calorie need come httpsketogainscomketogainscalculator Note macro guideline rule far benefit go keto diet usually applied weight loss mind However also shown result number benefit including increased energy level healthier inflammatory response improved blood sugar balance among thing Intermittent Fasting know Intermittent Fasting basically “cycle” period fasting healthy eating OVEREATING popular form 168 method entail fasting 16 hour every day 8hour eating window Traditionally fast consume water However known drink black coffee debate effect autophagy fat loss full 24hrs worth fasting consuming food every fast drink 3L water keep body hydrated running efficiently insulin level drop significantly — thus accelerating fatburning mechanism body also shown reduce free radical boost cellular repair process body undoubtedly mentioned note cover need know study Combining Keto Diet Intermittent Fasting understanding individual us may think Keto diet taxing body used together However Based research believe found perfect way piece together single system right implementation one incorporate effect ketosis fasting example gaining muscle mass much harder ketogenic diet solves improving body’s insulin sensitivity blood glucose regulation growth hormone production Fasting also help body achieve ketosis much faster ketosis much easier stick schedule since experience fewer hunger pain Remember keep metabolism high help adapt quickly reduced carb intake Finally ketosis fasting allows body start using body fat fuel source lead lower BF leaner body overall proven true Keto combination would breakthrough 90day Keto experiment aim affirm claim using body Motivation People commit many diet fitness routine various reason overcome physical concern others simply want preserve good health motivation routine simple want passion experience impact people’s life positively acting “firstmover” hope encourage reader join experiment experience healthier better life also want help medical friend vegan follower obtain deeper understanding practice affect body Additionally there’s bonus biohacker looking fully explore body’s potential — far DNA allows Without ado let’s get nittygritty experiment Here’s breakdown experiment Purpose test hypothesis highfat diet like Keto diet conjunction intermittent fasting help fight high cholesterol increase HDL decrease body fat decreaseeliminate joint pain accelerate muscle growth Objective Measurements Throughout experiment use following key measurement track progress • Reductions body fat percentage • Increases muscle mass • Improvements endurance strength gym See Google Sheets calculated measurement piece information using DexaFit scan confirmation purpose recorded tracked Google Sheets available experiment concluded Start Date 10012017 Finish Date 12292017 Calorie Stats BMR 1697cals Calories Consumed TThSatSun 2196cals Calories Consumed 24hr Fast 400cals Resources honest coming across Ruledme definitely made transitioning lifestyle lot easier huge resource around understanding certain aspect Ketogenic diet provide number fun recipe make food fun Another great resource Dominic D’Agostino DominicDAgosti2 work ketogenic diet hearing speak Joe Rogan Podcast Ep994 excited find information recommend resource anyone wanting understand ketogenic diet trying answer question might diet Process summarize experiment following ketogenic diet 90days without taking break also fasting 24hrs Mondays Wednesdays Fridays end 24 hour workout cap keto meal 25 gram carbs load fat Tuesdays Thursdays Saturdays Sundays eating 3–4 meal majority calorie consumed nonworkout day nonfasting day consuming normal amount calorie looking make calorie consume fast fast thing consuming water black coffee zero calorie food beverage WATER Workout Cardio Mondays working Back Bi’s Wednesdays working chest Shoulders Triceps Fridays Legs exercise follow TUT time tension style 4 set 12–8 rep starting lighter weight gradually increasing Speed name game contractingsqueezing muscle slowing releasing weight similar performing negative rep 60sec rest period workout consist 6–9 exercise total based body part part trained day important note variable changing regard workout experiment training style used last couple year thing change amount weight use strength go go weight keep type rep range difficulty end every workout 13 minute HIIT cardio keep energy level strength training use couple preworkout supplement energy pump take Naked Energy It’s Keto Approved strength endurance mix scoop Julian Bakery exogenous ketone found really take workout next level always suggest getting two supplement anyone want get keto Cardio Workout keep cardio towards end workout always I’ve learned lifting cardio much better fat loss workout energy efficiency take lot effort move heavy weight want waste running beforehand achieve rippedlean look body need use stored fat fuel order must burn glycogen store first lift weight typically use glycogen fuel lifting weight cardio burn majority glycogen store Knocking cardio crush weight burn fat Aren’t Tracking Aren’t Measuring sake experiment decided get baseline data measurement tracking First got blood tested acquire necessary information thyroid stimulating hormone cholesterol triglyceride HDL LDL next thing obtain DexaFit scan gave data body fat percentage muscle mass profile physiological data result • Total Body Fat Percentage 176 translates 8–9 BF using caliper • Total Mass 1644 lb • Fat Tissue 289 lb • Lean Tissue 1288 lb • BMC 67 lb • Visceral Fat 037 lb Starting PicturesTags Weight Loss Intermittent Fasting Fat Loss Keto Nutrition
|
187,982 |
10 Weight-Loss Recommendations
|
Eat breakfast every day.
You will likely not lose weight if you skip breakfast. You may be missing out on important nutrients, and you may find yourself nibbling more during the day as a result of your hunger. When you are hungry during the day, you are more likely to grab an easy snack. You are better off, in most situations, when you eat healthy, filling breakfast. Check out healthy recipes on pinterest
2. Consume a healthy diet rich in fruits and vegetables.
Fruit and vegetables are low in calories, fat, and fiber, all of which are important for weight loss. They’re high in vitamins and minerals, as well. I assume I don’t have to mention why fruits and vegetables are healthy, but this is just your reminder to eat your fruits and vegetables!
3. Discover your inner drive.
Nobody else has the power to make you lose weight. To pleasure yourself, you must make dietary and activity modifications. What will motivate you to stay on track with your weight-loss goals?
Make a list of what matters to you to stay motivated and focused, whether it’s a pending vacation or improved general health. Then figure out how to make sure you can use your motivational resources during times of temptation. You may find it helpful to write down your goals and to remind yourself of them daily, when your goal is straight and clear, you are more likely to stick to your plan. So put a paper on your fridge or door.
While you must take responsibility for your own conduct in order to lose weight, having the appropriate kind of support can assist. Choose people who will encourage you in a positive manner, free of shame, embarrassment, or sabotage.
Find people who will listen to your concerns and thoughts, spend time exercising with you or preparing healthy meals with you, and share your commitment to living a healthier lifestyle. Accountability from your support group can be a powerful motivator for sticking to your weight-loss objectives. And maybe joining some Facebook groups on the topic of your choice will help you to find those people.
4. Increase your physical activity.
While you can lose weight without exercise, combining it with calorie restriction can help you lose weight faster. Exercise can help you burn calories that you can’t get rid of through diet alone.
Exercise also has a variety of health benefits, such as improving your mood, strengthening your cardiovascular system, and lowering your blood pressure. Exercise might also aid in weight loss maintenance. Additionally building muscle by exercising can help you lose weight since your BMR (Basal Metabolic Rate) increases, which means your daily calorie need will increase, even the slightest increase can be helpful over the long-term.
Any additional movement aids in the process of burning calories. If you can’t fit in formal exercise on a given day, consider strategies to enhance your physical activity throughout the day. Instead of taking the elevator, go up and down the stairs, or park at the far end of the parking lot when shopping.
5. Use a plate that is smaller.
Smaller plates can assist you in eating smaller meals. You might be able to gradually get used to eating smaller portions without becoming hungry if you use smaller dishes and bowls. Psychologists say that it can help some people to eat less. So eat carefully and stop when you’re satisfied and don’t eat until you are full.
6. Get rid of all liquid calories.
Drinking sugar-sweetened soda, tea, juice, or wine can add up to hundreds of calories every day. These are referred to as “empty calories” since they supply more energy without providing any nutritious value.
Unless a smoothie is being consumed to substitute a meal, people should stick to water, unsweetened tea, or coffee. Water with a dash of fresh lemon or orange can also be flavorful. Later in this article, we will speak about smoothies more.
Dehydration should not be confused with hunger. A glass of water can typically satisfy hunger pangs between scheduled meal times.
7. Reduce your alcohol consumption.
A typical glass of wine has around the same amount of calories as a piece of chocolate. Drinking too much can easily lead to weight gain over time. Check calories and maybe switch your drinks to more fitting options whenever you do decide to drink. Check out calories in some alcoholic drinks
8. Make a meal plan
Plan your breakfast, lunch, dinner, and snacks for the week so you don’t go over your calorie limit. Making a weekly grocery list may be beneficial. I personally find it really helpful to plan meals and stick to certain times to eat. When I eat too late or too early, I get hungry at random times and tend to grab myself an easy snack and often these snacks deviate from your plan. Snacking is okay, but you have to give yourself space within your diet. I personally used ‘MyFitnessPal’ to track my calories. This app is simple to easy and has great features to make it easier to track calories.
9. Choose your diet carefully
You have plenty of options for a diet. If you are planning to start a diet you might have come across diets like: Keto diet, intermediate fasting or smoothie diets.
Keto diet ( Low carbohydrates / No carbs )
Within this diet you generally don’t track calories, but you plan your meals and try to get your calories from protein and healthy fats. Sometimes, it can still be helpful to track calories. The assumption is that the meals will fill you up without many calories. If want to know more about this diet and need to help: Click Here To Check Custom Keto Diet
2. Intermediate fasting
Intermediate fasting is basically setting yourself a time limit to eating, so you eat whatever you want between 12am-6pm. The assumption is that you will eat less because you are eating for a shorter time. This is helping a lot of people and it could be something for you!
3. Smoothie diet
Would you rather have a short period diet and then stay eating healthy after, then you can start with a smoothie diet. Smoothie diets can help rapid weight loss and increase your health, but here is your reminder that too rapid is unhealthy for you. Check out this astonishing smoothie diet
10. Maintain an optimistic attitude.
Weight loss is a gradual process, and if the pounds do not come off as quickly as expected, a person may become disheartened. When it comes to sticking to a weight reduction or maintenance program, some days will be more difficult than others. When self-change appears to be too difficult, a successful weight-loss program demands the individual to persevere and not give up.
Some people may need to reset their objectives, possibly by changing their exercise patterns or lowering the total number of calories they want to consume. The most important thing is to maintain a positive attitude and persevere in conquering the obstacles to weight loss achievement.
|
https://medium.com/@milanv02/10-weight-loss-recommendations-5df24995d0c8
|
[]
|
2021-12-17 15:14:14.985000+00:00
|
['Diet', 'Weight Loss', 'Ketogenic Diet', 'Health', 'Keto']
|
Title 10 WeightLoss RecommendationsContent Eat breakfast every day likely lose weight skip breakfast may missing important nutrient may find nibbling day result hunger hungry day likely grab easy snack better situation eat healthy filling breakfast Check healthy recipe pinterest 2 Consume healthy diet rich fruit vegetable Fruit vegetable low calorie fat fiber important weight loss They’re high vitamin mineral well assume don’t mention fruit vegetable healthy reminder eat fruit vegetable 3 Discover inner drive Nobody else power make lose weight pleasure must make dietary activity modification motivate stay track weightloss goal Make list matter stay motivated focused whether it’s pending vacation improved general health figure make sure use motivational resource time temptation may find helpful write goal remind daily goal straight clear likely stick plan put paper fridge door must take responsibility conduct order lose weight appropriate kind support assist Choose people encourage positive manner free shame embarrassment sabotage Find people listen concern thought spend time exercising preparing healthy meal share commitment living healthier lifestyle Accountability support group powerful motivator sticking weightloss objective maybe joining Facebook group topic choice help find people 4 Increase physical activity lose weight without exercise combining calorie restriction help lose weight faster Exercise help burn calorie can’t get rid diet alone Exercise also variety health benefit improving mood strengthening cardiovascular system lowering blood pressure Exercise might also aid weight loss maintenance Additionally building muscle exercising help lose weight since BMR Basal Metabolic Rate increase mean daily calorie need increase even slightest increase helpful longterm additional movement aid process burning calorie can’t fit formal exercise given day consider strategy enhance physical activity throughout day Instead taking elevator go stair park far end parking lot shopping 5 Use plate smaller Smaller plate assist eating smaller meal might able gradually get used eating smaller portion without becoming hungry use smaller dish bowl Psychologists say help people eat le eat carefully stop you’re satisfied don’t eat full 6 Get rid liquid calorie Drinking sugarsweetened soda tea juice wine add hundred calorie every day referred “empty calories” since supply energy without providing nutritious value Unless smoothie consumed substitute meal people stick water unsweetened tea coffee Water dash fresh lemon orange also flavorful Later article speak smoothy Dehydration confused hunger glass water typically satisfy hunger pang scheduled meal time 7 Reduce alcohol consumption typical glass wine around amount calorie piece chocolate Drinking much easily lead weight gain time Check calorie maybe switch drink fitting option whenever decide drink Check calorie alcoholic drink 8 Make meal plan Plan breakfast lunch dinner snack week don’t go calorie limit Making weekly grocery list may beneficial personally find really helpful plan meal stick certain time eat eat late early get hungry random time tend grab easy snack often snack deviate plan Snacking okay give space within diet personally used ‘MyFitnessPal’ track calorie app simple easy great feature make easier track calorie 9 Choose diet carefully plenty option diet planning start diet might come across diet like Keto diet intermediate fasting smoothie diet Keto diet Low carbohydrate carbs Within diet generally don’t track calorie plan meal try get calorie protein healthy fat Sometimes still helpful track calorie assumption meal fill without many calorie want know diet need help Click Check Custom Keto Diet 2 Intermediate fasting Intermediate fasting basically setting time limit eating eat whatever want 12am6pm assumption eat le eating shorter time helping lot people could something 3 Smoothie diet Would rather short period diet stay eating healthy start smoothie diet Smoothie diet help rapid weight loss increase health reminder rapid unhealthy Check astonishing smoothie diet 10 Maintain optimistic attitude Weight loss gradual process pound come quickly expected person may become disheartened come sticking weight reduction maintenance program day difficult others selfchange appears difficult successful weightloss program demand individual persevere give people may need reset objective possibly changing exercise pattern lowering total number calorie want consume important thing maintain positive attitude persevere conquering obstacle weight loss achievementTags Diet Weight Loss Ketogenic Diet Health Keto
|
187,983 |
Loss 30 kg in just 90 days
|
Would You Like to Know Exactly What to Eat to Lose Fat and Get Healthy Without Giving Up Your Favorite Foods or Starving Yourself?
Buy this product to loss your fat
https://742d20lip3pb3o8tl8xa6l6k5w.hop.clickbank.net/
Obesity is now being called an epidemic in the health community. In fact, it will soon be the leading cause of preventable death in the United States, even ahead of cigarette smoking. Obesity leads to type two diabetes, high blood pressure, heart disease or stroke and even an increased risk of cancer. With all of these health risks, as well as the general improvement in the quality of life that can occur, losing weight is one of the best things that you can do for yourself.
No matter what we would like to believe, there simply isn’t a magic solution to losing weight. The body will shed excess fat when it needs more calories to function through the demands you place on it in a given day than the amount of calories that you feed it. It’s that simple. So, in order to lose weight, you need to decrease the number of calories that you eat as well as increase the amount that you burn.
There is a wide range of options to choose from when looking for a weight loss program. All of them often spend a lot of time explaining what to eat, in what amounts and even at what times or in what combinations. But few of them emphasize the importance of exercise – not just for losing weight, but for your general health and wellbeing. Exercise is vital when trying to lose weight for several reasons:
Buy this product to loss your fat
https://742d20lip3pb3o8tl8xa6l6k5w.hop.clickbank.net/
First, as you start to eat less, your metabolism will slow down somewhat. Exercising helps to elevate your metabolism back to an efficient level.Second, as mentioned, exercise burns more calories so that you can lose weight faster and stay motivated in your efforts.Third, exercise actually releases endorphins, chemicals that keep your mood elevated.
Exercise doesn’t have to mean spending hours at the gym or straining through exhausting workouts. In fact, in order for you to stick with it on the long run, exercising should be something that you enjoy. Start by increasing your activity level in an overall way. Take the stairs when you can. Park further from the mall door when you go shopping. Go for a walk in the park or through a neighborhood you love and bring a dog or a friend along for company. Take dance or martial arts lessons.
Buy the product
https://742d20lip3pb3o8tl8xa6l6k5w.hop.clickbank.net/
Once you become more active in general, you’ll find it easier and more natural to move into regular exercise. Which you’ll need to do eventually in order to get regular, noticeable health benefits. You need to raise your heart rate to a fat burning level and keep it there for at least 20 minutes, 3 times or more a week. However, if you don’t want to go to a gym, there are other options. Videos and DVDs are now available in all kinds of exercise types. That way you can change your routine whenever you want so that you don’t get bored with what you’re doing. Try a range of aerobics, kickboxing, yoga, or pretty much any activity you want right in the comfort of your own home.
If you have physical limitations that would keep you off from exercising, you can still find a way to increase your activity level. Water aerobics is a wonderful option for those who have joint problems or limited mobility because it relieves the pressure on your body that your weight provides. But you still get the resistance to challenge your muscles from the water. There are even classes and videos available that let you exercise in a seated position.
Whatever kind of exercise you choose, it’s important to stay motivated and keep it fun. Try gathering a group together to make it a social event. Or get a pedometer, a device that tracks how far you walk, and see how many miles you can walk a week. Make a competition amongst your friends or family members and treat the winner with something special (not food related!). Make the experience of exercising something that you look forward to, and it will soon become a regular part of your healthier lifestyle.
Buy the product to loss the 50 kg in 90 days click here 👇👇👇👇👇
https://742d20lip3pb3o8tl8xa6l6k5w.hop.clickbank.net/
Thank you for buying this product
https://742d20lip3pb3o8tl8xa6l6k5w.hop.clickbank.net/
|
https://medium.com/@raftarahmad/loss-30-kg-in-just-90-days-1ca7eae207a4
|
['Raftar Ahmad']
|
2021-12-24 09:18:11.131000+00:00
|
['Ketodeit', 'Deit', 'Lossfat', 'Keto']
|
Title Loss 30 kg 90 daysContent Would Like Know Exactly Eat Lose Fat Get Healthy Without Giving Favorite Foods Starving Buy product loss fat https742d20lip3pb3o8tl8xa6l6k5whopclickbanknet Obesity called epidemic health community fact soon leading cause preventable death United States even ahead cigarette smoking Obesity lead type two diabetes high blood pressure heart disease stroke even increased risk cancer health risk well general improvement quality life occur losing weight one best thing matter would like believe simply isn’t magic solution losing weight body shed excess fat need calorie function demand place given day amount calorie feed It’s simple order lose weight need decrease number calorie eat well increase amount burn wide range option choose looking weight loss program often spend lot time explaining eat amount even time combination emphasize importance exercise – losing weight general health wellbeing Exercise vital trying lose weight several reason Buy product loss fat https742d20lip3pb3o8tl8xa6l6k5whopclickbanknet First start eat le metabolism slow somewhat Exercising help elevate metabolism back efficient levelSecond mentioned exercise burn calorie lose weight faster stay motivated effortsThird exercise actually release endorphin chemical keep mood elevated Exercise doesn’t mean spending hour gym straining exhausting workout fact order stick long run exercising something enjoy Start increasing activity level overall way Take stair Park mall door go shopping Go walk park neighborhood love bring dog friend along company Take dance martial art lesson Buy product https742d20lip3pb3o8tl8xa6l6k5whopclickbanknet become active general you’ll find easier natural move regular exercise you’ll need eventually order get regular noticeable health benefit need raise heart rate fat burning level keep least 20 minute 3 time week However don’t want go gym option Videos DVDs available kind exercise type way change routine whenever want don’t get bored you’re Try range aerobics kickboxing yoga pretty much activity want right comfort home physical limitation would keep exercising still find way increase activity level Water aerobics wonderful option joint problem limited mobility relief pressure body weight provides still get resistance challenge muscle water even class video available let exercise seated position Whatever kind exercise choose it’s important stay motivated keep fun Try gathering group together make social event get pedometer device track far walk see many mile walk week Make competition amongst friend family member treat winner something special food related Make experience exercising something look forward soon become regular part healthier lifestyle Buy product loss 50 kg 90 day click 👇👇👇👇👇 https742d20lip3pb3o8tl8xa6l6k5whopclickbanknet Thank buying product https742d20lip3pb3o8tl8xa6l6k5whopclickbanknetTags Ketodeit Deit Lossfat Keto
|
187,984 |
POWER OF KETO DIET
|
CUSTOM KETO DIET
BENEFITS OF KETO DIET:-
#1 — Weight Loss and Weight Loss
One of the great superpowers of the ketogenic diet is that it is highly effective for quick weight loss — especially for people who have a lot of weight to lose.
When compared to low-fat diets, dozens of studies show that a very low-carb diet can help overweight people:
to lose weight,
maintain muscle mass, and
improve several of the risk factors for diabetes and heart disease.
Among these factors, we can include elevated triglycerides, low HDL, and constantly elevated blood glucose.
There is simply no denying that a low-carb diet can be an effective treatment for obesity.
#2 — Blood Glucose Control
Having good blood glucose control seems to be relevant for weight maintenance.
In addition to being important for the prevention of chronic diseases such as diabetes, heart disease, cancer, and possibly even Alzheimer’s.
If your blood sugar levels are always high, you’re much more at risk for dozens of illnesses — and even more likely to die prematurely from those illnesses.
Fortunately, significantly reducing your carbohydrate intake can help control that number — particularly if you’re a sedentary person.
#3 — Treatment of Neurological Conditions
One of the oldest uses of the ketogenic diet in the treatment of seizures.
Remember that a ketogenic diet is a very low-carb diet, that is: very low in carbohydrates.
Doctors and health clinics have been using the ketogenic diet to treat epilepsy since the beginning of the 20th century.
The advent of anticonvulsant drugs has significantly reduced the use of this type of treatment.
However, over the last 20 years, there has been a greater demand for therapeutic uses of the ketogenic diet.
Currently, there are nutritionists who specialize in the ketogenic diet and work with patients who suffer from seizures (especially children).
Other neurological conditions that respond well to a ketogenic diet are:
Parkinson’s disease,
Alzheimer’s disease,
ALS (Amyotrophic Lateral Sclerosis),
spills, and
insanity.
#4 — Mood Enhancement
As with the neurological conditions mentioned above, low-carb or ketogenic diets can help reduce or eliminate the symptoms of conditions such as anxiety or depression.
There is preliminary evidence to suggest that these diets may have similar effects to antidepressant drugs.
Most of the existing research has been conducted on animals, but studies show benefits in improving symptoms such as aggression and fear — in addition to overall mood and quality of life.
However, one study demonstrated a drop in good mood in patients on a low-carb, calorie-restricted diet.
GET YOUR CUSTOM KETO DIET HERE.
