contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,687,007,608 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 60 | 0 | w=int(input("weight="))
while not 1<=w<=100:
w=int(input("weight="))
if w%2==0 and w!=2:
print("YES")
else:
print("NO")
| Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
w=int(input("weight="))
while not 1<=w<=100:
w=int(input("weight="))
if w%2==0 and w!=2:
print("YES")
else:
print("NO")
``` | 0 |
221 | A | Little Elephant and Function | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | null | null | The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order. | A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation. | In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists. | [
"1\n",
"2\n"
] | [
"1 ",
"2 1 "
] | none | 500 | [
{
"input": "1",
"output": "1 "
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "4",
"output": "4 1 2 3 "
},
{
"input": "5",
"output": "5 1 2 3 4 "
},
{
"input": "6",
"output": "6 1 2 3 4 5 "
},
{
"input": "7",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "999",
"output": "999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "998",
"output": "998 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "997",
"output": "997 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "900",
"output": "900 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "101",
"output": "101 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "67",
"output": "67 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 "
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "971",
"output": "971 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "683",
"output": "683 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "99",
"output": "99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 "
},
{
"input": "811",
"output": "811 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "875",
"output": "875 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "291",
"output": "291 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "419",
"output": "419 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "21",
"output": "21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 "
},
{
"input": "22",
"output": "22 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 "
},
{
"input": "23",
"output": "23 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 "
},
{
"input": "24",
"output": "24 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 "
},
{
"input": "25",
"output": "25 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 "
}
] | 1,568,653,568 | 2,147,483,647 | PyPy 3 | OK | TESTS | 34 | 280 | 1,433,600 | __author__ = 'Esfandiar'
n = int(input())
print(n,*range(1,n)) | Title: Little Elephant and Function
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order.
Input Specification:
A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation.
Output Specification:
In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists.
Demo Input:
['1\n', '2\n']
Demo Output:
['1 ', '2 1 ']
Note:
none | ```python
__author__ = 'Esfandiar'
n = int(input())
print(n,*range(1,n))
``` | 3 |
|
85 | A | Domino | PROGRAMMING | 1,300 | [
"constructive algorithms",
"implementation"
] | A. Domino | 1 | 256 | We all know the problem about the number of ways one can tile a 2<=×<=*n* field by 1<=×<=2 dominoes. You probably remember that it goes down to Fibonacci numbers. We will talk about some other problem below, there you also are going to deal with tiling a rectangular field with dominoes.
You are given a 4<=×<=*n* rectangular field, that is the field that contains four lines and *n* columns. You have to find for it any tiling by 1<=×<=2 dominoes such that each of the *n*<=-<=1 potential vertical cuts along the grid lines intersects at least one domino, splitting it in two. No two dominoes in the sought tiling should overlap, each square of the field should be covered by exactly one domino. It is allowed to rotate the dominoes, that is, you can use 2<=×<=1 as well as 1<=×<=2 dominoes.
Write a program that finds an arbitrary sought tiling. | The input contains one positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of the field's columns. | If there's no solution, print "-1" (without the quotes). Otherwise, print four lines containing *n* characters each — that's the description of tiling, where each vertical cut intersects at least one domino. You should print the tiling, having painted the field in no more than 26 colors. Each domino should be painted a color. Different dominoes can be painted the same color, but dominoes of the same color should not be side-neighbouring. To indicate colors you should use lowercase Latin letters. Print any of the acceptable ways of tiling. | [
"4\n"
] | [
"yyzz\nbccd\nbxxd\nyyaa\n"
] | none | 500 | [
{
"input": "4",
"output": "aacc\nbbdd\nzkkz\nzllz"
},
{
"input": "2",
"output": "aa\nbb\naa\nbb"
},
{
"input": "3",
"output": "aab\nccb\nbaa\nbcc"
},
{
"input": "5",
"output": "aaccz\nbbddz\nzkkmm\nzllnn"
},
{
"input": "1",
"output": "a\na\nb\nb"
},
{
"input": "6",
"output": "aaccee\nbbddff\nzkkmmz\nzllnnz"
},
{
"input": "7",
"output": "aacceez\nbbddffz\nzkkmmoo\nzllnnpp"
},
{
"input": "8",
"output": "aacceegg\nbbddffhh\nzkkmmooz\nzllnnppz"
},
{
"input": "9",
"output": "aacceeggz\nbbddffhhz\nzkkmmooqq\nzllnnpprr"