THANK YOU:)
BE SAFE AND BE HEALTHY
|
https://medium.com/@mchhetri685/power-of-keto-diet-13c050c777c3
|
['Meena Chhetri']
|
2021-12-21 10:16:27.830000+00:00
|
['Weight', 'Belly Fat', 'Weight Loss', 'Keto', 'Keto Diet']
|
Title POWER KETO DIETContent CUSTOM KETO DIET BENEFITS KETO DIET 1 — Weight Loss Weight Loss One great superpower ketogenic diet highly effective quick weight loss — especially people lot weight lose compared lowfat diet dozen study show lowcarb diet help overweight people lose weight maintain muscle mass improve several risk factor diabetes heart disease Among factor include elevated triglyceride low HDL constantly elevated blood glucose simply denying lowcarb diet effective treatment obesity 2 — Blood Glucose Control good blood glucose control seems relevant weight maintenance addition important prevention chronic disease diabetes heart disease cancer possibly even Alzheimer’s blood sugar level always high you’re much risk dozen illness — even likely die prematurely illness Fortunately significantly reducing carbohydrate intake help control number — particularly you’re sedentary person 3 — Treatment Neurological Conditions One oldest us ketogenic diet treatment seizure Remember ketogenic diet lowcarb diet low carbohydrate Doctors health clinic using ketogenic diet treat epilepsy since beginning 20th century advent anticonvulsant drug significantly reduced use type treatment However last 20 year greater demand therapeutic us ketogenic diet Currently nutritionist specialize ketogenic diet work patient suffer seizure especially child neurological condition respond well ketogenic diet Parkinson’s disease Alzheimer’s disease ALS Amyotrophic Lateral Sclerosis spill insanity 4 — Mood Enhancement neurological condition mentioned lowcarb ketogenic diet help reduce eliminate symptom condition anxiety depression preliminary evidence suggest diet may similar effect antidepressant drug existing research conducted animal study show benefit improving symptom aggression fear — addition overall mood quality life However one study demonstrated drop good mood patient lowcarb calorierestricted diet GET CUSTOM KETO DIET THANK SAFE HEALTHYTags Weight Belly Fat Weight Loss Keto Keto Diet
|
187,985 |
How to use ghee for improved health conditions?
|
There is hardly anyone who hasn’t heard about ghee which is also popular as clarified butter. Ghee is the clarified form of butter that has been simmered to remove the milk solids and evaporate the water content. Now the question is, is ghee bad for you? The answer is no. Ghee is not bad for you when you are having it in moderation. Ghee is a clear-golden cooking oil that is loaded with essential vitamins and essential fatty acids. It is also rich in antioxidants and anti-inflammatory properties.
Ghee is both lactose and casein-free which is good news for people who are officially lactose-intolerant.
Ghee butter is extremely versatile in use. Sprinkle them on a salad, toss them in a smoothie, or spread them on toast.
The high smoke point of ghee is safe for all types of high heat cooking purposes. Baking, grilling, deep-frying, sauteing and several other types of cooing can fone with ghee.
Ghee calories are higher than butter but when taken in moderation ghee can help in weight loss. It is rich in healthy saturated and unsaturated fats which are made of short and medium chain fatty acids.
Is ghee bad for you, should not be in your mind when you have so many ghee benefits. Ghee is scientifically proven for offering a better digestion, immunity, stronger bones, weight management, balancing hormones and much more.
|
https://medium.com/@carinasmith329/how-to-use-ghee-for-improved-health-conditions-7d40fb319fb4
|
['Carina Smith']
|
2021-12-23 14:47:25.928000+00:00
|
['Paleo', 'Ghee', 'Keto', 'Organic', 'Ghee Benefits']
|
Title use ghee improved health conditionsContent hardly anyone hasn’t heard ghee also popular clarified butter Ghee clarified form butter simmered remove milk solid evaporate water content question ghee bad answer Ghee bad moderation Ghee cleargolden cooking oil loaded essential vitamin essential fatty acid also rich antioxidant antiinflammatory property Ghee lactose caseinfree good news people officially lactoseintolerant Ghee butter extremely versatile use Sprinkle salad toss smoothie spread toast high smoke point ghee safe type high heat cooking purpose Baking grilling deepfrying sauteing several type cooing fone ghee Ghee calorie higher butter taken moderation ghee help weight loss rich healthy saturated unsaturated fat made short medium chain fatty acid ghee bad mind many ghee benefit Ghee scientifically proven offering better digestion immunity stronger bone weight management balancing hormone much moreTags Paleo Ghee Keto Organic Ghee Benefits
|
187,986 |
Ketogenic Diet and Sample Diet List
|
Losing weight without being hungry? The ketogenic diet, which has become very popular recently, allows you to effectively burn fat and lose weight without feeling hungry. All you have to do is reduce carbs and increase fat. How?
The ketogenic diet was first used in the 1920s to control epileptic seizures in children with epilepsy. However, nowadays it is used by many people to lose weight. The basis of the ketogenic diet is high-fat, moderatean 50 grams, the body enters ketosis.
Ketosis is a metabolic process that occurs when the body cannot get enough energy from glucose. It requires the elimination of certain nutrients from the diet, such as grains, legumes, sugar, milk and dairy products, fruit and some vegetables. After the body gets used to ketosis, an increase in focus and mental capacity can be observed. In addition, the ketogenic diet helps to break insulin resistance. In addition, since it is a diet rich in protein and fat, the feeling of satiety increases and therefore you will not be hungry.
How Much Weight Can You Lose on the Ketogenic Diet?
With the ketogenic diet, about 2 to 5 kilos can be lost per week. You can see rapid weight loss in the first days of starting the diet. The reason for this is the removal of excess water in the body, namely edema. As the diet progresses, weight loss may slow down. One of the important points to be considered in the ketogenic diet is calorie restriction. Otherwise, you cannot lose weight.
How about the ketogenic diet menu?
As with many diets, you cannot eat whatever you want on the keto diet. But keto is pretty strict, especially when it comes to carbs. In order for your body to enter ketosis mode, you need to cut out carbohydrates almost completely.
Carbs are not only found in unhealthy foods like pastries, but also in some very healthy foods. This is what makes keto a little harder than others. But when your body goes into keto mode, it’s easier because you’re not looking for carbs. Keto means a little patience and more determination at first.
Getting Started on the Keto Diet
It will be helpful to choose keto diet recipes and how to start according to your own habits. For this, you can search the internet thoroughly and find many different options. In general, what you need to know:
Have a very good nutrition plan and plan your meals well. It is very important in the beginning that you do not take any wrong steps.
Calculate daily macro targets
drink a lot of water
Get enough and quality sleep
While the keto diet may seem like a complex system that requires a lot of computation, there are easy ways to do it. First of all, if you are making a macro chart for yourself and you know which foods are beneficial for you and which you should avoid, you can plan your daily and weekly meals by looking at this chart.
|
https://medium.com/@kulacogullari1/ketogenic-diet-and-sample-diet-list-c64ecce15af9
|
[]
|
2021-12-18 07:38:55.045000+00:00
|
['Ketogenic Diet', 'Diet', 'Keto', 'Weigt Loss Tips', 'Keto Diet']
|
Title Ketogenic Diet Sample Diet ListContent Losing weight without hungry ketogenic diet become popular recently allows effectively burn fat lose weight without feeling hungry reduce carbs increase fat ketogenic diet first used 1920s control epileptic seizure child epilepsy However nowadays used many people lose weight basis ketogenic diet highfat moderatean 50 gram body enters ketosis Ketosis metabolic process occurs body cannot get enough energy glucose requires elimination certain nutrient diet grain legume sugar milk dairy product fruit vegetable body get used ketosis increase focus mental capacity observed addition ketogenic diet help break insulin resistance addition since diet rich protein fat feeling satiety increase therefore hungry Much Weight Lose Ketogenic Diet ketogenic diet 2 5 kilo lost per week see rapid weight loss first day starting diet reason removal excess water body namely edema diet progress weight loss may slow One important point considered ketogenic diet calorie restriction Otherwise cannot lose weight ketogenic diet menu many diet cannot eat whatever want keto diet keto pretty strict especially come carbs order body enter ketosis mode need cut carbohydrate almost completely Carbs found unhealthy food like pastry also healthy food make keto little harder others body go keto mode it’s easier you’re looking carbs Keto mean little patience determination first Getting Started Keto Diet helpful choose keto diet recipe start according habit search internet thoroughly find many different option general need know good nutrition plan plan meal well important beginning take wrong step Calculate daily macro target drink lot water Get enough quality sleep keto diet may seem like complex system requires lot computation easy way First making macro chart know food beneficial avoid plan daily weekly meal looking chartTags Ketogenic Diet Diet Keto Weigt Loss Tips Keto Diet
|
187,987 |
Get Your Custom Keto Diet Plan- Now in 2022
|
Do you want to get rid of extra body fat without giving up on your favorite food? Then here is all what you need to know!
Keto diet is a science backed diet plan that not only helps in shedding extra ponds of weight but also have many other health benefits. However, if you don’t follow it accurately, you can suffer from severe health problems.
Let’s get into the details without any further ado!
What is Keto Diet?
Keto diet is a low carb and high fat that puts your body into a metabolic state known as Ketosis. In this state, your body becomes highly efficient in burning fat and use it as an energy source. Besides, it converts fats into ketones that supply energy to the brain.
It also reduces the insulin and blood sugar level and shift body’s metabolism on fats and ketones that has many other health benefits.
Why Keto Diet is Better than Other Fat Loss Programs?
1. Easy to Follow
The Keto diet is pretty simple and easy to follow since you are allowed to eat delicious high fat foods like cheese, egg and steaks.
2. Speed Up Fat Burning
Other diet programs doesn’t lower insulin level and it hinders the fat loss. While in keto diet, your insulin level is dropped so it increases fat burning.
3. Reduce Hunger Cravings
The biggest advantage of keto diet is that it reduces hunger cravings. On the flip side, other diets couldn’t fade hunger cravings and ultimately fail after sometime.
4. Healthy & Safe
Keto diet elevates the level of good HDL cholesterol and reduce blood triglycerides level. This way, it reduces the risk of heart diseases and helps in fighting with some types of cancer. Plus, it reduce depression and have a therapeutic affect against some neurological conditions so, its completely safe and healthy to use.
5. Highly Efficient in Losing Weight
And the biggest advantage, you will automatically start losing the weight along with getting plenty of health benefits.
Note:
But hey, be aware!
Keto diet could be dangerous if you won’t follow it properly as per your body needs. For instance, if you don’t consume enough fat, you will feel more hungry. Then there is a great possibility that you will be tempted to make unhealthy food choices which will ultimately spoil your weight loss journey.
Here is the solution!
Get A Customized Keto Meal Plan According To Your Body, Goals, Taste Buds & Situation
We will provide you a customized meal plan according to your current health conditions and future health goals. Here’s what you will get:
· An eight-week meal plan based on expert’s opinion
· A customized diet according to your ideal macro and calorie intake
· Mouth-watering meals according to your food preferences
· Complete instructions to further customize the meal plan according to your choice
· Meal plan with wide range of food variety
· Easy to follow step by step recipe instruction
Our Pricing
You want to get your dream body but don’t have enough money to invest on expensive meal plans? Then worry no further since we are offering our high-class services with a starting price of merely $37.
Why so low? Because we are on a mission of helping one million men and women around the globe to achieve their health goals.
Also, if you are not satisfied from our meal plans, we’ll give all your money back. So, why are you waiting for? Get your customized meal plan right now!
PRODUCT LINK
|
https://medium.com/@mirzahasecic/get-your-custom-keto-diet-plan-now-in-2022-47c3924b95cc
|
['Mirza Hasecic']
|
2021-12-15 18:25:27.915000+00:00
|
['Diet', 'Ketogenic Diet', 'Health', 'Fitness', 'Keto']
|
Title Get Custom Keto Diet Plan 2022Content want get rid extra body fat without giving favorite food need know Keto diet science backed diet plan help shedding extra pond weight also many health benefit However don’t follow accurately suffer severe health problem Let’s get detail without ado Keto Diet Keto diet low carb high fat put body metabolic state known Ketosis state body becomes highly efficient burning fat use energy source Besides convert fat ketone supply energy brain also reduces insulin blood sugar level shift body’s metabolism fat ketone many health benefit Keto Diet Better Fat Loss Programs 1 Easy Follow Keto diet pretty simple easy follow since allowed eat delicious high fat food like cheese egg steak 2 Speed Fat Burning diet program doesn’t lower insulin level hinders fat loss keto diet insulin level dropped increase fat burning 3 Reduce Hunger Cravings biggest advantage keto diet reduces hunger craving flip side diet couldn’t fade hunger craving ultimately fail sometime 4 Healthy Safe Keto diet elevates level good HDL cholesterol reduce blood triglyceride level way reduces risk heart disease help fighting type cancer Plus reduce depression therapeutic affect neurological condition completely safe healthy use 5 Highly Efficient Losing Weight biggest advantage automatically start losing weight along getting plenty health benefit Note hey aware Keto diet could dangerous won’t follow properly per body need instance don’t consume enough fat feel hungry great possibility tempted make unhealthy food choice ultimately spoil weight loss journey solution Get Customized Keto Meal Plan According Body Goals Taste Buds Situation provide customized meal plan according current health condition future health goal Here’s get · eightweek meal plan based expert’s opinion · customized diet according ideal macro calorie intake · Mouthwatering meal according food preference · Complete instruction customize meal plan according choice · Meal plan wide range food variety · Easy follow step step recipe instruction Pricing want get dream body don’t enough money invest expensive meal plan worry since offering highclass service starting price merely 37 low mission helping one million men woman around globe achieve health goal Also satisfied meal plan we’ll give money back waiting Get customized meal plan right PRODUCT LINKTags Diet Ketogenic Diet Health Fitness Keto
|
187,988 |
The Ketogenic Diet
|
Different types of ketogenic diets
Ketogenic diets come in a variety of flavors.
The ketogenic diet comes in a variety of forms, including:
The standard ketogenic diet (SKD) is a low-carbohydrate, moderate-protein, high-fat diet. It usually has 70 percent fat, 20 percent protein, and barely 10% carbohydrates (9Trusted Source).
The cyclical ketogenic diet (CKD) entails periods of increased carb refeeding, such as five ketogenic days followed by two high carb days.
The targeted ketogenic diet (TKD) permits you to eat carbs in between workouts.
The targeted ketogenic diet (TKD) permits you to eat carbs in between workouts. This ketogenic diet is comparable to a conventional ketogenic diet, however it contains extra protein. Typically, the fat-to-protein-to-carbohydrate ratio is 60% fat, 35% protein, and 5% carbohydrates.
Only the regular and high-protein ketogenic diets have been thoroughly researched. More advanced ketogenic diets, such as cyclical or targeted ketogenic diets, are largely employed by bodybuilders and athletes.
The majority of the material in this page relates to the standard ketogenic diet (SKD), but there are a few exceptions.
What is ketosis?
Ketosis is a metabolic condition in which your body burns fat instead of carbohydrates for energy.
It occurs when you drastically restrict your carbohydrate intake, decreasing your body’s availability of glucose (sugar), which is the cells’ primary source of energy.
The most effective strategy to enter ketosis is to eat a ketogenic diet. This usually entails restricting carb intake to 20 to 50 grams per day and focusing on fats such meat, fish, eggs, nuts, and healthy oils.
Click Here to special
It’s also crucial to keep your protein intake in check. This is because if you eat too much protein, it will be turned to glucose, which will slow down your ketosis.
Intermittent fasting may also help you enter ketosis more quickly. Intermittent fasting can take numerous forms, but the most popular strategy entails restricting food consumption to roughly 8 hours per day and fasting for the rest of the day.
There are blood, urine, and breath tests that may be used to see if you’ve entered ketosis by measuring the quantity of ketones your body produces.
Increased thirst, dry mouth, frequent urination, and decreased hunger or appetite are some of the signs that you’ve entered ketosis.
Ketogenic diets can help you lose weight
A ketogenic diet can help you lose weight and reduce your risk of disease.
In fact, evidence suggests that the ketogenic diet may be just as successful as a low-fat diet for weight loss.
Furthermore, because the diet is so satisfying, you can lose weight without monitoring calories or keeping track of what you eat.
Following a very low carb, ketogenic diet was marginally more beneficial for long-term weight loss than following a low fat diet, according to a study of 13 research. The keto diet resulted in an average weight loss of 2 pounds (0.9 kg) more than the low-fat diet group.
Additionally, it resulted in lower diastolic blood pressure and lipid levels.
|
https://medium.com/@myonlinebusiness57/the-ketogenic-diet-799bc7009f75
|
['Myonline Business']
|
2021-12-16 05:37:57.074000+00:00
|
['Ketogenic Diet', 'Ketogenic', 'Keto Diet For Weight Loss', 'Keto', 'Ketogenic Diet Meal Plan']
|
Title Ketogenic DietContent Different type ketogenic diet Ketogenic diet come variety flavor ketogenic diet come variety form including standard ketogenic diet SKD lowcarbohydrate moderateprotein highfat diet usually 70 percent fat 20 percent protein barely 10 carbohydrate 9Trusted Source cyclical ketogenic diet CKD entail period increased carb refeeding five ketogenic day followed two high carb day targeted ketogenic diet TKD permit eat carbs workout targeted ketogenic diet TKD permit eat carbs workout ketogenic diet comparable conventional ketogenic diet however contains extra protein Typically fattoproteintocarbohydrate ratio 60 fat 35 protein 5 carbohydrate regular highprotein ketogenic diet thoroughly researched advanced ketogenic diet cyclical targeted ketogenic diet largely employed bodybuilder athlete majority material page relates standard ketogenic diet SKD exception ketosis Ketosis metabolic condition body burn fat instead carbohydrate energy occurs drastically restrict carbohydrate intake decreasing body’s availability glucose sugar cells’ primary source energy effective strategy enter ketosis eat ketogenic diet usually entail restricting carb intake 20 50 gram per day focusing fat meat fish egg nut healthy oil Click special It’s also crucial keep protein intake check eat much protein turned glucose slow ketosis Intermittent fasting may also help enter ketosis quickly Intermittent fasting take numerous form popular strategy entail restricting food consumption roughly 8 hour per day fasting rest day blood urine breath test may used see you’ve entered ketosis measuring quantity ketone body produce Increased thirst dry mouth frequent urination decreased hunger appetite sign you’ve entered ketosis Ketogenic diet help lose weight ketogenic diet help lose weight reduce risk disease fact evidence suggests ketogenic diet may successful lowfat diet weight loss Furthermore diet satisfying lose weight without monitoring calorie keeping track eat Following low carb ketogenic diet marginally beneficial longterm weight loss following low fat diet according study 13 research keto diet resulted average weight loss 2 pound 09 kg lowfat diet group Additionally resulted lower diastolic blood pressure lipid levelsTags Ketogenic Diet Ketogenic Keto Diet Weight Loss Keto Ketogenic Diet Meal Plan
|
187,989 |
How To Get Into Ketosis With Atkins
|
by Richard | Dec 17, 2021 |
This article is from www.wholehealthemporium.com and may contain affiliate links.
Atkins, paleo, keto, cabbage soup, and so many other diets come into popularity because of their rapid weight loss results.
Some diets are different, but some are similar with minor difference.
The basic principle of the Atkins diet is that a state of ketosis will help you burn your fat stores as energy.
Many people, even those who are on low carbohydrate diets, don’t quite understand ketosis and why it works.
Many diets are focused on calorie-reduction, which can be effective for some.
They help you lose weight, but some of the weight is from fat and some of it is from lean muscle tissue.
While the scale may show you some different numbers, your metabolism is actually slowing down.
The more muscle you lose the slower your metabolism will be.
This makes losing weight more difficult and gaining weight back even simpler.
If you’re looking for an extra boost to kick you into ketosis — these supplements are excellent!
How Does The Atkins Diet Achieve Ketosis?
The Atkins diet, on the other hand, is carbohydrate restrictive. It creates a state of ketosis in your body that burns only fat, and not muscle.
“The Atkins diet has four phases;
1. The induction phase,
2. Balancing phase,
3. Pre-maintenance phase
4. The long-term maintenance phase.”
The primary source of your energy for your body will be fat in the form of ketones.
Your liver will convert fat into ketones and it cannot be converted back. It will be excreted naturally.
Ketones are actual a normally and efficient source of fuel for the human body.
They are created in the liver from the fatty acids that result from the breakdown of body fat.
These only appear when there is an absence of glucose and sugar.
In the Atkins diet, you reduce the amount of glucose and sugar that is in the bloodstream.
As a result, your body produces ketones for fuel. When your body is creating ketones it is called ketosis.
There is a common misconception that following a ketogenic diet like Atkins is dangerous.
The truth is that being in ketosis is a completely naturally state. The human body creates ketones to use as fuel in the absence of glucose.
Ketone Testing Strips
In the Atkins diet book, Dr. Atkins suggests using ketone-testing strips to determine your state of ketosis during dieting.
These small plastic strips are held in the urine stream and contain a special chemically treated absorptive pad.
This pad will change color if ketones are present in the urine. With the presence of ketones, the strip will change varying shades of pink to purple.
There is a color scale on the label of the bottle that will help you determine your ketone levels.
Where To Find Ketone Strips
Ketone strips are available in any pharmacy and can be found among the diabetic supplies.
In some stores, they are kept behind the counter so you may have to ask for them. You won’t need a prescription to buy them though.
Once you open a package of ketosis strips they have a shelf life of 6 months. It may be helpful to mark the opening date on the box.
How Useful Are Ketone Strips?
Ketone strips will let you know if you are progressing correctly on the Atkins diet. If you are following the Induction plan to the letter and aren’t seeing purple, don’t worry.
Some people never show trace amounts of ketones or they may show just above the minimum line.
As long as you are losing weight and inches then you are successfully using ketones. Also, if you’ve just exercised a few hours before using the strips, you may not see purple.
Watch Out For Dehydration
Some dieters may mistakenly believe that a dark purple result on the testing strips means that they are losing weight faster.
Actually, the darkest purple color is a sign of dehydration. It means that your urine is too concentrated and you need to drink water.
Ketones come from fat in the bloodstream, whether it is fat that you eat or fat that you burn. So if you eat a meal heavy in fat and then immediately use a testing strip, then you’ll see a dark purple result. Use the strips as a guide, but don’t get hung up on the color.
Also watch out for the keto flu — click here to learn how you can beat the keto flu!
Supplements
Thousands of people who have had success with the atkins and/or keto diet find supplementing with additional vitamins is beneficial for their journey.
Also adding certain Superfoods like spirulina or chlorella can help boost your energy levels, detox, help with weight loss, and give clarity of mind without knocking you out of ketosis.
Conclusion
Reaching a state of ketosis is the key to success on the Atkins diet. Eliminating carbohydrates from the diet will help you in this process.
Make sure to follow the eating plan correctly and use the ketone testing strips as needed.
Supplements and superfoods can significantly help you during your in the process
Thank you for reading!
What was has your journey with the atkins and/or keto diet been like? Please share your comments with us below!
Edited by Pauline D. and Richard Tracy
Works Cited
“The Atkins Diet: Benefits, Risks and What to Eat — Health Guide.” .Ro.co. N.p., n.d. Web. 24 Oct. 2021.
Amazon.com. N.p., n.d. Web. 24 Oct. 2021.
|
https://medium.com/@wholehealthemporium/how-to-get-into-ketosis-with-atkins-c804b9525204
|
['Whole Health Emporium']
|
2021-12-17 14:03:04.535000+00:00
|
['Weight Loss', 'Health', 'Healthcare', 'Keto', 'Weight Loss Tips']
|
Title Get Ketosis AtkinsContent Richard Dec 17 2021 article wwwwholehealthemporiumcom may contain affiliate link Atkins paleo keto cabbage soup many diet come popularity rapid weight loss result diet different similar minor difference basic principle Atkins diet state ketosis help burn fat store energy Many people even low carbohydrate diet don’t quite understand ketosis work Many diet focused caloriereduction effective help lose weight weight fat lean muscle tissue scale may show different number metabolism actually slowing muscle lose slower metabolism make losing weight difficult gaining weight back even simpler you’re looking extra boost kick ketosis — supplement excellent Atkins Diet Achieve Ketosis Atkins diet hand carbohydrate restrictive creates state ketosis body burn fat muscle “The Atkins diet four phase 1 induction phase 2 Balancing phase 3 Premaintenance phase 4 longterm maintenance phase” primary source energy body fat form ketone liver convert fat ketone cannot converted back excreted naturally Ketones actual normally efficient source fuel human body created liver fatty acid result breakdown body fat appear absence glucose sugar Atkins diet reduce amount glucose sugar bloodstream result body produce ketone fuel body creating ketone called ketosis common misconception following ketogenic diet like Atkins dangerous truth ketosis completely naturally state human body creates ketone use fuel absence glucose Ketone Testing Strips Atkins diet book Dr Atkins suggests using ketonetesting strip determine state ketosis dieting small plastic strip held urine stream contain special chemically treated absorptive pad pad change color ketone present urine presence ketone strip change varying shade pink purple color scale label bottle help determine ketone level Find Ketone Strips Ketone strip available pharmacy found among diabetic supply store kept behind counter may ask won’t need prescription buy though open package ketosis strip shelf life 6 month may helpful mark opening date box Useful Ketone Strips Ketone strip let know progressing correctly Atkins diet following Induction plan letter aren’t seeing purple don’t worry people never show trace amount ketone may show minimum line long losing weight inch successfully using ketone Also you’ve exercised hour using strip may see purple Watch Dehydration dieter may mistakenly believe dark purple result testing strip mean losing weight faster Actually darkest purple color sign dehydration mean urine concentrated need drink water Ketones come fat bloodstream whether fat eat fat burn eat meal heavy fat immediately use testing strip you’ll see dark purple result Use strip guide don’t get hung color Also watch keto flu — click learn beat keto flu Supplements Thousands people success atkins andor keto diet find supplementing additional vitamin beneficial journey Also adding certain Superfoods like spirulina chlorella help boost energy level detox help weight loss give clarity mind without knocking ketosis Conclusion Reaching state ketosis key success Atkins diet Eliminating carbohydrate diet help process Make sure follow eating plan correctly use ketone testing strip needed Supplements superfoods significantly help process Thank reading journey atkins andor keto diet like Please share comment u Edited Pauline Richard Tracy Works Cited “The Atkins Diet Benefits Risks Eat — Health Guide” Roco Np nd Web 24 Oct 2021 Amazoncom Np nd Web 24 Oct 2021Tags Weight Loss Health Healthcare Keto Weight Loss Tips
|
187,990 |
The Ultimate Three-Day Ketogenic Diet Meal Plan
|
Want to start the keto diet but don’t know what to eat?
GET RESULTS IN 30 DAYS
Join 90k+ people who are losing weight with Keto Kickstart, our doctor-developed program designed to give you real weight loss results.
Here, you’ll learn the basics of the ketogenic diet, what to eat for breakfast, lunch and dinner and how to do keto meal prep the right way so you can save time.
When starting a new diet, knowing what you can and cannot eat is often the most stressful part of the transition. Here, all the guesswork is taken away for you. A ketogenic diet meal plan is laid out for you so you know exactly which recipes to follow for each meal.
The meal plan below is simplified into a 7-day plan, which you can download here.
Keto 101
The purpose of the ketogenic diet is to put your body in a metabolic state of ketosis and support your health. Ketosis is a state in which you burn mainly fat — rather than carbs — for energy. Ketosis has been shown to provide multiple health benefits, including weight loss, better mental performance, blood sugar control, and disease management.
On keto, the majority of your caloric intake will come from fa and some protein and very few carbs. Most people can enter ketosis following these guidelines:
Consume 0.8 grams of protein per pound of lean body mass at a minimum
Reduce your carbohydrate intake to 20–50 grams of total carbohydrates
Any remaining calories should come from healthy fats
This “starves” your body of carbohydrates, which would otherwise be converted into glucose in the liver. With no glucose available, your body burns ketones as its primary energy source, transitioning your body into a fat-burning state.
Foods You Can Eat On Keto
Preparation is an important component of the keto diet. Planning your meals in advance will save time, money and energy, and prevent you from reaching for carb-laden snacks when hunger hits.
As you put together your shopping list, take note of which foods are (and are not) keto-friendly.
For a complete overview, dive into The Full Keto Diet Food List.
Fats
Fats and oils: olive oil, coconut oil, sesame oil, butter, ghee, walnut oil, flaxseed oil
olive oil, coconut oil, sesame oil, butter, ghee, walnut oil, flaxseed oil Nuts and seeds: almonds, almond butter, chia seeds, walnuts, walnut butter, macadamia nuts, pecans, pistachios, cashews
almonds, almond butter, chia seeds, walnuts, walnut butter, macadamia nuts, pecans, pistachios, cashews Full-fat, organic, grass-fed dairy: heavy cream, butter, sour cream, cream cheese, hard and soft cheeses
Protein
Grass-fed beef: ground beef, veal, steak
ground beef, veal, steak Organ meats: liver, heart, tongue
liver, heart, tongue Pasture-raised pork: ham, bacon, pulled pork, pork loins
ham, bacon, pulled pork, pork loins Poultry: chicken, turkey, duck
chicken, turkey, duck Wild-caught seafood: salmon, mussels, cod, crab, tilapia, clams
salmon, mussels, cod, crab, tilapia, clams Eggs
Lamb
Goat
Carbs
Leafy green vegetables: kale, swiss chard, spinach, romaine lettuce, Brussels sprouts, broccoli
kale, swiss chard, spinach, romaine lettuce, Brussels sprouts, broccoli Other vegetables: cauliflower, zucchini, onions, bell peppers, celery, cucumber
cauliflower, zucchini, onions, bell peppers, celery, cucumber Low-carb fruits: avocado, blueberries, raspberries, cherries
You can also use some condiments, ideally homemade or made without sugar. Low carb sweeteners can be used in moderation.
Foods To Avoid On Keto
To make your meal prep as simple as possible, it’s helpful to know which foods to avoid. Avoid the grocery aisles containing the below food groups. If they’re currently stocked in your cupboards, it may be best to throw them out, or donate any unopened packaged foods.
Foods to avoid on keto:
Sugar: White sugar, brown sugar, honey, maple syrup
White sugar, brown sugar, honey, maple syrup Grains: White and wheat bread, whole grains, oats, rice, quinoa, couscous, pasta
White and wheat bread, whole grains, oats, rice, quinoa, couscous, pasta Fruit: Apples, mangoes, melons, oranges
Apples, mangoes, melons, oranges Legumes: Black beans, kidney beans, soy, lentils
Black beans, kidney beans, soy, lentils Starch: Sweet potatoes, potatoes, parsnips, carrots, other starchy vegetables
Find Your Keto Macros
As a beginner to the keto diet, it’s important to understand your macros.
The three macronutrients are fat, protein and carbohydrates. While a standard American diet weighs heavily in carbohydrates and low in fat, a ketogenic diet plan takes the opposite approach. On the keto diet, you will eat high quantities of fat, moderate amounts of protein and very few carbs.
A keto meal plan should be comprised of 75% fat, 20% protein and 5% total carbs.
If you eat 2,000 calories per day, that would come out to 1,500 calories or 167 grams of fat, 400 calories or 100 grams of protein and 100 calories or 25 grams of carbs. You would need to make sure you stay at or below 25 grams of carbs each day to stay in ketosis.
These percentages are estimates only. To calculate your macros precisely, use the Perfect Keto Macro Calculator.
Go Shopping: Know Which Foods to Eat and Which to Avoid
Foods to Avoid on Keto
Fat
Protein
GET RESULTS IN 30 DAYS
Join 90k+ people who are losing weight with Keto Kickstart, our doctor-developed program designed to give you real weight loss results.
Processed meats: hot dogs, salami, meats made with casings
Farm-raised seafood
Grain-fed beef, pork and poultry
Carbs
All grains: rice, wheat, bulgar, bread, cereal, oatmeal, barley, rye, couscous, quinoa
Starchy vegetables: white potatoes, sweet potatoes, most squash, corn, cherry tomatoes, carrots
High carb fruits: pineapple, apples, watermelon, dried fruit, fruit juice, mango
Most alcohol, sugar and artificial sweeteners, fast food and processed condiments are also off-limits on keto.
Go-To Meal Ideas
It’s always a good idea to have a backlog of go-to meal ideas. If you follow a strict work schedule or hectic lifestyle, these meals can be made quickly, without having to refer to a recipe. Here are a few Perfect Keto favorites:
Bulletproof coffee: Popular amongst many who follow a low carb or keto lifestyle, bulletproof coffee has many health benefits. It provides a sharp mental boost and satiety from the fat, plus it helps you get into ketosis first thing in the morning.
Salads: No, salads do not have to be boring. Pile your salad high with lots of leafy greens, good oils such as coconut oil or extra virgin olive oil, and healthy protein like salmon, bacon and hard-boiled eggs.
Collagen smoothies: Most smoothie recipes are loaded with fruit, and therefore loaded with sugar. By tweaking your smoothie recipes to include a healthy dose of fat and protein, adding a serving of collagen and topping with chia seeds or another keto-friendly topping, you have the perfect on-the-go snack or meal.
Intermittent fasting: If you’re not hungry, don’t force it. Keto supports intermittent fasting, which can provide various health benefits such as enhanced mental focus and weight loss.
Three-Day Ketogenic Diet Meal Plan
The following sample meal plan outlines three days on the ketogenic diet. Your meals may differ slightly based on your lifestyle, weight loss goals and body type.
Day 1
Lunch: Easy White Turkey Chili and salad greens with olive oil and pine nuts
Dinner: Portobello Bun Cheeseburger and a Keto Matcha Fat Bomb for dessert
Day 2
Breakfast: Keto Grand Slam
Lunch: Tuna Zoodle Casserole and roasted broccoli with olive oil
Dinner: Southing Keto Chicken Soup
Day 3
Breakfast: Two Cheesy Low Carb Stuffed Mushrooms with Bacon and half an avocado
Other Keto Meal Plan Resources
The first two weeks of any new diet are the most challenging. During this time period, you’ll adapt to a new way of grocery shopping, meal prepping and eating. On keto, an added challenge is the dreaded keto flu — flu-like withdrawal symptoms associated with transitioning to a low carb diet.
To make this transition easier, Perfect Keto is loaded with additional resources. Recipes, guidance, and articles are at your disposal to help you see success on keto. View the keto recipe library to plan a week’s worth of meals, check out the dessert page for when you’re overcome with carb or sugar cravings and view the Perfect Keto products for supplements to help you enter ketosis more easily.
For additional reading, check out the Perfect Keto knowledge base to help plan your meals. With a little diligence, a lot of preparation and a bit of patience, you will reach your goals.
GET RESULTS IN 30 DAYS
Join 90k+ people who are losing weight with Keto Kickstart, our doctor-developed program designed to give you real weight loss results.
|
https://medium.com/@shainul.abbas14/the-ultimate-three-day-ketogenic-diet-meal-plan-c53823caf50d
|
['Shainul Abbas']
|
2021-12-15 07:28:24.942000+00:00
|
['Ketogenic Diet', 'Keto', 'Ketogenic Diet Products', 'Ketogenic Diet Meal Plan', 'Keto Diet']
|
Title Ultimate ThreeDay Ketogenic Diet Meal PlanContent Want start keto diet don’t know eat GET RESULTS 30 DAYS Join 90k people losing weight Keto Kickstart doctordeveloped program designed give real weight loss result you’ll learn basic ketogenic diet eat breakfast lunch dinner keto meal prep right way save time starting new diet knowing cannot eat often stressful part transition guesswork taken away ketogenic diet meal plan laid know exactly recipe follow meal meal plan simplified 7day plan download Keto 101 purpose ketogenic diet put body metabolic state ketosis support health Ketosis state burn mainly fat — rather carbs — energy Ketosis shown provide multiple health benefit including weight loss better mental performance blood sugar control disease management keto majority caloric intake come fa protein carbs people enter ketosis following guideline Consume 08 gram protein per pound lean body mass minimum Reduce carbohydrate intake 20–50 gram total carbohydrate remaining calorie come healthy fat “starves” body carbohydrate would otherwise converted glucose liver glucose available body burn ketone primary energy source transitioning body fatburning state Foods Eat Keto Preparation important component keto diet Planning meal advance save time money energy prevent reaching carbladen snack hunger hit put together shopping list take note food ketofriendly complete overview dive Full Keto Diet Food List Fats Fats oil olive oil coconut oil sesame oil butter ghee walnut oil flaxseed oil olive oil coconut oil sesame oil butter ghee walnut oil flaxseed oil Nuts seed almond almond butter chia seed walnut walnut butter macadamia nut pecan pistachio cashew almond almond butter chia seed walnut walnut butter macadamia nut pecan pistachio cashew Fullfat organic grassfed dairy heavy cream butter sour cream cream cheese hard soft cheese Protein Grassfed beef ground beef veal steak ground beef veal steak Organ meat liver heart tongue liver heart tongue Pastureraised pork ham bacon pulled pork pork loin ham bacon pulled pork pork loin Poultry chicken turkey duck chicken turkey duck Wildcaught seafood salmon mussel cod crab tilapia clam salmon mussel cod crab tilapia clam Eggs Lamb Goat Carbs Leafy green vegetable kale swiss chard spinach romaine lettuce Brussels sprout broccoli kale swiss chard spinach romaine lettuce Brussels sprout broccoli vegetable cauliflower zucchini onion bell pepper celery cucumber cauliflower zucchini onion bell pepper celery cucumber Lowcarb fruit avocado blueberry raspberry cherry also use condiment ideally homemade made without sugar Low carb sweetener used moderation Foods Avoid Keto make meal prep simple possible it’s helpful know food avoid Avoid grocery aisle containing food group they’re currently stocked cupboard may best throw donate unopened packaged food Foods avoid keto Sugar White sugar brown sugar honey maple syrup White sugar brown sugar honey maple syrup Grains White wheat bread whole grain oat rice quinoa couscous pasta White wheat bread whole grain oat rice quinoa couscous pasta Fruit Apples mango melon orange Apples mango melon orange Legumes Black bean kidney bean soy lentil Black bean kidney bean soy lentil Starch Sweet potato potato parsnip carrot starchy vegetable Find Keto Macros beginner keto diet it’s important understand macro three macronutrients fat protein carbohydrate standard American diet weighs heavily carbohydrate low fat ketogenic diet plan take opposite approach keto diet eat high quantity fat moderate amount protein carbs keto meal plan comprised 75 fat 20 protein 5 total carbs eat 2000 calorie per day would come 1500 calorie 167 gram fat 400 calorie 100 gram protein 100 calorie 25 gram carbs would need make sure stay 25 gram carbs day stay ketosis percentage estimate calculate macro precisely use Perfect Keto Macro Calculator Go Shopping Know Foods Eat Avoid Foods Avoid Keto Fat Protein GET RESULTS 30 DAYS Join 90k people losing weight Keto Kickstart doctordeveloped program designed give real weight loss result Processed meat hot dog salami meat made casing Farmraised seafood Grainfed beef pork poultry Carbs grain rice wheat bulgar bread cereal oatmeal barley rye couscous quinoa Starchy vegetable white potato sweet potato squash corn cherry tomato carrot High carb fruit pineapple apple watermelon dried fruit fruit juice mango alcohol sugar artificial sweetener fast food processed condiment also offlimits keto GoTo Meal Ideas It’s always good idea backlog goto meal idea follow strict work schedule hectic lifestyle meal made quickly without refer recipe Perfect Keto favorite Bulletproof coffee Popular amongst many follow low carb keto lifestyle bulletproof coffee many health benefit provides sharp mental boost satiety fat plus help get ketosis first thing morning Salads salad boring Pile salad high lot leafy green good oil coconut oil extra virgin olive oil healthy protein like salmon bacon hardboiled egg Collagen smoothy smoothie recipe loaded fruit therefore loaded sugar tweaking smoothie recipe include healthy dose fat protein adding serving collagen topping chia seed another ketofriendly topping perfect onthego snack meal Intermittent fasting you’re hungry don’t force Keto support intermittent fasting provide various health benefit enhanced mental focus weight loss ThreeDay Ketogenic Diet Meal Plan following sample meal plan outline three day ketogenic diet meal may differ slightly based lifestyle weight loss goal body type Day 1 Lunch Easy White Turkey Chili salad green olive oil pine nut Dinner Portobello Bun Cheeseburger Keto Matcha Fat Bomb dessert Day 2 Breakfast Keto Grand Slam Lunch Tuna Zoodle Casserole roasted broccoli olive oil Dinner Southing Keto Chicken Soup Day 3 Breakfast Two Cheesy Low Carb Stuffed Mushrooms Bacon half avocado Keto Meal Plan Resources first two week new diet challenging time period you’ll adapt new way grocery shopping meal prepping eating keto added challenge dreaded keto flu — flulike withdrawal symptom associated transitioning low carb diet make transition easier Perfect Keto loaded additional resource Recipes guidance article disposal help see success keto View keto recipe library plan week’s worth meal check dessert page you’re overcome carb sugar craving view Perfect Keto product supplement help enter ketosis easily additional reading check Perfect Keto knowledge base help plan meal little diligence lot preparation bit patience reach goal GET RESULTS 30 DAYS Join 90k people losing weight Keto Kickstart doctordeveloped program designed give real weight loss resultsTags Ketogenic Diet Keto Ketogenic Diet Products Ketogenic Diet Meal Plan Keto Diet
|
187,991 |
True Keto 1800 True Keto 1800 Get Perfect Body Shape [SPAM & LEGIT] Sale-Price, Reviews, Offers
|
True Keto 1800
➢Product Name — True Keto 1800
➢ Composition — Natural Organic Compound
➢ Side-Effects — NA
➢ Price — Visit True Keto 1800
➢ Supplement Type — Capsules
➢ Official Website (Sale Is Live) — WWW.TRUEKETO1800.COM
True Keto 1800 is an dietary formula promising to make your body a fat-burning furnace 24 hours a day. Scientific facts show that obesity causes chronic joint pain, diabetes, hypertension, stroke, and heart attack.
High-calorie foods, poor sleep quality, stress, and a sedentary lifestyle have increased overweight individuals in the US alone. In addition, hundreds of supplement-making companies claim to use high-quality ingredients. However, only a few fat-burning formulas work. True Keto 1800 claims it fights to help its users to lose excess fat by raising the number of ketone bodies in your system.
What is True Keto 1800?
True Keto 1800 is a ketosis-inducing weight loss solution that fights obesity from the root. The creators assure users that they use premium-quality BHB ketone salts to induce ketosis. Similarly, the producers guarantee that this supplement contains no stimulants or psychoactive elements. Equally, True Keto 1800 stimulates the fat oxidation process with zero side effects.
Additionally, True Keto 1800 is a product from a US-based company that is GMP approved and FDA verified. Per the official sales page, the makers claim that TV personality Dr. Oz supports the Keto diet.
SEE ALSO: “Controversial True Keto 1800 Report is Out — They Will Never Tell You This”
How Does True Keto 1800 Work?
True Keto 1800 contains full spectrum BHB to increase fat metabolism in your body. It primarily works by improving your body’s ability to shed weight. Obese people seeking to cut fat find it hard to lose weight than regain it. You can create a caloric deficit by consuming fewer carbs and using more calories. This statement may not be logical if you struggle with low energy levels and cravings. Carbs provide your body with temporary energy.
After digestion, your system stores excess glucose in the form of fat. Experts claim you can only lose weight when your body utilizes the fat deposits into your system. The state where your body burns fat for heat and energy is called ketosis. It is the safest and most effective way of permanently getting rid of excess fat. It isn’t easy to condition your system to get into ketosis. A ketogenic diet can turn your body into a fat-burning furnace.
However, it may take weeks to get into ketosis, depending on diet alone. Additionally, you have to follow a restrictive diet that may be impossible for some people to stay in that condition.
True Keto 1800 is a supplement that acts as a shortcut to achieving ketosis. Instead of waiting for 2–3 weeks to get into ketosis, this supplement helps your body utilize fat in less than seven days. Per the official sales page, you can lose 5 lbs. within the first seven days of using this supplement. The full-spectrum BHB in True Keto 1800 targets fat cells to provide your system with fuel.
Thus, instead of carbs, your body uses the stored fat to generate heat and fuel. In addition, True Keto 1800 helps your body stay in the ketosis state for extended periods. Furthermore, it fights against cravings hence can help you achieve a calorie deficit needed for effective weight loss.
To get the True Keto 1800 at an Exclusive Discount Price online
(HUGE SAVINGS TODAY)
What Ingredients are in the True Keto 1800?
The primary ingredient in True Keto 1800 is full-spectrum BHB salts. Multiple scientific research indicates that BHB salts increase ketone bodies into your system hence aiding in weight loss. Consuming True Keto 1800 formula stimulates ketosis that turns your body into fat-burning mode for extended periods. According to the makers, ketosis provides your body with adequate energy for extended periods even when consuming fewer calories.
True Keto 1800 Dosage
You can consume two True Keto 1800 capsules daily to get maximum benefits. The manufacturer recommends consuming it in the morning before breakfast. However, it contains zero stimulants or ingredients that can affect your daily tasks or sleep. Thus, you can consume True Keto 1800 at any time. The manufacturer is confident that you will get the results you desire in 3–5 months. As a form of security, True Keto 1800 offers a money-back guarantee.
Still, do not take True Keto 1800 if you are using any medication or scheduled for surgery. In addition, nursing and pregnant women should use this supplement only under the guidance of their doctor. Equally, do not exceed the suggested dosage unless directed by the physician.
How to Achieve Effective Results Using True Keto 1800 Supplement
True Keto 1800 is an easy-to-use weight loss supplement. You do not need to make complicated changes to your lifestyle to get results using this supplement. The manufacturer recommends consuming True Keto 1800 pills daily to get the best results. In addition, you can be mindful about what you eat, stay hydrated, and perform regular exercises to maximize its effectiveness. There are three stages involved in the usage of this formula including:
Step one — Consume Keto Pills
After consuming your first dosage of True Keto 1800 pills, your body starts to burn fat instantly. The formula increases ketone bodies into your system, thus beginning the conversion process of fat into fuel. True Keto 1800 boldly claims you can lose up to 5 lbs. within the first week.
Step two — Regular use of True Keto 1800
You must consume True Keto 1800 regularly to accelerate the oxidation of fat. Additionally, regular usage of keto pills helps your body to stay in ketosis for extended periods. According to the producers, you can shed up to 20 lbs. in the first month. Similarly, you will notice your body becoming leaner and trimmer when you consume True Keto 1800 consistently.
Step three — Body Transformations
True Keto 1800 promises to help you achieve your ideal weight. However, to maintain optimal pounds and prevent weight gain, you need to consume True Keto 1800 for about 3–5 months. Within this time, the supplement fights against cravings and hence can help you consume healthy meals for long-term results.
True Keto 1800 Benefits
There are multiple benefits of consuming True Keto 1800 pills, including:
It supports weight loss and thus aids you in achieving the ideal weight.
It can protect you against weight-related conditions like hypertension and type two diabetes.
It can fight against chronic joint pain and inflammation.
It can boost your immunity and enhance recovery.
It supports better skin and joint health.
Combined with the proper workout, it can help you develop a muscular stature.
It can help you embrace clean eating and a healthy lifestyle.
What are the Pros and Cons of True Keto 1800 Supplements?
Pros
It contains 800 mg of full-spectrum BHB salts, scientifically proven to support weight loss.
It is all-natural and unlikely to cause severe side effects
True Keto 1800 is easy to consume and use
It is cost-effective
It is available online without a prescription
Cons
True Keto 1800 is only available on its official website
Results of using Trim Life may vary depending on a person’s genetic makeup and current weight
There is no guarantee that it will work for everyone.
It contains gelatin; hence it is not vegan-friendly.
(HUGE SAVINGS TODAY)
Click Here to Get True Keto 1800 For The Lowest Price Right Now
Where to Buy True Keto 1800?
This product is available for purchase from the True Keto 1800 official website only. Interested buyers should visit True Keto 1800 and take advantage of the discounted prices. The company recommends buying on the official website to avoid getting counterfeit products, which don’t deliver the expected results.
BUY 3 GET 2 FREE* For Those Who Need to Lose 25+ Pounds! Sell out risk: HIGH
BUY 2 GET 1 FREE For Those Who Need to Lose 15+ Pounds!
BUY 1 For Those Who Needto Lose 7+ Pounds!
Internet Exclusive Offers Available!
Limited supply available. We currently have product in stock and ready to ship within 24 hours.
By submitting, you affirm to have read and agreed to our Terms & Conditions.