},
{
"input": "10",
"output": "aacceeggii\nbbddffhhjj\nzkkmmooqqz\nzllnnpprrz"
},
{
"input": "11",
"output": "aacceeggiiz\nbbddffhhjjz\nzkkmmooqqss\nzllnnpprrtt"
},
{
"input": "12",
"output": "aacceeggiiaa\nbbddffhhjjbb\nzkkmmooqqssz\nzllnnpprrttz"
},
{
"input": "13",
"output": "aacceeggiiaaz\nbbddffhhjjbbz\nzkkmmooqqsskk\nzllnnpprrttll"
},
{
"input": "14",
"output": "aacceeggiiaacc\nbbddffhhjjbbdd\nzkkmmooqqsskkz\nzllnnpprrttllz"
},
{
"input": "15",
"output": "aacceeggiiaaccz\nbbddffhhjjbbddz\nzkkmmooqqsskkmm\nzllnnpprrttllnn"
},
{
"input": "16",
"output": "aacceeggiiaaccee\nbbddffhhjjbbddff\nzkkmmooqqsskkmmz\nzllnnpprrttllnnz"
},
{
"input": "17",
"output": "aacceeggiiaacceez\nbbddffhhjjbbddffz\nzkkmmooqqsskkmmoo\nzllnnpprrttllnnpp"
},
{
"input": "18",
"output": "aacceeggiiaacceegg\nbbddffhhjjbbddffhh\nzkkmmooqqsskkmmooz\nzllnnpprrttllnnppz"
},
{
"input": "19",
"output": "aacceeggiiaacceeggz\nbbddffhhjjbbddffhhz\nzkkmmooqqsskkmmooqq\nzllnnpprrttllnnpprr"
},
{
"input": "20",
"output": "aacceeggiiaacceeggii\nbbddffhhjjbbddffhhjj\nzkkmmooqqsskkmmooqqz\nzllnnpprrttllnnpprrz"
},
{
"input": "21",
"output": "aacceeggiiaacceeggiiz\nbbddffhhjjbbddffhhjjz\nzkkmmooqqsskkmmooqqss\nzllnnpprrttllnnpprrtt"
},
{
"input": "22",
"output": "aacceeggiiaacceeggiiaa\nbbddffhhjjbbddffhhjjbb\nzkkmmooqqsskkmmooqqssz\nzllnnpprrttllnnpprrttz"
},
{
"input": "23",
"output": "aacceeggiiaacceeggiiaaz\nbbddffhhjjbbddffhhjjbbz\nzkkmmooqqsskkmmooqqsskk\nzllnnpprrttllnnpprrttll"
},
{
"input": "24",
"output": "aacceeggiiaacceeggiiaacc\nbbddffhhjjbbddffhhjjbbdd\nzkkmmooqqsskkmmooqqsskkz\nzllnnpprrttllnnpprrttllz"
},
{
"input": "25",
"output": "aacceeggiiaacceeggiiaaccz\nbbddffhhjjbbddffhhjjbbddz\nzkkmmooqqsskkmmooqqsskkmm\nzllnnpprrttllnnpprrttllnn"
},
{
"input": "26",
"output": "aacceeggiiaacceeggiiaaccee\nbbddffhhjjbbddffhhjjbbddff\nzkkmmooqqsskkmmooqqsskkmmz\nzllnnpprrttllnnpprrttllnnz"
},
{
"input": "27",
"output": "aacceeggiiaacceeggiiaacceez\nbbddffhhjjbbddffhhjjbbddffz\nzkkmmooqqsskkmmooqqsskkmmoo\nzllnnpprrttllnnpprrttllnnpp"
},
{
"input": "28",
"output": "aacceeggiiaacceeggiiaacceegg\nbbddffhhjjbbddffhhjjbbddffhh\nzkkmmooqqsskkmmooqqsskkmmooz\nzllnnpprrttllnnpprrttllnnppz"
},
{
"input": "29",
"output": "aacceeggiiaacceeggiiaacceeggz\nbbddffhhjjbbddffhhjjbbddffhhz\nzkkmmooqqsskkmmooqqsskkmmooqq\nzllnnpprrttllnnpprrttllnnpprr"
},
{
"input": "30",
"output": "aacceeggiiaacceeggiiaacceeggii\nbbddffhhjjbbddffhhjjbbddffhhjj\nzkkmmooqqsskkmmooqqsskkmmooqqz\nzllnnpprrttllnnpprrttllnnpprrz"
},
{
"input": "91",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqss\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrtt"
},
{
"input": "92",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaa\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbb\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqssz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttz"
},
{
"input": "93",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaaz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskk\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttll"
},
{
"input": "94",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacc\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbdd\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllz"
},
{
"input": "95",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaaccz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmm\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnn"
},
{
"input": "96",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaaccee\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddff\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnz"
},
{
"input": "97",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceez\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmoo\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpp"
},
{
"input": "98",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceegg\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhh\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnppz"
},
{
"input": "99",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggz\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhz\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqq\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprr"
},
{
"input": "100",
"output": "aacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggiiaacceeggii\nbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjjbbddffhhjj\nzkkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqsskkmmooqqz\nzllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrttllnnpprrz"
}
] | 1,572,505,131 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 0 | 436 | 2,150,400 | n=int(input())
if n%3==2:
print("-1")
else:
ans=["."*n for i in range(4)]
for i in range(n):
if i%2==0:
ans[i][0]="a"
ans[i][1]="a"
ans[i][2]="b"
ans[i][3]="b"
else:
ans[i][0]="b"
ans[i][1]="b"
ans[i][2]="a"
ans[i][3]="a"
for i in ans:
print(i) | Title: Domino
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
We all know the problem about the number of ways one can tile a 2<=×<=*n* field by 1<=×<=2 dominoes. You probably remember that it goes down to Fibonacci numbers. We will talk about some other problem below, there you also are going to deal with tiling a rectangular field with dominoes.