ORDER NOW
PURCHASE TRUE KETO 1800 VISITING OFFICIAL WEBSITE
Final Thoughts
True Keto 1800 is a weight loss supplement that conditions your system to stay in ketosis. When in ketosis, your body burns fat for heat and energy. Additionally, this supplement prevents your system from storing more fat by fighting against overeating. However, True Keto 1800 is not a miracle pill. You should be consistent in taking it regularly and make a few dietary and lifestyle changes for permanent results.
True Keto 1800
➢Product Name — True Keto 1800
➢ Composition — Natural Organic Compound
➢ Side-Effects — NA
➢ Price — Visit True Keto 1800
➢ Supplement Type — Capsules
➢ Official Website (Sale Is Live) — WWW.TRUEKETO1800.COM
True Keto 1800 is an dietary formula promising to make your body a fat-burning furnace 24 hours a day. Scientific facts show that obesity causes chronic joint pain, diabetes, hypertension, stroke, and heart attack.
High-calorie foods, poor sleep quality, stress, and a sedentary lifestyle have increased overweight individuals in the US alone. In addition, hundreds of supplement-making companies claim to use high-quality ingredients. However, only a few fat-burning formulas work. True Keto 1800 claims it fights to help its users to lose excess fat by raising the number of ketone bodies in your system.
What is True Keto 1800?
True Keto 1800 is a ketosis-inducing weight loss solution that fights obesity from the root. The creators assure users that they use premium-quality BHB ketone salts to induce ketosis. Similarly, the producers guarantee that this supplement contains no stimulants or psychoactive elements. Equally, True Keto 1800 stimulates the fat oxidation process with zero side effects.
Additionally, True Keto 1800 is a product from a US-based company that is GMP approved and FDA verified. Per the official sales page, the makers claim that TV personality Dr. Oz supports the Keto diet.
SEE ALSO: “Controversial True Keto 1800 Report is Out — They Will Never Tell You This”
How Does True Keto 1800 Work?
True Keto 1800 contains full spectrum BHB to increase fat metabolism in your body. It primarily works by improving your body’s ability to shed weight. Obese people seeking to cut fat find it hard to lose weight than regain it. You can create a caloric deficit by consuming fewer carbs and using more calories. This statement may not be logical if you struggle with low energy levels and cravings. Carbs provide your body with temporary energy.
After digestion, your system stores excess glucose in the form of fat. Experts claim you can only lose weight when your body utilizes the fat deposits into your system. The state where your body burns fat for heat and energy is called ketosis. It is the safest and most effective way of permanently getting rid of excess fat. It isn’t easy to condition your system to get into ketosis. A ketogenic diet can turn your body into a fat-burning furnace.
However, it may take weeks to get into ketosis, depending on diet alone. Additionally, you have to follow a restrictive diet that may be impossible for some people to stay in that condition.
True Keto 1800 is a supplement that acts as a shortcut to achieving ketosis. Instead of waiting for 2–3 weeks to get into ketosis, this supplement helps your body utilize fat in less than seven days. Per the official sales page, you can lose 5 lbs. within the first seven days of using this supplement. The full-spectrum BHB in True Keto 1800 targets fat cells to provide your system with fuel.
Thus, instead of carbs, your body uses the stored fat to generate heat and fuel. In addition, True Keto 1800 helps your body stay in the ketosis state for extended periods. Furthermore, it fights against cravings hence can help you achieve a calorie deficit needed for effective weight loss.
To get the True Keto 1800 at an Exclusive Discount Price online
(HUGE SAVINGS TODAY)
What Ingredients are in the True Keto 1800?
The primary ingredient in True Keto 1800 is full-spectrum BHB salts. Multiple scientific research indicates that BHB salts increase ketone bodies into your system hence aiding in weight loss. Consuming True Keto 1800 formula stimulates ketosis that turns your body into fat-burning mode for extended periods. According to the makers, ketosis provides your body with adequate energy for extended periods even when consuming fewer calories.
True Keto 1800 Dosage
You can consume two True Keto 1800 capsules daily to get maximum benefits. The manufacturer recommends consuming it in the morning before breakfast. However, it contains zero stimulants or ingredients that can affect your daily tasks or sleep. Thus, you can consume True Keto 1800 at any time. The manufacturer is confident that you will get the results you desire in 3–5 months. As a form of security, True Keto 1800 offers a money-back guarantee.
Still, do not take True Keto 1800 if you are using any medication or scheduled for surgery. In addition, nursing and pregnant women should use this supplement only under the guidance of their doctor. Equally, do not exceed the suggested dosage unless directed by the physician.
How to Achieve Effective Results Using True Keto 1800 Supplement
True Keto 1800 is an easy-to-use weight loss supplement. You do not need to make complicated changes to your lifestyle to get results using this supplement. The manufacturer recommends consuming True Keto 1800 pills daily to get the best results. In addition, you can be mindful about what you eat, stay hydrated, and perform regular exercises to maximize its effectiveness. There are three stages involved in the usage of this formula including:
Step one — Consume Keto Pills
After consuming your first dosage of True Keto 1800 pills, your body starts to burn fat instantly. The formula increases ketone bodies into your system, thus beginning the conversion process of fat into fuel. True Keto 1800 boldly claims you can lose up to 5 lbs. within the first week.
Step two — Regular use of True Keto 1800
You must consume True Keto 1800 regularly to accelerate the oxidation of fat. Additionally, regular usage of keto pills helps your body to stay in ketosis for extended periods. According to the producers, you can shed up to 20 lbs. in the first month. Similarly, you will notice your body becoming leaner and trimmer when you consume True Keto 1800 consistently.
Step three — Body Transformations
True Keto 1800 promises to help you achieve your ideal weight. However, to maintain optimal pounds and prevent weight gain, you need to consume True Keto 1800 for about 3–5 months. Within this time, the supplement fights against cravings and hence can help you consume healthy meals for long-term results.
True Keto 1800 Benefits
There are multiple benefits of consuming True Keto 1800 pills, including:
It supports weight loss and thus aids you in achieving the ideal weight.
It can protect you against weight-related conditions like hypertension and type two diabetes.
It can fight against chronic joint pain and inflammation.
It can boost your immunity and enhance recovery.
It supports better skin and joint health.
Combined with the proper workout, it can help you develop a muscular stature.
It can help you embrace clean eating and a healthy lifestyle.
What are the Pros and Cons of True Keto 1800 Supplements?
Pros
It contains 800 mg of full-spectrum BHB salts, scientifically proven to support weight loss.
It is all-natural and unlikely to cause severe side effects
True Keto 1800 is easy to consume and use
It is cost-effective
It is available online without a prescription
Cons
True Keto 1800 is only available on its official website
Results of using Trim Life may vary depending on a person’s genetic makeup and current weight
There is no guarantee that it will work for everyone.
It contains gelatin; hence it is not vegan-friendly.
(HUGE SAVINGS TODAY)
Click Here to Get True Keto 1800 For The Lowest Price Right Now
Where to Buy True Keto 1800?
This product is available for purchase from the True Keto 1800 official website only. Interested buyers should visit True Keto 1800 and take advantage of the discounted prices. The company recommends buying on the official website to avoid getting counterfeit products, which don’t deliver the expected results.
BUY 3 GET 2 FREE* For Those Who Need to Lose 25+ Pounds! Sell out risk: HIGH
BUY 2 GET 1 FREE For Those Who Need to Lose 15+ Pounds!
BUY 1 For Those Who Needto Lose 7+ Pounds!
Internet Exclusive Offers Available!
Limited supply available. We currently have product in stock and ready to ship within 24 hours.
By submitting, you affirm to have read and agreed to our Terms & Conditions.
ORDER NOW
PURCHASE TRUE KETO 1800 VISITING OFFICIAL WEBSITE
Final Thoughts
True Keto 1800 is a weight loss supplement that conditions your system to stay in ketosis. When in ketosis, your body burns fat for heat and energy. Additionally, this supplement prevents your system from storing more fat by fighting against overeating. However, True Keto 1800 is not a miracle pill. You should be consistent in taking it regularly and make a few dietary and lifestyle changes for permanent results.
Copyright 2021 © True Keto 1800 | All Rights Reserved.
Terms and Conditions | Privacy Policy | Contact Us | Refund Policy
READ MORE:
https://healthmartblog.blogspot.com/2021/12/true-keto-1800-get-perfect-body-shape.html
https://sites.google.com/view/true-keto-1800-health/home
https://www.completefoods.co/diy/recipes/true-keto-1800-4
https://www.homify.com/professionals/8878842/true-keto-1800-store
https://www.homify.com/projects/1108538/true-keto-1800-get-perfect-body-shape-spam-legit-sale-price-reviews-offers
https://caramellaapp.com/miitchijoner/OoovbrCmo/true-keto-1800
https://promosimple.com/ps/18e90/true-keto-1800-get-perfect-body-shape-spam
https://promosimple.com/giveaways/true-keto-1800-get-perfect-body-shape-spam-legit-sale-price-reviews-offers/
https://www.emailmeform.com/builder/emf/TrueKeto1800reviews/TrueKeto1800reviews
https://www.facebook.com/True-Keto-1800-100193502541176
https://www.scoop.it/topic/true-keto-1800-by-true-keto-1800-43
https://trueketo1800blog.footeo.com/news/2021/12/21/true-keto-1800-get-perfect-body-shape-spam-legit-sale-price-rev
|
https://medium.com/@miitchijoner/true-keto-1800-true-keto-1800-get-perfect-body-shape-spam-legit-sale-price-reviews-offers-faa32faeed14
|
['True Keto']
|
2021-12-21 06:53:54.341000+00:00
|
['Keto', 'Fatloss', 'Health']
|
Title True Keto 1800 True Keto 1800 Get Perfect Body Shape SPAM LEGIT SalePrice Reviews OffersContent True Keto 1800 ➢Product Name — True Keto 1800 ➢ Composition — Natural Organic Compound ➢ SideEffects — NA ➢ Price — Visit True Keto 1800 ➢ Supplement Type — Capsules ➢ Official Website Sale Live — WWWTRUEKETO1800COM True Keto 1800 dietary formula promising make body fatburning furnace 24 hour day Scientific fact show obesity cause chronic joint pain diabetes hypertension stroke heart attack Highcalorie food poor sleep quality stress sedentary lifestyle increased overweight individual US alone addition hundred supplementmaking company claim use highquality ingredient However fatburning formula work True Keto 1800 claim fight help user lose excess fat raising number ketone body system True Keto 1800 True Keto 1800 ketosisinducing weight loss solution fight obesity root creator assure user use premiumquality BHB ketone salt induce ketosis Similarly producer guarantee supplement contains stimulant psychoactive element Equally True Keto 1800 stimulates fat oxidation process zero side effect Additionally True Keto 1800 product USbased company GMP approved FDA verified Per official sale page maker claim TV personality Dr Oz support Keto diet SEE ALSO “Controversial True Keto 1800 Report — Never Tell This” True Keto 1800 Work True Keto 1800 contains full spectrum BHB increase fat metabolism body primarily work improving body’s ability shed weight Obese people seeking cut fat find hard lose weight regain create caloric deficit consuming fewer carbs using calorie statement may logical struggle low energy level craving Carbs provide body temporary energy digestion system store excess glucose form fat Experts claim lose weight body utilizes fat deposit system state body burn fat heat energy called ketosis safest effective way permanently getting rid excess fat isn’t easy condition system get ketosis ketogenic diet turn body fatburning furnace However may take week get ketosis depending diet alone Additionally follow restrictive diet may impossible people stay condition True Keto 1800 supplement act shortcut achieving ketosis Instead waiting 2–3 week get ketosis supplement help body utilize fat le seven day Per official sale page lose 5 lb within first seven day using supplement fullspectrum BHB True Keto 1800 target fat cell provide system fuel Thus instead carbs body us stored fat generate heat fuel addition True Keto 1800 help body stay ketosis state extended period Furthermore fight craving hence help achieve calorie deficit needed effective weight loss get True Keto 1800 Exclusive Discount Price online HUGE SAVINGS TODAY Ingredients True Keto 1800 primary ingredient True Keto 1800 fullspectrum BHB salt Multiple scientific research indicates BHB salt increase ketone body system hence aiding weight loss Consuming True Keto 1800 formula stimulates ketosis turn body fatburning mode extended period According maker ketosis provides body adequate energy extended period even consuming fewer calorie True Keto 1800 Dosage consume two True Keto 1800 capsule daily get maximum benefit manufacturer recommends consuming morning breakfast However contains zero stimulant ingredient affect daily task sleep Thus consume True Keto 1800 time manufacturer confident get result desire 3–5 month form security True Keto 1800 offer moneyback guarantee Still take True Keto 1800 using medication scheduled surgery addition nursing pregnant woman use supplement guidance doctor Equally exceed suggested dosage unless directed physician Achieve Effective Results Using True Keto 1800 Supplement True Keto 1800 easytouse weight loss supplement need make complicated change lifestyle get result using supplement manufacturer recommends consuming True Keto 1800 pill daily get best result addition mindful eat stay hydrated perform regular exercise maximize effectiveness three stage involved usage formula including Step one — Consume Keto Pills consuming first dosage True Keto 1800 pill body start burn fat instantly formula increase ketone body system thus beginning conversion process fat fuel True Keto 1800 boldly claim lose 5 lb within first week Step two — Regular use True Keto 1800 must consume True Keto 1800 regularly accelerate oxidation fat Additionally regular usage keto pill help body stay ketosis extended period According producer shed 20 lb first month Similarly notice body becoming leaner trimmer consume True Keto 1800 consistently Step three — Body Transformations True Keto 1800 promise help achieve ideal weight However maintain optimal pound prevent weight gain need consume True Keto 1800 3–5 month Within time supplement fight craving hence help consume healthy meal longterm result True Keto 1800 Benefits multiple benefit consuming True Keto 1800 pill including support weight loss thus aid achieving ideal weight protect weightrelated condition like hypertension type two diabetes fight chronic joint pain inflammation boost immunity enhance recovery support better skin joint health Combined proper workout help develop muscular stature help embrace clean eating healthy lifestyle Pros Cons True Keto 1800 Supplements Pros contains 800 mg fullspectrum BHB salt scientifically proven support weight loss allnatural unlikely cause severe side effect True Keto 1800 easy consume use costeffective available online without prescription Cons True Keto 1800 available official website Results using Trim Life may vary depending person’s genetic makeup current weight guarantee work everyone contains gelatin hence veganfriendly HUGE SAVINGS TODAY Click Get True Keto 1800 Lowest Price Right Buy True Keto 1800 product available purchase True Keto 1800 official website Interested buyer visit True Keto 1800 take advantage discounted price company recommends buying official website avoid getting counterfeit product don’t deliver expected result BUY 3 GET 2 FREE Need Lose 25 Pounds Sell risk HIGH BUY 2 GET 1 FREE Need Lose 15 Pounds BUY 1 Needto Lose 7 Pounds Internet Exclusive Offers Available Limited supply available currently product stock ready ship within 24 hour submitting affirm read agreed Terms Conditions ORDER PURCHASE TRUE KETO 1800 VISITING OFFICIAL WEBSITE Final Thoughts True Keto 1800 weight loss supplement condition system stay ketosis ketosis body burn fat heat energy Additionally supplement prevents system storing fat fighting overeating However True Keto 1800 miracle pill consistent taking regularly make dietary lifestyle change permanent result True Keto 1800 ➢Product Name — True Keto 1800 ➢ Composition — Natural Organic Compound ➢ SideEffects — NA ➢ Price — Visit True Keto 1800 ➢ Supplement Type — Capsules ➢ Official Website Sale Live — WWWTRUEKETO1800COM True Keto 1800 dietary formula promising make body fatburning furnace 24 hour day Scientific fact show obesity cause chronic joint pain diabetes hypertension stroke heart attack Highcalorie food poor sleep quality stress sedentary lifestyle increased overweight individual US alone addition hundred supplementmaking company claim use highquality ingredient However fatburning formula work True Keto 1800 claim fight help user lose excess fat raising number ketone body system True Keto 1800 True Keto 1800 ketosisinducing weight loss solution fight obesity root creator assure user use premiumquality BHB ketone salt induce ketosis Similarly producer guarantee supplement contains stimulant psychoactive element Equally True Keto 1800 stimulates fat oxidation process zero side effect Additionally True Keto 1800 product USbased company GMP approved FDA verified Per official sale page maker claim TV personality Dr Oz support Keto diet SEE ALSO “Controversial True Keto 1800 Report — Never Tell This” True Keto 1800 Work True Keto 1800 contains full spectrum BHB increase fat metabolism body primarily work improving body’s ability shed weight Obese people seeking cut fat find hard lose weight regain create caloric deficit consuming fewer carbs using calorie statement may logical struggle low energy level craving Carbs provide body temporary energy digestion system store excess glucose form fat Experts claim lose weight body utilizes fat deposit system state body burn fat heat energy called ketosis safest effective way permanently getting rid excess fat isn’t easy condition system get ketosis ketogenic diet turn body fatburning furnace However may take week get ketosis depending diet alone Additionally follow restrictive diet may impossible people stay condition True Keto 1800 supplement act shortcut achieving ketosis Instead waiting 2–3 week get ketosis supplement help body utilize fat le seven day Per official sale page lose 5 lb within first seven day using supplement fullspectrum BHB True Keto 1800 target fat cell provide system fuel Thus instead carbs body us stored fat generate heat fuel addition True Keto 1800 help body stay ketosis state extended period Furthermore fight craving hence help achieve calorie deficit needed effective weight loss get True Keto 1800 Exclusive Discount Price online HUGE SAVINGS TODAY Ingredients True Keto 1800 primary ingredient True Keto 1800 fullspectrum BHB salt Multiple scientific research indicates BHB salt increase ketone body system hence aiding weight loss Consuming True Keto 1800 formula stimulates ketosis turn body fatburning mode extended period According maker ketosis provides body adequate energy extended period even consuming fewer calorie True Keto 1800 Dosage consume two True Keto 1800 capsule daily get maximum benefit manufacturer recommends consuming morning breakfast However contains zero stimulant ingredient affect daily task sleep Thus consume True Keto 1800 time manufacturer confident get result desire 3–5 month form security True Keto 1800 offer moneyback guarantee Still take True Keto 1800 using medication scheduled surgery addition nursing pregnant woman use supplement guidance doctor Equally exceed suggested dosage unless directed physician Achieve Effective Results Using True Keto 1800 Supplement True Keto 1800 easytouse weight loss supplement need make complicated change lifestyle get result using supplement manufacturer recommends consuming True Keto 1800 pill daily get best result addition mindful eat stay hydrated perform regular exercise maximize effectiveness three stage involved usage formula including Step one — Consume Keto Pills consuming first dosage True Keto 1800 pill body start burn fat instantly formula increase ketone body system thus beginning conversion process fat fuel True Keto 1800 boldly claim lose 5 lb within first week Step two — Regular use True Keto 1800 must consume True Keto 1800 regularly accelerate oxidation fat Additionally regular usage keto pill help body stay ketosis extended period According producer shed 20 lb first month Similarly notice body becoming leaner trimmer consume True Keto 1800 consistently Step three — Body Transformations True Keto 1800 promise help achieve ideal weight However maintain optimal pound prevent weight gain need consume True Keto 1800 3–5 month Within time supplement fight craving hence help consume healthy meal longterm result True Keto 1800 Benefits multiple benefit consuming True Keto 1800 pill including support weight loss thus aid achieving ideal weight protect weightrelated condition like hypertension type two diabetes fight chronic joint pain inflammation boost immunity enhance recovery support better skin joint health Combined proper workout help develop muscular stature help embrace clean eating healthy lifestyle Pros Cons True Keto 1800 Supplements Pros contains 800 mg fullspectrum BHB salt scientifically proven support weight loss allnatural unlikely cause severe side effect True Keto 1800 easy consume use costeffective available online without prescription Cons True Keto 1800 available official website Results using Trim Life may vary depending person’s genetic makeup current weight guarantee work everyone contains gelatin hence veganfriendly HUGE SAVINGS TODAY Click Get True Keto 1800 Lowest Price Right Buy True Keto 1800 product available purchase True Keto 1800 official website Interested buyer visit True Keto 1800 take advantage discounted price company recommends buying official website avoid getting counterfeit product don’t deliver expected result BUY 3 GET 2 FREE Need Lose 25 Pounds Sell risk HIGH BUY 2 GET 1 FREE Need Lose 15 Pounds BUY 1 Needto Lose 7 Pounds Internet Exclusive Offers Available Limited supply available currently product stock ready ship within 24 hour submitting affirm read agreed Terms Conditions ORDER PURCHASE TRUE KETO 1800 VISITING OFFICIAL WEBSITE Final Thoughts True Keto 1800 weight loss supplement condition system stay ketosis ketosis body burn fat heat energy Additionally supplement prevents system storing fat fighting overeating However True Keto 1800 miracle pill consistent taking regularly make dietary lifestyle change permanent result Copyright 2021 © True Keto 1800 Rights Reserved Terms Conditions Privacy Policy Contact Us Refund Policy READ httpshealthmartblogblogspotcom202112trueketo1800getperfectbodyshapehtml httpssitesgooglecomviewtrueketo1800healthhome httpswwwcompletefoodscodiyrecipestrueketo18004 httpswwwhomifycomprofessionals8878842trueketo1800store httpswwwhomifycomprojects1108538trueketo1800getperfectbodyshapespamlegitsalepricereviewsoffers httpscaramellaappcommiitchijonerOoovbrCmotrueketo1800 httpspromosimplecomps18e90trueketo1800getperfectbodyshapespam httpspromosimplecomgiveawaystrueketo1800getperfectbodyshapespamlegitsalepricereviewsoffers httpswwwemailmeformcombuilderemfTrueKeto1800reviewsTrueKeto1800reviews httpswwwfacebookcomTrueKeto1800100193502541176 httpswwwscoopittopictrueketo1800bytrueketo180043 httpstrueketo1800blogfooteocomnews20211221trueketo1800getperfectbodyshapespamlegitsalepricerevTags Keto Fatloss Health
|
187,992 |
A Surprising Thing Happened When I Stopped Eating For 3 Days
|
The Experiment
I planned to do a 1-day bone broth fast. Start with that, I thought, and then graduate to a 3-day fast later. That’s probably the reason I was able to overcome the mental barrier to even begin.
Here is what happened though:
Day 0
On Dec 23, I finished dinner around 8pm. I ate two Factor 75 meals with extra butter (wanted to load up before the fast). I went to bed that night knowing I wouldn’t eat solid food the next day. Already my mind was pissed at me. It mostly whispered that I would lose muscle mass and sacrifice all the strength gains I’ve made in recent months. I tried ignoring them and went to sleep.
Day 1
I woke up and my stomach was already grumbling. It had only been 12 hours and my body was already hangry.
I was going to do a bone broth fast, so I went to my kitchen to heat some up. Sadly, I didn’t plan this well and only had one small cup’s worth of broth left. One cup it is. I drank it slowly that morning.
The rest of the day went fine. I was hungry, but it wasn’t too difficult. I did feel weak and lethargic by late afternoon. Maybe it was my body switching into ketosis? More likely it was psychological. The fear of not eating is strong.
My stomach grumbled a lot during the day. It could have been from the stomach issues or just the transition to fasting. Empty stomachs sometimes grumble.
As I was getting ready for bed, I wondered if I should continue the fast for another day? I was already one day in. I might as well continue now that I have momentum. It made sense logically but my mind was pretty strongly against it.
I decided to wait and see how I felt in the morning.
Day 2
I journaled on day 2. Here are those entries:
8am
My mind is being a real pain in the @$$ this morning. I want to extend the fast and do a full 3-days, but it’s flipping its shit. I woke up needing to decide whether to continue and it whispered so many reasons not to. “You’re losing muscle. You’re being unhealthy. You’re being anti-social. Not eating is boring. You’re getting weaker. You don’t know if this is safe. Not eating is just not cool. Don’t you want to be cool!?!? Be cool dammit and start eating again… sorry, got emotional there. Feed me please?” I decided to continue fasting.
10am
I wanted to make more bone broth, so I went to CVS to get filtered water. While I was there, I had to walk the food aisles and thought again about breaking the fast. Whenever the whispers encourage me to eat and I say no, they push back more fiercely. I hope that eventually stops. My body feels lethargic as I write this. I’m going to do a short workout.
3pm
My stomach isn’t grumbling anymore. I don’t have the feeling of needing food. I still want to eat food, but it’s not a craving. It’s just my mind still holding to that idea that it’s better to eat all the time. The workout earlier felt awesome. It was about an hour of bodyweight exercises. I had much more energy afterward. All the lethargy from the earlier entry is gone.
8pm
I’ve been working for the last 3 hours with good focus. I just got up to take a short break and found myself shadow-boxing in front of a mirror. This fasting thing ain’t so bad.
Day 3
A few surprising things happened today.
Surprising thing #1
I didn’t feel tired at all today. Even though I slept poorly, I felt fine.
Surprising thing #2
I wasn’t hungry at all today. I drank one cup of bone broth around 8pm. However, I didn’t need it. I only drank it because I hoped it would help repair my gut, like Ariane had suggested.
Surprising thing #3
WARNING: this is 100% a n=1 observation, I have very limited and unreliable data, and it is most likely just a coincidence. < — seriously, it’s probably a coincidence.
That said, I’m including this because it DID surprise me. I have an irregular heartbeat. I’ve always had it. Last night, I used an AliveCor device on my phone to take an ECG reading and saw zero irregular beats. That never happens. So I took another sample and still zero. I tested again in the morning and they were back, but at a lower frequency than usual — only 1–2 in each minute sample. Again, this is probably related to other confounding factors, but it surprised me and I’m curious to research it more. If anyone knows of research on fasting and the heart, please share in the comments!
Surprising thing #4
This is the MOST surprising thing of all. I decided to work out with my brother around 6pm on day 3. We did a Crossfit workout — heavy back squats and then a WOD. I thought I’d be weaker after 3 days of fasting, but the exact opposite happened. I set a new personal record for my 1 rep max on my back squat.
I’ve always thought fasting would make me weak, tired, and unhappy.
And yet, 3 days in, I wasn’t craving food, I had more energy than usual, and I lifted more weight than I ever have before.
Take that you fearful labrador brain!
Benefits of the Fast
Of my five reasons for doing the fast experiment, all were at least moderately successful.
I felt less food obsessed after the fast
I broke the fast on Dec 27. Even though I started eating again, I didn’t have food cravings. It’s a difficult thing to explain. You have to feel it yourself to understand it. For example, I had two containers of Paleo granola in my cabinet and no cravings to eat them. Pre-fast, I would have eaten both in one sitting. I had sweet potato mash in one of my Factor meals, and it tasted sweet to the point that I didn’t want to eat it. I finished everything else and left that behind. I’ve never done that.
I got into Ketosis
Most likely, this decrease in food obsession was due to being in ketosis, just like I experienced in my 2012 keto experiment. This time, I didn’t use any devices for measuring ketone levels. I will for my next fast.
My gut felt better
My stomach is feeling subjectively better now than it was pre-fast. It’s hard to quantify, but observationally I don’t have the same morning aches or bloating symptoms that I was experiencing before.
I had more time
As expected, when you don’t eat, you also stop planning, prepping, cooking, and cleaning for meals. That left a lot of extra time in my days. I used that time to reflect on 2015 and start thinking about goals for 2016.
I learned that fasting is not as scary as I thought
Most importantly, I’m happy to have confronted my fear of fasting. It’s not so scary anymore. I did another one-day fast last week. My mind still objected, but I now know I won’t starve, wither, and die. Based on this experience, the opposite is more likely true. It’ll make me stronger and healthier.
What now?
As I write this, I’m no longer in ketosis. I ate a whole bag of KIND Granola tonight. I’m apparently back to being obsessed with food.
That’s okay! An experiment’s conclusion is only valid if it’s repeatable, right? I’ll just have to do another fast. I’ll use a keto blood meter to measure my ketone levels this time and I’ll definitely attempt another 1 RM back squat.
If that’s also repeatable, I might just stop eating food entirely.
|
https://betterhumans.pub/a-surprising-thing-happened-when-i-stopped-eating-for-3-days-ee1fe8b426cf
|
['Mark Moschel']
|
2021-10-12 11:18:35.819000+00:00
|
['Keto', 'Fasting', 'Health']
|
Title Surprising Thing Happened Stopped Eating 3 DaysContent Experiment planned 1day bone broth fast Start thought graduate 3day fast later That’s probably reason able overcome mental barrier even begin happened though Day 0 Dec 23 finished dinner around 8pm ate two Factor 75 meal extra butter wanted load fast went bed night knowing wouldn’t eat solid food next day Already mind pissed mostly whispered would lose muscle mass sacrifice strength gain I’ve made recent month tried ignoring went sleep Day 1 woke stomach already grumbling 12 hour body already hangry going bone broth fast went kitchen heat Sadly didn’t plan well one small cup’s worth broth left One cup drank slowly morning rest day went fine hungry wasn’t difficult feel weak lethargic late afternoon Maybe body switching ketosis likely psychological fear eating strong stomach grumbled lot day could stomach issue transition fasting Empty stomach sometimes grumble getting ready bed wondered continue fast another day already one day might well continue momentum made sense logically mind pretty strongly decided wait see felt morning Day 2 journaled day 2 entry 8am mind real pain morning want extend fast full 3days it’s flipping shit woke needing decide whether continue whispered many reason “You’re losing muscle You’re unhealthy You’re antisocial eating boring You’re getting weaker don’t know safe eating cool Don’t want cool cool dammit start eating again… sorry got emotional Feed please” decided continue fasting 10am wanted make bone broth went CVS get filtered water walk food aisle thought breaking fast Whenever whisper encourage eat say push back fiercely hope eventually stop body feel lethargic write I’m going short workout 3pm stomach isn’t grumbling anymore don’t feeling needing food still want eat food it’s craving It’s mind still holding idea it’s better eat time workout earlier felt awesome hour bodyweight exercise much energy afterward lethargy earlier entry gone 8pm I’ve working last 3 hour good focus got take short break found shadowboxing front mirror fasting thing ain’t bad Day 3 surprising thing happened today Surprising thing 1 didn’t feel tired today Even though slept poorly felt fine Surprising thing 2 wasn’t hungry today drank one cup bone broth around 8pm However didn’t need drank hoped would help repair gut like Ariane suggested Surprising thing 3 WARNING 100 n1 observation limited unreliable data likely coincidence — seriously it’s probably coincidence said I’m including surprise irregular heartbeat I’ve always Last night used AliveCor device phone take ECG reading saw zero irregular beat never happens took another sample still zero tested morning back lower frequency usual — 1–2 minute sample probably related confounding factor surprised I’m curious research anyone know research fasting heart please share comment Surprising thing 4 surprising thing decided work brother around 6pm day 3 Crossfit workout — heavy back squat WOD thought I’d weaker 3 day fasting exact opposite happened set new personal record 1 rep max back squat I’ve always thought fasting would make weak tired unhappy yet 3 day wasn’t craving food energy usual lifted weight ever Take fearful labrador brain Benefits Fast five reason fast experiment least moderately successful felt le food obsessed fast broke fast Dec 27 Even though started eating didn’t food craving It’s difficult thing explain feel understand example two container Paleo granola cabinet craving eat Prefast would eaten one sitting sweet potato mash one Factor meal tasted sweet point didn’t want eat finished everything else left behind I’ve never done got Ketosis likely decrease food obsession due ketosis like experienced 2012 keto experiment time didn’t use device measuring ketone level next fast gut felt better stomach feeling subjectively better prefast It’s hard quantify observationally don’t morning ache bloating symptom experiencing time expected don’t eat also stop planning prepping cooking cleaning meal left lot extra time day used time reflect 2015 start thinking goal 2016 learned fasting scary thought importantly I’m happy confronted fear fasting It’s scary anymore another oneday fast last week mind still objected know won’t starve wither die Based experience opposite likely true It’ll make stronger healthier write I’m longer ketosis ate whole bag KIND Granola tonight I’m apparently back obsessed food That’s okay experiment’s conclusion valid it’s repeatable right I’ll another fast I’ll use keto blood meter measure ketone level time I’ll definitely attempt another 1 RM back squat that’s also repeatable might stop eating food entirelyTags Keto Fasting Health
|
187,993 |
A List Of The Best Keto-Friendly Alcohol Drinks
|
There’s actually quite a variety to choose from…
Get your custom diet plan here
Tequila has various medical advantages (and contains low calories as compared to Smirnoff vodka). Agavins, the characteristic sugar found in tequila, are non-absorbable (which means they act like fiber) and won’t increase your blood glucose levels. Additionally, the sugar is appeared to help lower cholesterol and could assist you with getting more fit by cutting your weight. Yes, believe it or not, tequila can fit in consummately with a weight-reduction plan whenever taken with some restraint.
#Key Tip: The regular quantity of a glass of tequila is 1 ounce.
At last, all wine changes over into sugar, which isn’t beneficial for you. Even so, red wine specifically has some fabulous medical advantages. The dynamic substances in red wine (polyphenols, resveratrol, and quercetin) have been demonstrated to enhance in general your heart’s wellbeing. Besides, study carries out at the University of Massachusetts Amherst discovered that red wine hinders the procedure of glucose hitting the circulatory system, which prevents high spikes of insulin.
#Key Tip: The regular quantity of a glass of wine is 5 ounces.
Rum is definitely not a well known alcohol, however it ought to be (for its breathtaking medical advantages). Produced using molasses and other sugarcane side-products, rum has been demonstrated to improve psychological wellness from multiple points of view. With some restraint, a standard serving could help decrease tension, for instance.
Do you think you have an awful memory? If so, celebrate with champagne all the more frequently. The bubbly alcohol drink could conceivably improve your memory activity. What’s more, champagne could assist enhance the nature of your skin. I don’t understand your views, and however, as for me, these are two perspectives I have an inclination that I could enhance.
|
https://medium.com/@ketoalerts/a-list-of-the-best-keto-friendly-alcohol-drinks-dbee054f44bd
|
['Mc Boguz']
|
2022-01-16 20:35:18.831000+00:00
|
['Weight Loss', 'Health', 'Mental Health', 'Keto', 'Alcohol']
|
Title List Best KetoFriendly Alcohol DrinksContent There’s actually quite variety choose from… Get custom diet plan Tequila various medical advantage contains low calorie compared Smirnoff vodka Agavins characteristic sugar found tequila nonabsorbable mean act like fiber won’t increase blood glucose level Additionally sugar appeared help lower cholesterol could assist getting fit cutting weight Yes believe tequila fit consummately weightreduction plan whenever taken restraint Key Tip regular quantity glass tequila 1 ounce last wine change sugar isn’t beneficial Even red wine specifically fabulous medical advantage dynamic substance red wine polyphenols resveratrol quercetin demonstrated enhance general heart’s wellbeing Besides study carry University Massachusetts Amherst discovered red wine hinders procedure glucose hitting circulatory system prevents high spike insulin Key Tip regular quantity glass wine 5 ounce Rum definitely well known alcohol however ought breathtaking medical advantage Produced using molasses sugarcane sideproducts rum demonstrated improve psychological wellness multiple point view restraint standard serving could help decrease tension instance think awful memory celebrate champagne frequently bubbly alcohol drink could conceivably improve memory activity What’s champagne could assist enhance nature skin don’t understand view however two perspective inclination could enhanceTags Weight Loss Health Mental Health Keto Alcohol
|
187,994 |
The Most Common Injuries in Track & Field Athletes
|
Track & Field is a sport that involves a combination of activities that require running, jumping, and throwing. Due to the broad scope of different activities within the sport as well as the physical demands required, competing athletes are at high risk for injury.
Even those that don’t compete at a high level but instead participate recreationally can still experience injury. In fact, 80% of injuries associated with running are simply caused by repetitive stress and overuse.
Other injuries can be caused by collision, impact, poor technique, and lack of strength. These injuries can range from mild to severe and even persist chronically if the proper treatment and preventative measures aren’t met.
In what follows, we’ll be discussing the most common injuries related to the sport of Track & Field. We’ll also discuss potential treatments and preventative protocol measures to combat such injuries.
Most Common Track & Field-Related Injuries
Like many true Track & Field athletes, those with the most rigorous of schedules are most likely to get injured. Unfortunately, because the sport requires so many skills across several athletic disciplines, rigorous training hours are required to compete at an elite level.
Even athletes that simply participate in long-distance running will typically log anywhere from 50 to 100 miles of training each week. Mileage can even be higher in athletes of the highest caliber.
As you can imagine, this takes quite a toll on the body, including the muscles, bones, joints, tendons, and ligaments. In order to simply sustain this high level of activity, hours of recovery and preventative exercises are required. In addition, several hours are needed for extra measures to prevent or limit the risk of injury.
In any sport, and most definitely in Track & Field, injuries are inevitable, even in the most prepared of athletes. The following are the most common and prevalent injuries seen in track & field athletes:
• Patellofemoral Syndrome (Runners’ Knee)
• Patellar Tendonitis (Jumpers’ Knee)
• Plantar Fasciitis
• Hamstring Tear
• Achilles Tendonitis
Other common injuries prevalent in Track & Field, and more specifically sprinting and long-distance running, are shin splints, traumatic knee injuries, calf strain, ankle sprain, fractures, and IT band syndrome.
The large majority of track & field related injuries and, more specifically, running-related injuries are lower-extremity based.
Take My FREE PDF Which Reveals A Secret Technique Used By World Class Athletes To Recover Very Fast From Sports Injuries
Patellofemoral Syndrome
Otherwise known as runners’ knee, patellofemoral syndrome is most commonly caused by overuse. If you’re experiencing pain in the front of the knee or surrounding area, and you’re an avid runner, you may well be experiencing symptoms of runners’ knee.
Luckily, this type of injury can be non-invasively treated with guidance from your doctor and physical therapy.
Patellar Tendonitis
More commonly known as jumpers’ knee, patellar tendonitis is an injury of the patellar tendon, the ligament attaching the patella (kneecap) to the tibia. Patellar tendonitis is inflammation involving the patellar tendon due to repetitive impact and wear & tear.
Patellar tendonitis does have the rare complication of full ligament tear or rupture.
Take My FREE PDF Which Reveals A Secret Technique Used By World Class Athletes To Recover Very Fast From Sports Injuries
Plantar Fasciitis
One of the most common foot injuries in general, and certainly in Track & Field, plantar fasciitis is an overuse injury that causes discomfort and pain at the bottom of the foot (plantar surface). The injury occurs in cases of overuse and general wear and tear of the fascia at the plantar aspect of the foot and is best treated with rest.
While most cases are minor and can be treated at home, rare cases may need surgical treatment.
Hamstring Tear
Because the primary role of the hamstrings is to assist in deceleration, hamstring injuries are quite common in lower extremity power-based sports such as sprinting and long jump.
Hamstring injuries, though most often due to active injury, can also be the byproduct of tightness, weakness, and fatigue of the muscle itself. While hamstring tears that occur in sprinters are often more sudden and severe, those that occur in long-distance runners are typically slower to progress, developing from initial micro-tears and worsening over time.
Achilles Tendonitis
The Achilles tendon is a tendon attaching the calf muscle to the heel and is the largest tendon in the body. Because its primary function is to facilitate lower extremity movement of the leg and foot, Achilles injuries, both mild and severe, are quite common in track & field athletes.
While Achilles tendinitis can be a difficult condition, it can be treated effectively. Yet, it’s important to know that this condition can be a precursor to an even worse injury, such as Achilles tendon tear or rupture.
Unfortunately, an Achilles tendon tear or rupture is a common injury that can be seen in track & field athletes, and it will require surgery and months of rehabilitation.
Take My FREE PDF Which Reveals A Secret Technique Used By World Class Athletes To Recover Very Fast From Sports Injuries
Effective Treatment Options
If you’ve since been diagnosed with an injury or you’re experiencing symptoms that you presume may be a specific injury, it’s important to seek medical treatment immediately.
Effective treatment options commonly used for runner injuries include:
• Contrast therapy (hot and cold exposure)
• Physiotherapy
• Anti-inflammatory medication
• Muscle relaxants and pain relievers
• Non-steroidal injections
• Surgery
The type of treatment is dependent on the specific nature of the injury, and it’s best to seek personalized treatment specific to your injury. Your sports medicine specialist will be able to diagnose and recommend the best course of action for your injury.
Injury Prevention Tips for Track & Field Athletes
Although injuries can happen to anyone, especially competitive runners and track & field athletes, the nature of this sport is highly likely to yield injuries. It can be difficult in some cases to prevent such events from happening.
Preventative actions can still be implemented, and they are extremely helpful in reducing the chances of injury.
Below are the most effective preventative measures:
• Stretching (warming up & cooling down)
• Hydration
• Don’t overtrain
• Follow a slow progression plan (increase training volume strategically)
• Listen to your body
• Rest and recovery
• Implement a complementary strength training program
• Improve technique
The most common causes for injuries for runners and track & field athletes are overuse, overtraining, and lack of preventative rehabilitation and recovery. By following the recommended measures, athletes will put themselves in a much better position to prevent injuries.
Take My FREE PDF Which Reveals A Secret Technique Used By World Class Athletes To Recover Very Fast From Sports Injuries
Final Thoughts
Many track & field athletes and distance runners are likely to experience an injury at some point in their journey. The minute the symptoms of pain and discomfort develop, it’s best to seek early evaluation by a medical professional to ensure proper diagnosis and treatment.
Additionally, it helps to use other at-home treatment techniques, such as rest, contrast therapy, and stretching. Preventative measures can also be the key to a continuous healthy career as a track and field athlete.
|
https://medium.com/@lettersfromnonso/the-most-common-injuries-in-track-field-athletes-aabe1a81a639
|
['Nonso Eugene']
|
2021-12-18 20:43:32.714000+00:00
|
['Track And Field Injuries', 'Injury Prevention', 'Track And Field', 'Keto', 'Track And Field Sports']
|
Title Common Injuries Track Field AthletesContent Track Field sport involves combination activity require running jumping throwing Due broad scope different activity within sport well physical demand required competing athlete high risk injury Even don’t compete high level instead participate recreationally still experience injury fact 80 injury associated running simply caused repetitive stress overuse injury caused collision impact poor technique lack strength injury range mild severe even persist chronically proper treatment preventative measure aren’t met follows we’ll discussing common injury related sport Track Field We’ll also discus potential treatment preventative protocol measure combat injury Common Track FieldRelated Injuries Like many true Track Field athlete rigorous schedule likely get injured Unfortunately sport requires many skill across several athletic discipline rigorous training hour required compete elite level Even athlete simply participate longdistance running typically log anywhere 50 100 mile training week Mileage even higher athlete highest caliber imagine take quite toll body including muscle bone joint tendon ligament order simply sustain high level activity hour recovery preventative exercise required addition several hour needed extra measure prevent limit risk injury sport definitely Track Field injury inevitable even prepared athlete following common prevalent injury seen track field athlete • Patellofemoral Syndrome Runners’ Knee • Patellar Tendonitis Jumpers’ Knee • Plantar Fasciitis • Hamstring Tear • Achilles Tendonitis common injury prevalent Track Field specifically sprinting longdistance running shin splint traumatic knee injury calf strain ankle sprain fracture band syndrome large majority track field related injury specifically runningrelated injury lowerextremity based Take FREE PDF Reveals Secret Technique Used World Class Athletes Recover Fast Sports Injuries Patellofemoral Syndrome Otherwise known runners’ knee patellofemoral syndrome commonly caused overuse you’re experiencing pain front knee surrounding area you’re avid runner may well experiencing symptom runners’ knee Luckily type injury noninvasively treated guidance doctor physical therapy Patellar Tendonitis commonly known jumpers’ knee patellar tendonitis injury patellar tendon ligament attaching patella kneecap tibia Patellar tendonitis inflammation involving patellar tendon due repetitive impact wear tear Patellar tendonitis rare complication full ligament tear rupture Take FREE PDF Reveals Secret Technique Used World Class Athletes Recover Fast Sports Injuries Plantar Fasciitis One common foot injury general certainly Track Field plantar fasciitis overuse injury cause discomfort pain bottom foot plantar surface injury occurs case overuse general wear tear fascia plantar aspect foot best treated rest case minor treated home rare case may need surgical treatment Hamstring Tear primary role hamstring assist deceleration hamstring injury quite common lower extremity powerbased sport sprinting long jump Hamstring injury though often due active injury also byproduct tightness weakness fatigue muscle hamstring tear occur sprinter often sudden severe occur longdistance runner typically slower progress developing initial microtears worsening time Achilles Tendonitis Achilles tendon tendon attaching calf muscle heel largest tendon body primary function facilitate lower extremity movement leg foot Achilles injury mild severe quite common track field athlete Achilles tendinitis difficult condition treated effectively Yet it’s important know condition precursor even worse injury Achilles tendon tear rupture Unfortunately Achilles tendon tear rupture common injury seen track field athlete require surgery month rehabilitation Take FREE PDF Reveals Secret Technique Used World Class Athletes Recover Fast Sports Injuries Effective Treatment Options you’ve since diagnosed injury you’re experiencing symptom presume may specific injury it’s important seek medical treatment immediately Effective treatment option commonly used runner injury include • Contrast therapy hot cold exposure • Physiotherapy • Antiinflammatory medication • Muscle relaxant pain reliever • Nonsteroidal injection • Surgery type treatment dependent specific nature injury it’s best seek personalized treatment specific injury sport medicine specialist able diagnose recommend best course action injury Injury Prevention Tips Track Field Athletes Although injury happen anyone especially competitive runner track field athlete nature sport highly likely yield injury difficult case prevent event happening Preventative action still implemented extremely helpful reducing chance injury effective preventative measure • Stretching warming cooling • Hydration • Don’t overtrain • Follow slow progression plan increase training volume strategically • Listen body • Rest recovery • Implement complementary strength training program • Improve technique common cause injury runner track field athlete overuse overtraining lack preventative rehabilitation recovery following recommended measure athlete put much better position prevent injury Take FREE PDF Reveals Secret Technique Used World Class Athletes Recover Fast Sports Injuries Final Thoughts Many track field athlete distance runner likely experience injury point journey minute symptom pain discomfort develop it’s best seek early evaluation medical professional ensure proper diagnosis treatment Additionally help use athome treatment technique rest contrast therapy stretching Preventative measure also key continuous healthy career track field athleteTags Track Field Injuries Injury Prevention Track Field Keto Track Field Sports
|
187,995 |
How can I lose weight faster in 10 days with no exercise?
|
Hey People I have an Intense Idea on these Weight Loss Supplements I know One that works for me and the people I’ve introduced it to.
but! before then there are some tips you need to know about losing weights
.Burn The Fats Here Without Exercise
These brilliant and simple tips will assist you with thinning down, and you don’t have to bind up your tennis shoes.
All things considered, with regards to getting in shape, what you eat is critical — and concentrates on show there are a lot of weight reduction procedures that don’t have anything to do with work out. Look at this 5 science-upheld, thin-down tips.
1. Control your parts.
At the point when you’re at home, eat from more modest plates and bowls. You’ll probably take in fewer calories, and it fools your mind into believing you’re chowing down on more than you really are. (Do the contrary when you’re eating quality food sources, similar to servings of mixed greens or cooked veggies — then, at that point, it’s a good idea to supersize those dishes!). Another significant hint: Don’t eat from bundles of anything, even those “better” chips or wafers. Segment some out into a dish, and set the sack or box aside.
2. Eat more fiber.
“Fiber assists with weight reduction in such countless ways,” says Karen Ansel, M.S., R.D.N., creator of Healing Superfoods for Anti-Aging: Stay Younger, Live Longer. “First of all, it grows in your stomach like a wipe so it’s a characteristic hunger suppressant. In addition, the most recent examination is observing it valuably affects great stomach microorganisms that assist with delivering chemicals in the stomach that tell your cerebrum you’ve sufficiently had to eat. Focus on no less than 25 grams every day from an assortment of food varieties like entire grains, beans, natural products, and vegetables.”
3. Load up on protein as well.
“Like fiber, protein normally assists you with feeling full by impacting the creation of satiety chemicals,” says Ansel. “It consumes a large chunk of the day to process, so you’re probably not going to go rummaging for a nibble later a protein-rich supper. Furthermore here’s a slick stunt: Protein additionally takes more energy to process than, say, fat or carbs, so you don’t store a considerable lot of its calories. For greatest effect focus on 20 grams for each feast from lean proteins like fish, chicken, turkey, eggs, and low-fat dairy.”
4. Get sufficient rest.
It’s ground that lack of sleep can prompt weight gain. It comes down to chemicals: Sleep denied individuals produce more ghrelin, a craving animating chemical. Also, they produce less leptin, the chemical that lets you know when you’ve sufficiently eaten. There’s likewise proof that the excessively languid eat more calories and more solace food-crabs. Furthermore, it’s nothing unexpected that when you’re depleted, it’s harder to control your driving forces (which means, snatching many treats might appear to be a fine thought).
5. Eat all the more carefully.
As such, dial back. Your cerebrum needs to find your mouth and convey the message that you’re full, and that is more earnestly when you’re speeding through your dinner. Additionally, studies have shown that when you’re diverted, you will more often than not eat more. So stash your telephone, switch off the TV, and focus on the thing you’re eating.
Start Burning Those Fats Here and Now. No Exercise Needed
Weight loss without Exercise with this Amazing Supplement..
|
https://medium.com/@delegendmedia/how-can-i-lose-weight-faster-in-10-days-with-no-exercise-53a9cb6b8626
|
[]
|
2021-12-31 20:07:39.211000+00:00
|
['Weight Loss', 'Weight Loss Supplements', 'Keto', 'Weightloss Foods', 'Weight Loss Tips']
|
Title lose weight faster 10 day exerciseContent Hey People Intense Idea Weight Loss Supplements know One work people I’ve introduced tip need know losing weight Burn Fats Without Exercise brilliant simple tip assist thinning don’t bind tennis shoe thing considered regard getting shape eat critical — concentrate show lot weight reduction procedure don’t anything work Look 5 scienceupheld thindown tip 1 Control part point you’re home eat modest plate bowl You’ll probably take fewer calorie fool mind believing you’re chowing really contrary you’re eating quality food source similar serving mixed green cooked veggie — point it’s good idea supersize dish Another significant hint Don’t eat bundle anything even “better” chip wafer Segment dish set sack box aside 2 Eat fiber “Fiber assist weight reduction countless ways” say Karen Ansel MS RDN creator Healing Superfoods AntiAging Stay Younger Live Longer “First grows stomach like wipe it’s characteristic hunger suppressant addition recent examination observing valuably affect great stomach microorganism assist delivering chemical stomach tell cerebrum you’ve sufficiently eat Focus le 25 gram every day assortment food variety like entire grain bean natural product vegetables” 3 Load protein well “Like fiber protein normally assist feeling full impacting creation satiety chemicals” say Ansel “It consumes large chunk day process you’re probably going go rummaging nibble later proteinrich supper Furthermore here’s slick stunt Protein additionally take energy process say fat carbs don’t store considerable lot calorie greatest effect focus 20 gram feast lean protein like fish chicken turkey egg lowfat dairy” 4 Get sufficient rest It’s ground lack sleep prompt weight gain come chemical Sleep denied individual produce ghrelin craving animating chemical Also produce le leptin chemical let know you’ve sufficiently eaten There’s likewise proof excessively languid eat calorie solace foodcrabs Furthermore it’s nothing unexpected you’re depleted it’s harder control driving force mean snatching many treat might appear fine thought 5 Eat carefully dial back cerebrum need find mouth convey message you’re full earnestly you’re speeding dinner Additionally study shown you’re diverted often eat stash telephone switch TV focus thing you’re eating Start Burning Fats Exercise Needed Weight loss without Exercise Amazing SupplementTags Weight Loss Weight Loss Supplements Keto Weightloss Foods Weight Loss Tips
|
187,996 |
Becoming the Best Engaging Speaker for your Business
|
Public speaking is the most common way of planning and conveying a message to a crowd of people. Powerful open speaking includes understanding your crowd and speaking objectives, picking components for the discourse that will draw in your crowd with your point, and delivering your message handily. Great adult speakers understand that they should design, put together, and update their material to foster a compelling discourse.
Its significance
Whether planning or organizing business contacts, or leading a meeting, an engaging speaker associates and show abilities as a fundamental part of the expert achievement. Helpless relational abilities can be a huge expert divert and can cost you cash, advancement, or even your work.
Ordinarily, we feel that the best chefs have the smartest thoughts and settle on visionary choices. These are unquestionably advantageous characteristics; however, they are not the abilities that will soar you to authority achievement. Knowing how to lead change will, and becoming amazing at public speaking, is a key part.
So how might you sharpen your public speaking and expert relational abilities and take your profession to a higher level? For some individuals, the vital lies in communication and show training to acquire that expert edge. Here are only a couple of the advantages of business/leadership speaker training:
· Proficient communication training will change you as well as your workers into sure, expressive and proficient speakers and will further develop their communication both inside the organization and with customers.
· Your show abilities will affect the brand and picture of your organization. The training addresses the advancement of a dynamic, drawing in speaking voice, fundamental to conveying your message with certainty.
· Miscommunication can prompt disarray, troubled clients and lost business. By guaranteeing you and additionally your group speak with clearness and demonstrable skill, you can further develop client assistance, increment consumer loyalty, and work on your main concern!
· Relational abilities are intently attached to efficiency. Reliable communication considers viable administration, guaranteeing that undertakings are promptly perceived and appropriately executed, diminishing the wiggle room. Data is efficient and spread accurately, which implies cut-off times are met on schedule.
As well as learning the most common way of making and conveying a successful discourse, understudies of public speaking leave the class with various advantages too. A portion of these advantages incorporate:
· creating decisive reasoning abilities,
· verbal and nonverbal abilities,
· conquering apprehension of public speaking.
As of late, we have had numerous experts start to work with us because of senior administration telling them their relational abilities are keeping them away from proficient development and advancement. Try not to trust that that will happen to you! Make a move today with great public speaking.
|
https://medium.com/@reviveuandi/becoming-the-best-engaging-speaker-for-your-business-6b45f660eec3
|
['Revive Uandi']
|
2021-12-17 09:08:10.533000+00:00
|
['Public Speaking', 'Engaging Speaker', 'Adult Speaker', 'Business', 'Youth Speaker']
|
Title Becoming Best Engaging Speaker BusinessContent Public speaking common way planning conveying message crowd people Powerful open speaking includes understanding crowd speaking objective picking component discourse draw crowd point delivering message handily Great adult speaker understand design put together update material foster compelling discourse significance Whether planning organizing business contact leading meeting engaging speaker associate show ability fundamental part expert achievement Helpless relational ability huge expert divert cost cash advancement even work Ordinarily feel best chef smartest thought settle visionary choice unquestionably advantageous characteristic however ability soar authority achievement Knowing lead change becoming amazing public speaking key part might sharpen public speaking expert relational ability take profession higher level individual vital lie communication show training acquire expert edge couple advantage businessleadership speaker training · Proficient communication training change well worker sure expressive proficient speaker develop communication inside organization customer · show ability affect brand picture organization training address advancement dynamic drawing speaking voice fundamental conveying message certainty · Miscommunication prompt disarray troubled client lost business guaranteeing additionally group speak clearness demonstrable skill develop client assistance increment consumer loyalty work main concern · Relational ability intently attached efficiency Reliable communication considers viable administration guaranteeing undertaking promptly perceived appropriately executed diminishing wiggle room Data efficient spread accurately implies cutoff time met schedule well learning common way making conveying successful discourse understudy public speaking leave class various advantage portion advantage incorporate · creating decisive reasoning ability · verbal nonverbal ability · conquering apprehension public speaking late numerous expert start work u senior administration telling relational ability keeping away proficient development advancement Try trust happen Make move today great public speakingTags Public Speaking Engaging Speaker Adult Speaker Business Youth Speaker
|
187,997 |
3 Costly Public Speaking Myths That Hurt Leader’s Influence
|
Myths vs Realities of Influential Speaking
Most business leaders know public speaking is a valuable skill. And many of them work hard at it.
They write their presentations, rehearse, and build slide decks.
They give their speeches.
But, they don’t get the results they expect.
Prospective customers don’t buy their product or service.
Their team doesn’t buy into their message.
Potential investors don’t buy into their company.
This leads to frustration, disappointment, and disillusionment. They may question their abilities as speakers and communicators.
The problem isn’t their capabilities. They don’t understand the fundamentals of effective speaking.
Therefore, to help with this skill, here are three common myths. And insights to overcome them to become a more influential and persuasive presenter:
Public Speaking Myth #1
“Great speakers are born that way.”
It’s October 1994. I’m a Certified Financial Planner. I’m seated in my boss’s office. We’ve just reviewed evaluations from the last retirement planning workshop I had facilitated.
And they aren’t positive. They’re so bad, in fact, that my boss says, “You’re not a very good speaker. You need to fix this, or else.”
That day I started calling around to ask for help. One of my friends suggested I attend a meeting of Toastmasters International. If you’re not familiar with them, they help people manage their fear of speaking to become more effective presenters.
One of the first lessons I learned is:
Public speaking is like riding a bike, driving a car, or any other skill… it’s learnable.
I was always under the impression you were either born with the gift of speaking, or you weren’t.
Toastmasters, and later the National Speakers Association, taught me the fundamentals of speaking.
The Reality of public speaking is:
Great speakers are made, not born. You just have to discover the fundamentals and use them.
Are you willing to take the time to learn and hone these valuable skills?
Public Speaking Myth #2
“Audiences want you to share new information”
Think about a speaker you’ve heard who was recognized as an expert in his or her field. This person gave useful information in an entertaining fashion, but at some point in the talk, you realized, “Enough already! This is too much.” You felt stuffed, like someone who had too much food at a holiday meal.
This is not uncommon. Many leaders believe audiences want as much information as possible about their topic.
They don’t. Your audience has more information available through their mobile phones than you’ll ever be able to present.
The Reality is:
People don’t want more information. They want your perspective and experience about your topic.
What’s your interpretation of the latest research?
What experiences have you had, both positive and negative?
What success stories can you share?
Are you willing to do the work to share your perspective and cut out the information they can get elsewhere?
Public Speaking Myth #3
Only 7% of effective communication is based on the words you use.
This myth has been perpetuated for over five decades. It’s based on the misinterpretation of a study done in 1967 by Dr. Albert Mehrabian.
In his research, Dr. Mehrabian made this observation:
When a person communicates with another and her words aren’t congruent with tone of voice, feelings, or energy, the listener will only believe words 7% of the time.
Many people in the communication field, including highly paid professional speakers, have promoted this idea:
“Words account for only 7% of the impact in your communication.”
This is not what Dr. Mehrabian claimed. In the years following his research, he has repeatedly attempted to contradict this myth.
If words only account for 7% of communication, what does that say about email or text? Do the words only account for 7% of those types of communication?
If you watched a movie or TV show in a foreign language you were not familiar with, would you understand the plot and the emotions at a 93% level?
And my favorite example of this myth is:
“We’ve been waiting for previously agreed upon changes and modifications to be enacted, but they have failed to materialize.
“The end users of these promised changes have been let down, many times at a tragic cost to them and their individual teams. This has had a massive impact on the bottom line at all levels of our great organization.
“Therefore, we’ve assembled a committee and we’re crafting a new vision and mission statement for immediate implementation to modify the current status and improve the user experience for all shareholders involved.
In case you haven’t figured it out, that’s Dr. King’s most memorable speech boiled down to a few lines of corporate speak.
If words don’t matter, why didn’t Dr. King provide a shortened version of his speech like this one at the March on Washington in 1963?
Is it possible his eloquent message resonates six decades later because of the power of his words?
Do you remember how he used his hands and body language?
There are many myths that derail the impact of speeches. If the reality of these three myths resonates with you, you’re on your way to improved speaking. Focus on the reality of these myths, and you’ll increase your influence and impact.
If you’d like more insights into public speaking skills, feel free to schedule a no-cost, no-obligation call with me. I’m happy to answer your questions. Feel free to schedule a 20 to 30-minute call with Michael Davis: https://bit.ly/CPR30Call
|
https://medium.com/@speakingcpr/3-costly-public-speaking-myths-that-hurt-leaders-influence-28ea99579a26
|
['Michael Davis']
|
2021-11-26 18:49:46.009000+00:00
|
['Public Speaking', 'Storytelling', 'Management And Leadership', 'Leadership Development', 'Presentation Tips']
|
Title 3 Costly Public Speaking Myths Hurt Leader’s InfluenceContent Myths v Realities Influential Speaking business leader know public speaking valuable skill many work hard write presentation rehearse build slide deck give speech don’t get result expect Prospective customer don’t buy product service team doesn’t buy message Potential investor don’t buy company lead frustration disappointment disillusionment may question ability speaker communicator problem isn’t capability don’t understand fundamental effective speaking Therefore help skill three common myth insight overcome become influential persuasive presenter Public Speaking Myth 1 “Great speaker born way” It’s October 1994 I’m Certified Financial Planner I’m seated boss’s office We’ve reviewed evaluation last retirement planning workshop facilitated aren’t positive They’re bad fact bos say “You’re good speaker need fix else” day started calling around ask help One friend suggested attend meeting Toastmasters International you’re familiar help people manage fear speaking become effective presenter One first lesson learned Public speaking like riding bike driving car skill… it’s learnable always impression either born gift speaking weren’t Toastmasters later National Speakers Association taught fundamental speaking Reality public speaking Great speaker made born discover fundamental use willing take time learn hone valuable skill Public Speaking Myth 2 “Audiences want share new information” Think speaker you’ve heard recognized expert field person gave useful information entertaining fashion point talk realized “Enough already much” felt stuffed like someone much food holiday meal uncommon Many leader believe audience want much information possible topic don’t audience information available mobile phone you’ll ever able present Reality People don’t want information want perspective experience topic What’s interpretation latest research experience positive negative success story share willing work share perspective cut information get elsewhere Public Speaking Myth 3 7 effective communication based word use myth perpetuated five decade It’s based misinterpretation study done 1967 Dr Albert Mehrabian research Dr Mehrabian made observation person communicates another word aren’t congruent tone voice feeling energy listener believe word 7 time Many people communication field including highly paid professional speaker promoted idea “Words account 7 impact communication” Dr Mehrabian claimed year following research repeatedly attempted contradict myth word account 7 communication say email text word account 7 type communication watched movie TV show foreign language familiar would understand plot emotion 93 level favorite example myth “We’ve waiting previously agreed upon change modification enacted failed materialize “The end user promised change let many time tragic cost individual team massive impact bottom line level great organization “Therefore we’ve assembled committee we’re crafting new vision mission statement immediate implementation modify current status improve user experience shareholder involved case haven’t figured that’s Dr King’s memorable speech boiled line corporate speak word don’t matter didn’t Dr King provide shortened version speech like one March Washington 1963 possible eloquent message resonates six decade later power word remember used hand body language many myth derail impact speech reality three myth resonates you’re way improved speaking Focus reality myth you’ll increase influence impact you’d like insight public speaking skill feel free schedule nocost noobligation call I’m happy answer question Feel free schedule 20 30minute call Michael Davis httpsbitlyCPR30CallTags Public Speaking Storytelling Management Leadership Leadership Development Presentation Tips
|
187,998 |
Checklist for a Successful Public Speaking Gig
|
If you’ve spent any time at all doing public speaking gigs then chances are that you’re well aware of how important it is to ensure you’ve got all of the essentials covered. If nothing else, it means that you won’t worry that you’ve forgotten something. You need to be organized to be able to devote all of your attention to your speaking gig.
And so with that in mind, we’ve put our heads together and created this checklist that every public speaker needs if they want to guarantee that they’re giving their best possible performances. Let’s dive in and take a look.
1. Backups
One of the biggest mistakes that newbie public speakers make is failing to create backups of their presentations. This is a good idea in general and is a huge safeguard when you’re creating a presentation as it means you can roll back to an earlier version if your file gets corrupted or you need to undo some changes. Most modern writing software includes version control, but saving backups will give you that belt and braces confidence. It’s even more important when you’re heading off to the venue. Storing your files in Dropbox or similar is a good idea, but it’s also worth taking your presentation on a couple of flash drives in case there’s no internet connection.2. Handouts
If you’re planning on handing out any materials to your attendees, make sure that you remember to prepare them in time to be printed if necessary, and to have spare copies with you as well as access to an online copy. You never know when extra people might show up at the last minute or when someone might spill their coffee and need another one.
3. A change of clothes
Speaking of spilled coffee, it’s also worth taking a change of clothes with you, just in case. It’s all about redundancy and making sure that you’re covered (literally in this case) if something goes wrong. The last thing that you want is to be tucking into a free doughnut at a conference and to end up spilling jam down your shirt. Taking a change of clothes means you won’t spend the hour on the run up to your talk hunting for a nearby clothes shop or desperately dabbing at the stains on your clothes.
4. Spare batteries and chargers
Chances are that you’re using some sort of technology as part of your talk, whether that’s a laser pointer or a laptop computer. Where possible, ensure that you have spare batteries for all of your gadgets and that they’re fully charged, and if you may not be able to charge the battery on your laptop from the mains, get yourself a portable charger. Come to think of it, get one of those anyway for your smartphone and other peripherals.
5. Emergency contacts
Make sure that you have a record of the emergency contact numbers for the event organizers. We’d recommend keeping both a copy on your smartphone and a physical copy in your wallet, so if something goes wrong or you have an important question, you can get in touch with them.
6. Business cards
This might seem like an obvious one, but you’d be surprised at how often people forget to make sure that they have enough business cards. You’ll want to take more than you think you’re likely to need so that if things go well and you make a lot of contacts, you still have more than enough to go around.
7. Bottles of water
Packing a few bottles of water will help you ensure that you’re well hydrated before, during, and after your talk. If you don’t pay attention to hydration, your mind will be sluggish and you risk losing your voice in the middle of an important conversation, which is embarrassing at best, and is actively damaging when you’re trying to make a good impression. If you’re flying internationally, make a point of buying some bottled water once you land.
8. Eyeglasses and medication
If you wear glasses, be sure to take a spare pair. If you take medication, make sure that you’ve got enough to see you through to the end of the event or trip, preferably with a couple of days of wiggle room. If you are to perform at your best, it’s essential to prepare every aspect, and that includes being able to read or find your way around, and not running out of the essentials.
9. Pens and a notebook
This might seem more like something that should be recommended to attendees instead of speakers, but it’s always a good idea to have them handy. You can use them to jot down notes as well as feedback from the audience after your session, and it can also help you to look busy and attentive when you’re watching other speakers. In panel discussions, you can note down questions or areas that you want to address when the mic reaches you, or take a look at when you’re back in the office.
10. Tickets and instructions
If you’ve been sent tickets, instructions, or physical passes for the event, be sure to take them with you. True, if you’re one of the speakers then they’re going to know who you are and will still let you in, but it’s never a good look if you forget them. Directions can be particularly useful, especially if you’re going to a venue that you’ve not visited before.
Conclusion
Now that you’ve seen our list of essentials for a successful public speaking gig, we want to hear from you. What goes on to your checklist, and have you ever been caught out because you were missing something that you were reliant on?
As always, be sure to let us know your thoughts in the comments so that we can keep the discussion going. You can also check back often and follow us on your social networking sites of choice for further updates. We’ll see you soon!
This was originally posted on SpeakerHub Skillcamp.
|
https://medium.com/@speakerhubhq/checklist-for-a-successful-public-speaking-gig-f61f106d4a21
|
[]
|
2021-12-20 01:11:32.077000+00:00
|
['Public Speaking', 'Public Speaker', 'Public Speaking Tips', 'Speakerhub', 'Checklist']
|
Title Checklist Successful Public Speaking GigContent you’ve spent time public speaking gig chance you’re well aware important ensure you’ve got essential covered nothing else mean won’t worry you’ve forgotten something need organized able devote attention speaking gig mind we’ve put head together created checklist every public speaker need want guarantee they’re giving best possible performance Let’s dive take look 1 Backups One biggest mistake newbie public speaker make failing create backup presentation good idea general huge safeguard you’re creating presentation mean roll back earlier version file get corrupted need undo change modern writing software includes version control saving backup give belt brace confidence It’s even important you’re heading venue Storing file Dropbox similar good idea it’s also worth taking presentation couple flash drive case there’s internet connection2 Handouts you’re planning handing material attendee make sure remember prepare time printed necessary spare copy well access online copy never know extra people might show last minute someone might spill coffee need another one 3 change clothes Speaking spilled coffee it’s also worth taking change clothes case It’s redundancy making sure you’re covered literally case something go wrong last thing want tucking free doughnut conference end spilling jam shirt Taking change clothes mean won’t spend hour run talk hunting nearby clothes shop desperately dabbing stain clothes 4 Spare battery charger Chances you’re using sort technology part talk whether that’s laser pointer laptop computer possible ensure spare battery gadget they’re fully charged may able charge battery laptop main get portable charger Come think get one anyway smartphone peripheral 5 Emergency contact Make sure record emergency contact number event organizer We’d recommend keeping copy smartphone physical copy wallet something go wrong important question get touch 6 Business card might seem like obvious one you’d surprised often people forget make sure enough business card You’ll want take think you’re likely need thing go well make lot contact still enough go around 7 Bottles water Packing bottle water help ensure you’re well hydrated talk don’t pay attention hydration mind sluggish risk losing voice middle important conversation embarrassing best actively damaging you’re trying make good impression you’re flying internationally make point buying bottled water land 8 Eyeglasses medication wear glass sure take spare pair take medication make sure you’ve got enough see end event trip preferably couple day wiggle room perform best it’s essential prepare every aspect includes able read find way around running essential 9 Pens notebook might seem like something recommended attendee instead speaker it’s always good idea handy use jot note well feedback audience session also help look busy attentive you’re watching speaker panel discussion note question area want address mic reach take look you’re back office 10 Tickets instruction you’ve sent ticket instruction physical pass event sure take True you’re one speaker they’re going know still let it’s never good look forget Directions particularly useful especially you’re going venue you’ve visited Conclusion you’ve seen list essential successful public speaking gig want hear go checklist ever caught missing something reliant always sure let u know thought comment keep discussion going also check back often follow u social networking site choice update We’ll see soon originally posted SpeakerHub SkillcampTags Public Speaking Public Speaker Public Speaking Tips Speakerhub Checklist
|
187,999 |
My Protégé Experience
|
Thank you, Toastmaster, for introducing me. Hello everyone, I am Amy again, the product design researcher at Citrix based in the Santa Clara office. Today, I will talk about my experience as a protégé, a new vocabulary that I learned from this Toastmaster’s project.
Before this project, I never distinguished a manager, a boss, a coach, or a mentor. To me, these four terms were synonyms. If you had heard my speech regarding my leadership styles, you knew I was a very obedient worker. The manager was the boss that I had to obey. The manager was also a coach, aka a mentor that gave me work instructions. I never thought about the difference.
My definition of a mentor changed after I read the materials from this project. Now I know that the mentor should be the one who guides me to reach my long-term goals. And a coach is someone who helps me achieve short-term aims. Keeping this new definition in mind, I found I had a lot of great coaches who provided guidance and training to polish my certain skillsets. However, I had very few mentors.
The protégé experience I will share with you today is about a person that most of our old Toastrix members know: Daniel Hor.
Daniel was not my manager and definitely not my boss. He was a co-worker who got on board on the same day as I did. He was the only senior researcher here in the Santa Clara office. I didn’t notice how much mentorship I received from him until I started this project.
Daniel, as some of you know, was very enthusiastic about helping others. He always volunteered to do a lot of work. Without me asking, he always provided me with his supports and advice. He became my mentor in a subtle way that we both didn’t notice.
There was no official protégé and mentor relationship between us. But as the only senior researcher near me, he guided me naturally and spent his working hours and personal time to understand my needs.
When he was still in the company, we would have lunch together every day and share what had been happening in our lives. I would ask him not only the research questions but also the broader questions from how to become a senior researcher, how to improve as a user experience professional, to how to live a happy life. Being in the industry for about eight years and having a kid and his own family, his abundant life and work experience helped me explore the possibilities of my career and my life.
He was not a coach that would give me tasks. He would not focus on helping me polish a small set of skills. As a mentor, he usually just gave me his feedback on what I was doing and shared his experience so I could find commonality and learn from it.
I remember one time he reviewed my diary study and gave me a lot of feedback on details for the best practice. However, I didn’t have time to change anything, and I needed to start data collection right away. He told me that it was ok. I would learn to see if my way worked, or I would just suffer from the data analysis because of the structure of the study, and I would still learn in a hard way though. In the end, I did suffer, and I did learn. I appreciated his honest feedback and his chill attitude on “things might go wrong, but you would be fine, and you will just learn.”
Besides his attitude to work, I also learned from him to try not to be afraid of controversy. If you know Daniel, he is interested in conversations even debates. He was never afraid to share his opinions even on topics like religion, politics, and sexualities. And he always encouraged me to do the same and tried to be curious and ask questions all the time.
From him, I truly see the value of communication. Communication might not solve all the problems, but if people are just too afraid to talk, we might miss what others are thinking, and we will solve nothing.
Being not afraid of learning from failure, never avoiding sensitive topics, and being curious are the three things Daniel has taught me. They are beneficial traits for not only my career but also my life.
|
https://medium.com/@amychen_59433/my-prot%C3%A9g%C3%A9-experience-53c17d4d02d2
|
['Amy Chen']
|
2021-12-13 00:40:12.919000+00:00
|
['Public Speaking', 'Learning', 'Protege', 'Toastmasters', 'Mentorship']
|
Title Protégé ExperienceContent Thank Toastmaster introducing Hello everyone Amy product design researcher Citrix based Santa Clara office Today talk experience protégé new vocabulary learned Toastmaster’s project project never distinguished manager bos coach mentor four term synonym heard speech regarding leadership style knew obedient worker manager bos obey manager also coach aka mentor gave work instruction never thought difference definition mentor changed read material project know mentor one guide reach longterm goal coach someone help achieve shortterm aim Keeping new definition mind found lot great coach provided guidance training polish certain skillsets However mentor protégé experience share today person old Toastrix member know Daniel Hor Daniel manager definitely bos coworker got board day senior researcher Santa Clara office didn’t notice much mentorship received started project Daniel know enthusiastic helping others always volunteered lot work Without asking always provided support advice became mentor subtle way didn’t notice official protégé mentor relationship u senior researcher near guided naturally spent working hour personal time understand need still company would lunch together every day share happening life would ask research question also broader question become senior researcher improve user experience professional live happy life industry eight year kid family abundant life work experience helped explore possibility career life coach would give task would focus helping polish small set skill mentor usually gave feedback shared experience could find commonality learn remember one time reviewed diary study gave lot feedback detail best practice However didn’t time change anything needed start data collection right away told ok would learn see way worked would suffer data analysis structure study would still learn hard way though end suffer learn appreciated honest feedback chill attitude “things might go wrong would fine learn” Besides attitude work also learned try afraid controversy know Daniel interested conversation even debate never afraid share opinion even topic like religion politics sexuality always encouraged tried curious ask question time truly see value communication Communication might solve problem people afraid talk might miss others thinking solve nothing afraid learning failure never avoiding sensitive topic curious three thing Daniel taught beneficial trait career also lifeTags Public Speaking Learning Protege Toastmasters Mentorship
|
188,000 |
10 Hard-Hitting, Not-So-Subtle New Year Thoughts for the Events Industry
|
I’ve read a few articles on predictions for the global events industry in 2022. Enjoyable reads from those associated with an industry hit hard by COVID. But, in my humble opinion, those articles stop short. They’re incomplete. Off target, at least from my point of view.
There are some chronic problems with events that never seem to get addressed. Others issues are just gaining traction. At events, large and small.
So I decided to offer 10 thoughts of my own, based on my experience as an event director, conference producer, corporate and product marketer, broadcast and streaming media professional, trade show booth set-up and tear-down guy, TV and film background actor, voiceover talent, exhibit hall presenter, CRM industry keynote speaker, writer, content creator, speaking coach, materials handler, frequent flyer… you get the drift.
But they’re not predictions. I wanna be different. 10 thoughts.
I could offer so much more, but here are 10 thoughts, for starters:
1. Public Speakers Will Continue to be Ill-Prepared
Ok, allow me to clarify. The vast, vast, vast majority of public speakers won’t be prepared for their sessions. Not all, but most. This was a problem long before the pandemic, and it’s not changing anytime soon. The evidence is out there for all the world to see and hear as more and more companies decide to go online with event activities. It’s clear and obvious when corporate speakers don’t prep or rehearse. It’s clear when they don’t attempt to use their body language or their voices. While they read slides, waste your time, etc.
You know it 10–15 seconds into a session, and you have an hour to go…
2. Audiences Will Continue to Accept (and Pay for) Bad Presentations
Again, this is a problem that’s been around forever. Nobody checks on what an audience learns — or doesn’t. I’ve been a part of more terrible event, conference, and trade show sessions where the speaker loses an audience from the start, yet receives a polite round of applause from the crowd playing on phones and laptops. Add in the cost of travel, hotel, and food to the price of an event ticket and somebody, somewhere is flushing their money down the drain.
But it usually isn’t the attendee.
3. Panel Discussions Should be Regulated by the FDA
Because they’re putting people to sleep not just in the USA, but across the planet. We may have a new pharmaceutical on our hands.
Years have gone by and I’ve yet to hear somebody say, “WOW! I was blown away by that panel discussion!” Check your next event schedule. Do you see a panel discussion?
Ugh.
I’m guilty of having panel discussions on my programs in the distant past. I’m not sure where the notion of having three to six (or more) people sit in comfy chairs on stage and drone on for an hour became engaging and entertaining. And I’m sure as hell unaware of how anybody can put the same number of people online and called that entertaining. Panel discussions look good an paper, and are very easy to do. It’s a way to accommodate high-paying sponsors and placate know-it-alls with a spot in front the crowd. It’s also a phenomenal way to phone in your next appearance.
Did I mention they’re easy, time fillers… and you’re paying for that…
(In the United States of America, FDA stands for Food and Drug Adminstration.)
4. Investors, CEOs, and CMOs Continue to Struggle with Events
Having been in and around this business for decades, I know what costs what. Investors clearly pay the bill — but they rarely ask questions about event outcomes. Or they wait until it’s too late.
CEOs may actually attend an event — for a moment or two, but they’re rarely around for booth set-up or tear down. And CMOs will stroll into the convention hall with a cup of coffee while the booth is being set, finger point, and they’ll leave just before this exhibit hall closes…with the false sense of knowing they did a great job, but without knowing all there is to know about the results from a just-completed event.
This event and conference stuff costs money.
And if more investors took an interest, and if more CEOs and CMOs had a handle on the totality of their events, expenditures, and outcomes, a different, more engaging and more productive event landscape may exist.
But it doesn’t.
How else can you explain why the business world is offered such outdated, cookie-cutter conventions and boring virtual activities while at the same time finding companies to pay the freight of the high-price tags to participate?
In 2022, some will start to pay attention. Finally.
5. Sales Enablement Continues to Enable… Not Very Much
We’re now in a pandemic age of supporting sales across multiple channels. This includes events. But companies are more concerned with the usage of software platforms to deliver stale content then they are with genuine sales team readiness.
Meanwhile, more time is wasted and there are numbers to be hit.
External sales must be able to speak to content. Inside sales. Executives. Marketing. All front-line personnel, to start. Tech usage for learning is good, but if that’s the major concern, you’ll be left standing on the one yard line.
Sales Readiness is essential for event success.
Example… Think about the last demo you saw. I’ll give you the benefit of the doubt. I’m sure there were award-winning graphics and sound. Scripted material. Innovative tech.
But how about the presenter? Storytelling skills…audience interaction…hybrid formats…endurance… If the computer crashed, could the demo continue? Sales Enablement, indeed. You need team readiness for all event formats.
Try it without the tech to exercise personal communication skills.
6. Filler Language Expands its Footprint
Ummm, you know what I mean, uhhh… right?
Filler words are the vocabulary of the unprepared public speaker. Or panelist. Or podcast host, and their guests. Filler words have now expanded into business podcasts. Into virtual and hybrid presentations. You’ve heard them; maybe you use them.
What do I mean ‘maybe’?
Play a game with me. When watching or listening to a session (of any kind) you’ll know within the first 15–30 seconds if a speaker is ready. The filler words will start to fly. Count them. Use your fingers and toes and a pen and paper to count the ummms, uhhhs, you knows, rights…odds are you’ll run out of fingers and toes within a few minutes.
Maybe, ummm, quite possibly, sooner. Ya know?
That’s unfortunate. Filler words are so easy to eliminate.
7. On Podcasts… The Astonishing Lack of Creativity Endures
I read somewhere that the average podcast lasts seven episodes. No surprise, because the average business podcast sounds like, acts like, looks like, and feels like every other podcast… and they’re hard work to produce.
How about some generic music at the beginning?
How about some long-winded bio introductions?
Some poor quality audio, with phone lines or concrete walls?
Brought to you by your host, thrown to wolves on a microphone by those who think a good performance just happens, just because…
… and you expect me to listen for more than 60 seconds?
When the going gets tough and the podcast becomes a marketing pain, most take the path of least resistance. They stop doing them.
Podcasts can play a fun, creative, competitive part in any event activity. But they’re hard work. Good audio, is hard work. Speaker prep, is hard work. Creative usage at events doesn’t come easy. And for those who truly believe that you’re being creative just by having a podcast studio set-up in your booth, that’s old news. That’s been done for decades — in various forms. The world won’t come running to your booth, just because. There are dozens of ways to use creative audio at events, anchored by exceptional podcasts. In-person, virtual, and hybrid.
Show your audience something other than the typical podcast painted-by-number.
8. Sales Kickoffs Need to Adjust
Beyond the safety blanket and the misguided notions behind sales enablement software and learning platforms being the immediate priorities, you’ve got a sales or company kickoff scheduled for early 2022. Of course you do. And I challenge you to think and act differently before, during and after your next kickoff.
But what do you have planned, for this next round? Lemme guess…
Sessions with your CEO, CMO, and Product VPs given an hour each.
Maybe a customer or two and and an analyst, or a special guest, also with an hour each.
Some sales stories. A few case studies.
And a dash of product marketing…as in “Here’s Tony, at 9:30 Wednesday morning, to tell you everything you need to know about GTM strategy, messaging, positioning, content, alliances, and competitive intel, and how this will play out at events… after his 30 minutes, we’ll break at 10.”
Throw that away. For those who want an idea for 2022 sales kickoff, try the Product Marketing Gauntlet.
With Omicron at the outset of 2022, you need an agile, fully-prepared sales team to excel in any format of market interaction. Then again, you’ve needed that all along and you still offered the same cookie-cutter sales kickoff format.
This year, get into the sales and team readiness game and try something else.
9. Alternatives to Trade Shows and Conventions Will Increase
As much as I can’t stand senior leadership’s obliviousness when it comes to events, there are some rumblings from some business people about long-in-the-tooth event formats, their effectiveness, and time and wallet-draining expenses.
in 2022, you don’t have to jump back into any single industry event and spend a boatload of your marketing money. I suggested 10 Alternatives, and your options are only increasing. And nobody is going to think you’re going out of business if you don’t have a 30’ x 30’ booth or spend six and seven figures at the next Vegas or Northern California event. There are newer, better, and more cost-efficient and effective ways to engage audiences vs. the tired exercise of fighting your way through a pandemic to Midtown Manhattan or the Chicago Lakefront for a week-long marathon.
Especially in explosive arena of B2B Tech Marketing.
10. Understanding Event Selection, Prep, Execution, and Measurement is Critical
Some want the Vegas boondoggle. Others want to play the role of big shot sponsor in Northern California. Still others just buy what some event producers are selling…just because.
Great, enjoy.
For those serious about their events, faced with choosing when and where to place their investments in 2022 and 2023, you must apply critical business perspectives to all event activities. That time is now.
You’re spending limited resources, and this affects how you choose events, how well your speakers are prepared, the depth of your content, how sales skills are strengthened, exhibit hall, branding, and booth activities, opportunity generation, on-line and in-person engagements, measurement and reporting… and so much more.
As we enter 2022, possessing this business acumen around events has never been more important. For astute investors and executives, it’s all table stakes now.
—
Marketing, is under duress. CMOs have short windows of opportunities, and short tenures.
The process of how events are approached, executed, and measured plays a huge role in marketing and sales success. And event shortcomings have only been exposed and exasperated during the pandemic.
For those who wish to keep doing what you’re doing with events, I wrote about my experience here. All the best to you in 2022.
For those who understand the Event Gauntlet that will challenge you in 2022, welcome to a new business landscape like you’ve never seen before.
I predict radically redesigned sales and marketing opportunities involving events will be endless.
Tony Compton holds two degrees from Loyola University Chicago: a 1987 B.A. in Communication and a 1995 MBA. He’s held a number of marketing and business leadership positions over the past three decades. And he knows a thing or two about events.
|
https://medium.datadriveninvestor.com/10-hard-hitting-not-so-subtle-new-year-thoughts-for-the-events-industry-97cabf79ad9a
|
['Tony Compton']
|
2022-01-01 21:18:11.983000+00:00
|
['Public Speaking', 'Marketing', 'Sales', 'Events', 'Trade Show']
|
Title 10 HardHitting NotSoSubtle New Year Thoughts Events IndustryContent I’ve read article prediction global event industry 2022 Enjoyable read associated industry hit hard COVID humble opinion article stop short They’re incomplete target least point view chronic problem event never seem get addressed Others issue gaining traction event large small decided offer 10 thought based experience event director conference producer corporate product marketer broadcast streaming medium professional trade show booth setup teardown guy TV film background actor voiceover talent exhibit hall presenter CRM industry keynote speaker writer content creator speaking coach material handler frequent flyer… get drift they’re prediction wanna different 10 thought could offer much 10 thought starter 1 Public Speakers Continue IllPrepared Ok allow clarify vast vast vast majority public speaker won’t prepared session problem long pandemic it’s changing anytime soon evidence world see hear company decide go online event activity It’s clear obvious corporate speaker don’t prep rehearse It’s clear don’t attempt use body language voice read slide waste time etc know 10–15 second session hour go… 2 Audiences Continue Accept Pay Bad Presentations problem that’s around forever Nobody check audience learns — doesn’t I’ve part terrible event conference trade show session speaker loses audience start yet receives polite round applause crowd playing phone laptop Add cost travel hotel food price event ticket somebody somewhere flushing money drain usually isn’t attendee 3 Panel Discussions Regulated FDA they’re putting people sleep USA across planet may new pharmaceutical hand Years gone I’ve yet hear somebody say “WOW blown away panel discussion” Check next event schedule see panel discussion Ugh I’m guilty panel discussion program distant past I’m sure notion three six people sit comfy chair stage drone hour became engaging entertaining I’m sure hell unaware anybody put number people online called entertaining Panel discussion look good paper easy It’s way accommodate highpaying sponsor placate knowitalls spot front crowd It’s also phenomenal way phone next appearance mention they’re easy time fillers… you’re paying that… United States America FDA stand Food Drug Adminstration 4 Investors CEOs CMOs Continue Struggle Events around business decade know cost Investors clearly pay bill — rarely ask question event outcome wait it’s late CEOs may actually attend event — moment two they’re rarely around booth setup tear CMOs stroll convention hall cup coffee booth set finger point they’ll leave exhibit hall closes…with false sense knowing great job without knowing know result justcompleted event event conference stuff cost money investor took interest CEOs CMOs handle totality event expenditure outcome different engaging productive event landscape may exist doesn’t else explain business world offered outdated cookiecutter convention boring virtual activity time finding company pay freight highprice tag participate 2022 start pay attention Finally 5 Sales Enablement Continues Enable… Much We’re pandemic age supporting sale across multiple channel includes event company concerned usage software platform deliver stale content genuine sale team readiness Meanwhile time wasted number hit External sale must able speak content Inside sale Executives Marketing frontline personnel start Tech usage learning good that’s major concern you’ll left standing one yard line Sales Readiness essential event success Example… Think last demo saw I’ll give benefit doubt I’m sure awardwinning graphic sound Scripted material Innovative tech presenter Storytelling skills…audience interaction…hybrid formats…endurance… computer crashed could demo continue Sales Enablement indeed need team readiness event format Try without tech exercise personal communication skill 6 Filler Language Expands Footprint Ummm know mean uhhh… right Filler word vocabulary unprepared public speaker panelist podcast host guest Filler word expanded business podcasts virtual hybrid presentation You’ve heard maybe use mean ‘maybe’ Play game watching listening session kind you’ll know within first 15–30 second speaker ready filler word start fly Count Use finger toe pen paper count ummms uhhhs know rights…odds you’ll run finger toe within minute Maybe ummm quite possibly sooner Ya know That’s unfortunate Filler word easy eliminate 7 Podcasts… Astonishing Lack Creativity Endures read somewhere average podcast last seven episode surprise average business podcast sound like act like look like feel like every podcast… they’re hard work produce generic music beginning longwinded bio introduction poor quality audio phone line concrete wall Brought host thrown wolf microphone think good performance happens because… … expect listen 60 second going get tough podcast becomes marketing pain take path least resistance stop Podcasts play fun creative competitive part event activity they’re hard work Good audio hard work Speaker prep hard work Creative usage event doesn’t come easy truly believe you’re creative podcast studio setup booth that’s old news That’s done decade — various form world won’t come running booth dozen way use creative audio event anchored exceptional podcasts Inperson virtual hybrid Show audience something typical podcast paintedbynumber 8 Sales Kickoffs Need Adjust Beyond safety blanket misguided notion behind sale enablement software learning platform immediate priority you’ve got sale company kickoff scheduled early 2022 course challenge think act differently next kickoff planned next round Lemme guess… Sessions CEO CMO Product VPs given hour Maybe customer two analyst special guest also hour sale story case study dash product marketing…as “Here’s Tony 930 Wednesday morning tell everything need know GTM strategy messaging positioning content alliance competitive intel play events… 30 minute we’ll break 10” Throw away want idea 2022 sale kickoff try Product Marketing Gauntlet Omicron outset 2022 need agile fullyprepared sale team excel format market interaction you’ve needed along still offered cookiecutter sale kickoff format year get sale team readiness game try something else 9 Alternatives Trade Shows Conventions Increase much can’t stand senior leadership’s obliviousness come event rumbling business people longinthetooth event format effectiveness time walletdraining expense 2022 don’t jump back single industry event spend boatload marketing money suggested 10 Alternatives option increasing nobody going think you’re going business don’t 30’ x 30’ booth spend six seven figure next Vegas Northern California event newer better costefficient effective way engage audience v tired exercise fighting way pandemic Midtown Manhattan Chicago Lakefront weeklong marathon Especially explosive arena B2B Tech Marketing 10 Understanding Event Selection Prep Execution Measurement Critical want Vegas boondoggle Others want play role big shot sponsor Northern California Still others buy event producer selling…just Great enjoy serious event faced choosing place investment 2022 2023 must apply critical business perspective event activity time You’re spending limited resource affect choose event well speaker prepared depth content sale skill strengthened exhibit hall branding booth activity opportunity generation online inperson engagement measurement reporting… much enter 2022 possessing business acumen around event never important astute investor executive it’s table stake — Marketing duress CMOs short window opportunity short tenure process event approached executed measured play huge role marketing sale success event shortcoming exposed exasperated pandemic wish keep you’re event wrote experience best 2022 understand Event Gauntlet challenge 2022 welcome new business landscape like you’ve never seen predict radically redesigned sale marketing opportunity involving event endless Tony Compton hold two degree Loyola University Chicago 1987 BA Communication 1995 MBA He’s held number marketing business leadership position past three decade know thing two eventsTags Public Speaking Marketing Sales Events Trade Show
|
188,001 |
Insider Tips to the Psychology of Speaking With Confidence and Influence
|
Tip #1 — Public Speaking is a LEARNABLE skill
When I was a young financial advisor, I presented retirement workshops and I was later told, “Your speaking skills are bad. You need to fix this problem, or else.”
That threat motivated me to look for a solution. My search led me to Toastmasters International and the National Speakers Association. Those organizations taught me this key concept…
Great speakers aren’t born, they’re made. Through a series of proven structures and formats, you can gain the confidence to become an influential speaker.
Are you willing to step outside of your comfort zone to master these skills?
Tip #2 — Human Beings are WIRED to be afraid of speaking
In his book, ‘Confessions of a Public Speaker’ author Scott Berkun points out our earliest ancestors were faced with a basic fact — stay with the pack or risk losing your life.
The person who got separated from the pack was alone, without a weapon, out in the open, and was being watched by many pairs of eyes (of predators).
What is public speaking?
It’s standing in front of a group (or camera) alone, without a weapon, out in the open, and being watched by many pairs of eyes.
There is no scientific research to back this up, but it seems clear the survival lessons learned by our earliest ancestors have been passed down to us, although we’re not conscious of them.
When you feel scared, nervous, or intimidated, you’re carrying on a millennia-old survival response.
Fortunately, you and I have been blessed with a higher-thinking brain. It understands people want you to succeed when you speak.
How can I say this?
Good question, which leads to Tip #3…
Tip #3 — Your audience WANTS you to succeed
Think about the last time you went to an event and heard a group of speakers present. Chances are you got into your car, drove through traffic, maybe dealt with inclement weather, probably paid to park your car, waited in a line of people to enter the meeting room, and finally, sat down in your seat.
After going through all that, was the first thing you said to yourself, “I really hope the speakers are lousy. I mean, I hope they’re terrible!”
Of course not. Your time is too valuable to be wasted on bad presentations.
Guess what?
So is your audience’s time.
They WANT you to succeed because if you do, you’ve provided value to them.
Are you able to focus on the needs of your audience rather than worry about yourself?
Tip #4 — Nerves are GOOD
Contrary to popular belief, you shouldn’t strive to get rid of all your nerves.
Why?
Nerves are a sign you care about doing well. That doesn’t mean you look good or get a standing ovation. Instead, you provide valuable insights or ideas for your audience.
What you don’t want is nerves to paralyze you to the point you hyperventilate, forget your presentation, or can’t function.
The goal is to manage your nerves. And there are several actions you can take to do this:
Exercise before you speak
Deep breathing
Awareness of what you say to yourself before speaking
Are you doing any of these before you speak?
Tip #5 — The PROVEN method to speaking success
As important as the previous suggestions are, there is one habit more than any other which will give you the confidence and skill to be influential and impactful every time you speak…
Practice and rehearse your presentation over and over.
When I make this suggestion, I’m frequently asked, “How much?”
There is no hard-and-fast rule to this, but, to give you context, the highest paid speakers in the world practice their speeches a minimum of 100, and typically, 200 times.
I know what you may be thinking…
200 times! Are you nuts?
It depends. I might be, but it’s not about me. How committed are you to becoming a speaker who positively impacts and influences audiences, your team, or prospective clients?
100 rehearsals sound like a lot but think about any type of presentation you frequently give. You’ve presented them many times. The key is to develop a habit of intentional practice and rehearsal with specific outcomes in mind.
Employ these five ideas and your influence will increase.
If you have questions or would like additional insights to improve your presentation skills, feel free to check out SpeakingCPR.com for our complimentary resources.
|
https://medium.com/@speakingcpr/insider-tips-to-the-psychology-of-speaking-with-confidence-and-influence-68f1ab797749
|
['Michael Davis']
|
2021-11-30 12:03:23.420000+00:00
|
['Storytelling For Business', 'Leadership Skills', 'Presentation Skills', 'Public Speaking']
|
Title Insider Tips Psychology Speaking Confidence InfluenceContent Tip 1 — Public Speaking LEARNABLE skill young financial advisor presented retirement workshop later told “Your speaking skill bad need fix problem else” threat motivated look solution search led Toastmasters International National Speakers Association organization taught key concept… Great speaker aren’t born they’re made series proven structure format gain confidence become influential speaker willing step outside comfort zone master skill Tip 2 — Human Beings WIRED afraid speaking book ‘Confessions Public Speaker’ author Scott Berkun point earliest ancestor faced basic fact — stay pack risk losing life person got separated pack alone without weapon open watched many pair eye predator public speaking It’s standing front group camera alone without weapon open watched many pair eye scientific research back seems clear survival lesson learned earliest ancestor passed u although we’re conscious feel scared nervous intimidated you’re carrying millenniaold survival response Fortunately blessed higherthinking brain understands people want succeed speak say Good question lead Tip 3… Tip 3 — audience WANTS succeed Think last time went event heard group speaker present Chances got car drove traffic maybe dealt inclement weather probably paid park car waited line people enter meeting room finally sat seat going first thing said “I really hope speaker lousy mean hope they’re terrible” course time valuable wasted bad presentation Guess audience’s time WANT succeed you’ve provided value able focus need audience rather worry Tip 4 — Nerves GOOD Contrary popular belief shouldn’t strive get rid nerve Nerves sign care well doesn’t mean look good get standing ovation Instead provide valuable insight idea audience don’t want nerve paralyze point hyperventilate forget presentation can’t function goal manage nerve several action take Exercise speak Deep breathing Awareness say speaking speak Tip 5 — PROVEN method speaking success important previous suggestion one habit give confidence skill influential impactful every time speak… Practice rehearse presentation make suggestion I’m frequently asked “How much” hardandfast rule give context highest paid speaker world practice speech minimum 100 typically 200 time know may thinking… 200 time nut depends might it’s committed becoming speaker positively impact influence audience team prospective client 100 rehearsal sound like lot think type presentation frequently give You’ve presented many time key develop habit intentional practice rehearsal specific outcome mind Employ five idea influence increase question would like additional insight improve presentation skill feel free check SpeakingCPRcom complimentary resourcesTags Storytelling Business Leadership Skills Presentation Skills Public Speaking
|
188,002 |
One Key to Increase Audience Interest in Your Story
|
One Key to Story Success
A (Missing) Memorable Moment
“Dude, you’re going to die if you keep this up!”
I was watching Dave in a storytelling workshop. He’d already presented his story and was being debriefed. The facilitators were asking questions about a specific scene when he said, “Yeah, at one point my doctor told me, “Dude, you’re going to die if you keep this up!”
The workshops facilitators immediately stopped him and said, “Whoa! What? Say that again!”
More than a little surprised, Dave, repeated the phrase, “My doctor said, “Dude, you’re going to die if you keep this up!”
The facilitators said, “Dude! Where was THAT in the story? That’s what’s missing. We need to hear that moment when you’re told your life is on the line.”
A Common, but Costly, Storytelling Mistake
Up until that moment, he’d struggled to convey the seriousness of a scene in which he was told he needed to change his lifestyle, or he would die a premature death.
He did what many storytellers do — provide a lot of facts in his back story about what led him to that point:
He was overweight and inactive
He’d experienced an incident of paralyzing chest pains in a hotel room
He’d ignored the pain and attended a work conference
He felt sick again on the drive home
He visited his friend, a doctor, who gave him a lengthy explanation of his condition
He eventually was admitted to the hospital, lucky to be alive
To be fair, this was the first draft of Dave’s story. He was in what we call the ‘messy’ stage of his story.
In the debrief, he casually threw out the line “My doctor said, “Dude, you’re going to die if you keep this up!”
It was THE moment missing from the story.
This is not uncommon in the coaching sessions I’m involved in. Nearly every time, I or one of my colleagues stop the meeting and ask, “Where was THAT in the story?”
Two Key Lessons From This Experience
One. The key to meaningful stories is memorable moments. We tend to overlook or not understand the significance of specific incidents in our lives.
These are crucial because they generate the most emotion in your story. If he experiences several months or years in the past, your feelings may be less intense about it, therefore, you dismiss its importance.
This is why it’s vital to have other people listen to your narrative. They will help you understand why specific moments are powerful to your story.
Two. You and I are too close to our own material to see its value. We lived the experience, so we tend to disregard its significance.
The workshop facilitators immediately saw the value in the statement from Dave’s doctor and encouraged him to include it.
When writing their stories, most people tend to over-explain because they don’t understand which parts are most valuable. They feel the need to give every detail of the backstory so the audience understands every aspect of the situation.
It’s a good strategy for writing a novel, but it’s deadly for speakers. Audiences want just enough detail to understand the situation and no more. This is the approach used in the movie industry.
As has been repeated by many in the industry, “Hollywood tells stories of real life, with the boring parts taken out.”
Bonus Idea
Key moments can shorten the story, yet heighten the impact.
When Dave finally understood the strength of the one sentence from his doctor, he inserted it into the story. He practiced the delivery a few times and it became one of the key moments of his talk.
He described sitting in the doctor's office, waiting for him to walk in. He paused for a few seconds. He then said, “My doctor, who is a long-time friend, didn’t bother to sit down. He didn’t waste any time. He said, “Dude, you’re going to die if you keep this up!”
Dave then paused to let the audience see his facial expression of disbelief, the impact the doctor’s words had on him. The silence, and his expression, allowed the audience to feel the significance on the moment.
It was far more powerful than the minute-plus explanation of the first version.
The typical speaker gives a ‘report,’ “My doctor told me he was concerned. He said my blood pressure was 190/110 and that my heart rate was 92 per minute. He was also concerned about my triglyceride count, and we discussed these readings in context with the information from previous visits.”
Aren’t you simply riveted by that information?
Some key thoughts to consider:
Are all of the facts true?
Yes.
Are they important to the story?
Yes, they underscore the serious nature of the health problem.
Are they vital to the audience?
NO!
What does the audience need to know?
“Dude, you’re gonna die!”
THAT is where the emotions; connection is made.
It’s more dramatic, and your point is made. All in just a few words
As you craft your story, don’t overlook simple, powerful incidents which capture the essence of a situation and heighten the tension.
Create the moments audiences will long remember, and you’ll create a deeper emotional connection with them.
New and Experienced Speakers: Jump Start 2022 on Getting Paid to Speak What You’re Worth
Ever see a speaker whom you knew was getting paid and thought…
“I’m at least that good.”
You could be 100% right. But…
…what did that person do to be the one who was booked?
My friend and mentor, World Champion Speaker Darren LaCroix, CSP, will answer that question and many others to help you be the speaker getting paid.
Darren is facilitating a 30-day challenge that will help you discover insider secrets to either transitioning from free to paid speaking or increasing your current fee to a higher one which represents your true value.
To discover more about this opportunity to attract paid speaking engagements in 2022, CLICK HERE.
P.S. The Early Bird price of $97 for this 30-day challenge is available until 11:59 pm Friday, December 31.
P.S.S. Before you commit, be sure to use your discount code, Mike25, to receive an additional 25% discount off the Early Bird price.
Darren has had a significant impact on my career and he can help you save months or years of trial and error learning and help you begin getting paid what you’re worth for your expertise and wisdom.
|
https://medium.com/@speakingcpr/one-key-to-increase-audience-interest-in-your-story-c18fa837ccf7
|
['Michael Davis']
|
2021-12-28 17:22:09.941000+00:00
|
['Public Speaking', 'Professional Speaking', 'Présentation']
|
Title One Key Increase Audience Interest StoryContent One Key Story Success Missing Memorable Moment “Dude you’re going die keep up” watching Dave storytelling workshop He’d already presented story debriefed facilitator asking question specific scene said “Yeah one point doctor told “Dude you’re going die keep up” workshop facilitator immediately stopped said “Whoa Say again” little surprised Dave repeated phrase “My doctor said “Dude you’re going die keep up” facilitator said “Dude story That’s what’s missing need hear moment you’re told life line” Common Costly Storytelling Mistake moment he’d struggled convey seriousness scene told needed change lifestyle would die premature death many storyteller — provide lot fact back story led point overweight inactive He’d experienced incident paralyzing chest pain hotel room He’d ignored pain attended work conference felt sick drive home visited friend doctor gave lengthy explanation condition eventually admitted hospital lucky alive fair first draft Dave’s story call ‘messy’ stage story debrief casually threw line “My doctor said “Dude you’re going die keep up” moment missing story uncommon coaching session I’m involved Nearly every time one colleague stop meeting ask “Where story” Two Key Lessons Experience One key meaningful story memorable moment tend overlook understand significance specific incident life crucial generate emotion story experience several month year past feeling may le intense therefore dismiss importance it’s vital people listen narrative help understand specific moment powerful story Two close material see value lived experience tend disregard significance workshop facilitator immediately saw value statement Dave’s doctor encouraged include writing story people tend overexplain don’t understand part valuable feel need give every detail backstory audience understands every aspect situation It’s good strategy writing novel it’s deadly speaker Audiences want enough detail understand situation approach used movie industry repeated many industry “Hollywood tell story real life boring part taken out” Bonus Idea Key moment shorten story yet heighten impact Dave finally understood strength one sentence doctor inserted story practiced delivery time became one key moment talk described sitting doctor office waiting walk paused second said “My doctor longtime friend didn’t bother sit didn’t waste time said “Dude you’re going die keep up” Dave paused let audience see facial expression disbelief impact doctor’s word silence expression allowed audience feel significance moment far powerful minuteplus explanation first version typical speaker give ‘report’ “My doctor told concerned said blood pressure 190110 heart rate 92 per minute also concerned triglyceride count discussed reading context information previous visits” Aren’t simply riveted information key thought consider fact true Yes important story Yes underscore serious nature health problem vital audience audience need know “Dude you’re gonna die” emotion connection made It’s dramatic point made word craft story don’t overlook simple powerful incident capture essence situation heighten tension Create moment audience long remember you’ll create deeper emotional connection New Experienced Speakers Jump Start 2022 Getting Paid Speak You’re Worth Ever see speaker knew getting paid thought… “I’m least good” could 100 right But… …what person one booked friend mentor World Champion Speaker Darren LaCroix CSP answer question many others help speaker getting paid Darren facilitating 30day challenge help discover insider secret either transitioning free paid speaking increasing current fee higher one represents true value discover opportunity attract paid speaking engagement 2022 CLICK PS Early Bird price 97 30day challenge available 1159 pm Friday December 31 PSS commit sure use discount code Mike25 receive additional 25 discount Early Bird price Darren significant impact career help save month year trial error learning help begin getting paid you’re worth expertise wisdomTags Public Speaking Professional Speaking Présentation
|
188,003 |
How to Host a Killer Panel Discussion
|
No good event is complete without a panel discussion, because it provides a great way to create a dialogue between speakers and audience members and it can also enable you to get to the bottom of what attendees are truly interested in.
Done well, panel discussions don’t just give you a snapshot of what’s coming up in the future of your industry — they actively help to shape it, bringing together the right people and fostering an environment in which innovation takes center stage and ideas can be freely exchanged.
But how exactly can you set yourself up for success when hosting a panel discussion? Have no fear, because we’ve got you covered with these top tips.
1. Choose the right topic
This is perhaps the most fundamental thing of all, if you don’t get this one right then you can forget about the rest. Getting the topic right will help to ensure that people are interested enough in your panel to check it out. You need to get the balance just right, ensuring that it’s specific enough to guide the discussion while simultaneously being broad enough to leave some wiggle room and to encourage questions.
2. Choose the right panelists
The next step is to ensure that you have the right panelists, because these experts will be responsible for keeping the discussion going. They need to know their subject matter like the backs of their hands because, while the moderator will guide the discussion to a certain extent, the panelists will need to respond to questions and provide insightful contributions.
3. Choose the right moderator
Building on the last point, the moderator that you choose will help to keep the discussion going and act in many ways as the face of the panel discussion. Moderating a panel discussion requires a totally different set of skills to speaking, and you ideally want someone without an ego so that they’ll be happy to step back and let the conversation flow, only stepping in when they’re needed to bring things back on topic. If you get it wrong, you risk having a moderator who talks so much that they might as well have been a panelist, or, at the other extreme, one who allows the conversation to roam off topic, unchecked.
4. Throw the discussion open to questions
This is the way to get engagement between the panelists and the audience. As a general rule, it’s a good idea to allocate up to half of your time to audience questions and half or more of it to a more linear discussion that’s facilitated by your moderator.
5. Do your prep
Benjamin Franklin famously said, “By failing to prepare, you’re preparing to fail.” This is particularly true for a panel discussion because you need to ensure that you’ve prepped the speakers, planned out the discussion, and prepared plenty of questions that your moderator can use to help to shape the dialogue.
6. Have a decent sound technician
There’s nothing worse than going to a panel discussion and not being able to hear the discussion clearly. If you’re watching online and the sound sucks, you can just close your browser window. If you’re there in person, it’s a lot harder to just sneak out. Don’t leave your attendees feeling trapped in a room with no idea what’s being said on stage. Hire a professional sound guy to help you out and to make sure that people can hear clearly no matter what part of the room they’re sitting in.
7. Consider live translation
Live translation can be a great way to make an event more accessible when you’re welcoming international guests, and it’s particularly important when you’re in a country where more than one language is spoken. It’s relatively easy to carry out live translation, but can be laborious, you’ll need to hire or buy plenty of headsets for people, for instance. Therefore consider hiring a provider who can do all the hard work for you.
8. Don’t sell
As tempting as it can be to use a panel as an excuse to promote your company and services, that’s a big no-no and a quick way to ensure that people tune out and stop listening to what you’re saying. As an organizer, It’s important for you to avoid this, but it’s even more important to make this clear to your moderator and your speakers. The discussion should focus on education and information, not on sales.
9. Ask for feedback
After the event is over, be sure to ask people for their feedback so that you can improve your next panel discussion. Your attendees can provide the kind of unbiased feedback that you’ll struggle to find elsewhere, and considering that they’re the people that your discussion is catering to in the first place, it’s more important to act on their feedback than it is to act on what you personally think may be needed.
10. Provide attendees with a summary
There are several different ways to do this, and the right approach will depend upon the event, and on the attendees’ communication preferences. If you’re filming the event, then you can send registrants a link to the recording, but it’s also a good idea to spend some time summarizing key points and creating a written version that you can send out for them to read through, too. Try to do this within a few days of the event because that will help to ensure that the discussion is still fresh in people’s memories.
Conclusion
Now that you know just a few of our top tips for hosting a killer panel discussion at your next event, we want to hear from you. Have you hosted a panel discussion at one of your events? If so, how did it go, and what worked well and not so well?
We’d love to keep the discussion going and to continue the dialogue, so be sure to let us know in the comments. We’ll see you soon in another article!
This was originally posted on SpeakerHub Skillcamp.
|
https://medium.com/@speakerhubhq/how-to-host-a-killer-panel-discussion-bd6056e668fb
|
[]
|
2021-12-26 23:30:44.495000+00:00
|
['Public Speaking', 'Public Speaker', 'Panel Discussion', 'Public Speaking Tips', 'Speakerhub']
|
Title Host Killer Panel DiscussionContent good event complete without panel discussion provides great way create dialogue speaker audience member also enable get bottom attendee truly interested Done well panel discussion don’t give snapshot what’s coming future industry — actively help shape bringing together right people fostering environment innovation take center stage idea freely exchanged exactly set success hosting panel discussion fear we’ve got covered top tip 1 Choose right topic perhaps fundamental thing don’t get one right forget rest Getting topic right help ensure people interested enough panel check need get balance right ensuring it’s specific enough guide discussion simultaneously broad enough leave wiggle room encourage question 2 Choose right panelist next step ensure right panelist expert responsible keeping discussion going need know subject matter like back hand moderator guide discussion certain extent panelist need respond question provide insightful contribution 3 Choose right moderator Building last point moderator choose help keep discussion going act many way face panel discussion Moderating panel discussion requires totally different set skill speaking ideally want someone without ego they’ll happy step back let conversation flow stepping they’re needed bring thing back topic get wrong risk moderator talk much might well panelist extreme one allows conversation roam topic unchecked 4 Throw discussion open question way get engagement panelist audience general rule it’s good idea allocate half time audience question half linear discussion that’s facilitated moderator 5 prep Benjamin Franklin famously said “By failing prepare you’re preparing fail” particularly true panel discussion need ensure you’ve prepped speaker planned discussion prepared plenty question moderator use help shape dialogue 6 decent sound technician There’s nothing worse going panel discussion able hear discussion clearly you’re watching online sound suck close browser window you’re person it’s lot harder sneak Don’t leave attendee feeling trapped room idea what’s said stage Hire professional sound guy help make sure people hear clearly matter part room they’re sitting 7 Consider live translation Live translation great way make event accessible you’re welcoming international guest it’s particularly important you’re country one language spoken It’s relatively easy carry live translation laborious you’ll need hire buy plenty headset people instance Therefore consider hiring provider hard work 8 Don’t sell tempting use panel excuse promote company service that’s big nono quick way ensure people tune stop listening you’re saying organizer It’s important avoid it’s even important make clear moderator speaker discussion focus education information sale 9 Ask feedback event sure ask people feedback improve next panel discussion attendee provide kind unbiased feedback you’ll struggle find elsewhere considering they’re people discussion catering first place it’s important act feedback act personally think may needed 10 Provide attendee summary several different way right approach depend upon event attendees’ communication preference you’re filming event send registrant link recording it’s also good idea spend time summarizing key point creating written version send read Try within day event help ensure discussion still fresh people’s memory Conclusion know top tip hosting killer panel discussion next event want hear hosted panel discussion one event go worked well well We’d love keep discussion going continue dialogue sure let u know comment We’ll see soon another article originally posted SpeakerHub SkillcampTags Public Speaking Public Speaker Panel Discussion Public Speaking Tips Speakerhub
|
188,004 |
LEVERAGING TECHNOLOGY IN MY CAREER.
|
Photo by Andrew Neel on Unsplash
Hey guys, I’m here again! This is a sequel article to my last article but you can actually enjoy it without having to read the last article.
So, in this article, I will be discussing how I’ve been able to leverage technology in doing what I do and you know, how I make an income and still increase my income options with it, and how it makes my job easier.
Let's start from the basics. The basics of my carriers as a writer, public speaker, and life coach, revolve around the use of my phone, laptop, and the apps and software I download on them, technology-wise. I do a lot of other things asides from these three but those roles are majorly volunteered roles. So I won’t be discussing them on here unless I have to.
Everything I do, I do it on my phone and Laptop. I don’t do any physical meetings, asides from some of the demands in my public speaking career. Because even that space has chosen to leverage online platforms. So, technology is an integral part of what I do and it would be very hard for me to progress without technology.
In my career as a writer, I use Medium, Substack, Microsoft word, LinkedIn, Instagram, WhatsApp, Google Chrome, and Grammarly. I have used WordPress, Surfer SEO, Google sheet, Freelancer, Poetizer, Fiverr, e.t.c in the past. Now let’s talk about what I use each of them for and how I use them.
The platforms where I publish my articles are Medium and Substack. Medium is my personal blog and Substack is for my brand's webpage, rmwca.substack.com. I use Microsoft word to most times outline and plan my article ahead.
Sometimes, I pre-write the article on Microsoft Word and then paste it on Medium or Substack. Other times, I use it to write my short stories that I deliver to clients on Freelancing platforms or to work on personal projects.
I use Google Chrome as my browser on my laptop. I access Medium, Substack, Grammarly, Gmail, basically, all the websites I work with are accessed on Google Chrome. You know being able to access multiple tabs conveniently and also access my mail right from my browser is it for me.
I use Grammarly for spelling and grammatical errors and it is installed on my Chrome browser. Freelancer and Fiverr are my freelancing pages. I use Surfer SEO, word press, while I was interning as a technical writer. I also used google sheets to access topics then. I used Poetizer when I was actively writing poems.
My day-to-day apps are WhatsApp, Instagram, and LinkedIn. These are the platforms where I market myself, publicize my articles once they are published, and continuously bombard with value. I use them all for my career in writing, public speaking, and as a life coach.
How? In my career as a writer, immediately after I publish an article, I share it on my WhatsApp, LinkedIn, and Instagram. On Instagram, I have an account for my brand @rubb_ingmindswithcoachAliyyah(please follow) and I have a personal blog under my name @aliyyah_kalejaye. On my brand’s account, I post daily quotes, weekend specials, I leverage on insta stories and the likes, the same with my personal blog, to promote my career as a life coach.
On LinkedIn, I have a professional account in my name also, where I encourage my connections to engage with my articles and what I do. My social media pages depict who I am and what I do, all day every day and it has attracted a series of offers, connections, and opportunities to me.
These are my biggest ways of leveraging technology to do what I do and make what I do easier and seamless for me. You could also adopt some of these ways if you haven’t. Also, tell me ways you are Leveraging Technology in your career in the comment section. I’d love to hear ittt!
You can find me on all social media platforms as Aliyyah Kalejaye.
Like, share, comment, and SUBSCRIBE! if you enjoyed reading this article.
|
https://medium.com/@aliyyahkalejaye/leveraging-technology-in-my-career-2bf3c0771c97
|
['Aliyyah Kalejaye']
|
2021-11-27 17:04:45.899000+00:00
|
['Writing', 'Public Speaking', 'Life Coaching', 'Leveraging Technology', 'Technical Writing']
|
Title LEVERAGING TECHNOLOGY CAREERContent Photo Andrew Neel Unsplash Hey guy I’m sequel article last article actually enjoy without read last article article discussing I’ve able leverage technology know make income still increase income option make job easier Lets start basic basic carrier writer public speaker life coach revolve around use phone laptop apps software download technologywise lot thing aside three role majorly volunteered role won’t discussing unless Everything phone Laptop don’t physical meeting aside demand public speaking career even space chosen leverage online platform technology integral part would hard progress without technology career writer use Medium Substack Microsoft word LinkedIn Instagram WhatsApp Google Chrome Grammarly used WordPress Surfer SEO Google sheet Freelancer Poetizer Fiverr etc past let’s talk use use platform publish article Medium Substack Medium personal blog Substack brand webpage rmwcasubstackcom use Microsoft word time outline plan article ahead Sometimes prewrite article Microsoft Word paste Medium Substack time use write short story deliver client Freelancing platform work personal project use Google Chrome browser laptop access Medium Substack Grammarly Gmail basically website work accessed Google Chrome know able access multiple tab conveniently also access mail right browser use Grammarly spelling grammatical error installed Chrome browser Freelancer Fiverr freelancing page use Surfer SEO word press interning technical writer also used google sheet access topic used Poetizer actively writing poem daytoday apps WhatsApp Instagram LinkedIn platform market publicize article published continuously bombard value use career writing public speaking life coach career writer immediately publish article share WhatsApp LinkedIn Instagram Instagram account brand rubbingmindswithcoachAliyyahplease follow personal blog name aliyyahkalejaye brand’s account post daily quote weekend special leverage insta story like personal blog promote career life coach LinkedIn professional account name also encourage connection engage article social medium page depict day every day attracted series offer connection opportunity biggest way leveraging technology make easier seamless could also adopt way haven’t Also tell way Leveraging Technology career comment section I’d love hear ittt find social medium platform Aliyyah Kalejaye Like share comment SUBSCRIBE enjoyed reading articleTags Writing Public Speaking Life Coaching Leveraging Technology Technical Writing
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.