You are given a 4<=×<=*n* rectangular field, that is the field that contains four lines and *n* columns. You have to find for it any tiling by 1<=×<=2 dominoes such that each of the *n*<=-<=1 potential vertical cuts along the grid lines intersects at least one domino, splitting it in two. No two dominoes in the sought tiling should overlap, each square of the field should be covered by exactly one domino. It is allowed to rotate the dominoes, that is, you can use 2<=×<=1 as well as 1<=×<=2 dominoes.
Write a program that finds an arbitrary sought tiling.
Input Specification:
The input contains one positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of the field's columns.
Output Specification:
If there's no solution, print "-1" (without the quotes). Otherwise, print four lines containing *n* characters each — that's the description of tiling, where each vertical cut intersects at least one domino. You should print the tiling, having painted the field in no more than 26 colors. Each domino should be painted a color. Different dominoes can be painted the same color, but dominoes of the same color should not be side-neighbouring. To indicate colors you should use lowercase Latin letters. Print any of the acceptable ways of tiling.
Demo Input:
['4\n']
Demo Output:
['yyzz\nbccd\nbxxd\nyyaa\n']
Note:
none | ```python
n=int(input())
if n%3==2:
print("-1")
else:
ans=["."*n for i in range(4)]
for i in range(n):
if i%2==0:
ans[i][0]="a"
ans[i][1]="a"
ans[i][2]="b"
ans[i][3]="b"
else:
ans[i][0]="b"
ans[i][1]="b"
ans[i][2]="a"
ans[i][3]="a"
for i in ans:
print(i)
``` | -1 |
292 | B | Network Topology | PROGRAMMING | 1,200 | [
"graphs",
"implementation"
] | null | null | This problem uses a simplified network topology model, please read the problem statement carefully and use it as a formal document as you develop the solution.
Polycarpus continues working as a system administrator in a large corporation. The computer network of this corporation consists of *n* computers, some of them are connected by a cable. The computers are indexed by integers from 1 to *n*. It's known that any two computers connected by cable directly or through other computers
Polycarpus decided to find out the network's topology. A network topology is the way of describing the network configuration, the scheme that shows the location and the connections of network devices.
Polycarpus knows three main network topologies: bus, ring and star. A bus is the topology that represents a shared cable with all computers connected with it. In the ring topology the cable connects each computer only with two other ones. A star is the topology where all computers of a network are connected to the single central node.
Let's represent each of these network topologies as a connected non-directed graph. A bus is a connected graph that is the only path, that is, the graph where all nodes are connected with two other ones except for some two nodes that are the beginning and the end of the path. A ring is a connected graph, where all nodes are connected with two other ones. A star is a connected graph, where a single central node is singled out and connected with all other nodes. For clarifications, see the picture.
You've got a connected non-directed graph that characterizes the computer network in Polycarpus' corporation. Help him find out, which topology type the given network is. If that is impossible to do, say that the network's topology is unknown. | The first line contains two space-separated integers *n* and *m* (4<=≤<=*n*<=≤<=105; 3<=≤<=*m*<=≤<=105) — the number of nodes and edges in the graph, correspondingly. Next *m* lines contain the description of the graph's edges. The *i*-th line contains a space-separated pair of integers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*) — the numbers of nodes that are connected by the *i*-the edge.
It is guaranteed that the given graph is connected. There is at most one edge between any two nodes. No edge connects a node with itself. | In a single line print the network topology name of the given graph. If the answer is the bus, print "bus topology" (without the quotes), if the answer is the ring, print "ring topology" (without the quotes), if the answer is the star, print "star topology" (without the quotes). If no answer fits, print "unknown topology" (without the quotes). | [
"4 3\n1 2\n2 3\n3 4\n",
"4 4\n1 2\n2 3\n3 4\n4 1\n",
"4 3\n1 2\n1 3\n1 4\n",
"4 4\n1 2\n2 3\n3 1\n1 4\n"
] | [
"bus topology\n",
"ring topology\n",
"star topology\n",
"unknown topology\n"
] | none | 1,000 | [
{
"input": "4 3\n1 2\n2 3\n3 4",
"output": "bus topology"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n4 1",
"output": "ring topology"
},
{
"input": "4 3\n1 2\n1 3\n1 4",
"output": "star topology"
},
{
"input": "4 4\n1 2\n2 3\n3 1\n1 4",
"output": "unknown topology"
},
{
"input": "5 4\n1 2\n3 5\n1 4\n5 4",
"output": "bus topology"
},
{
"input": "5 5\n3 4\n5 2\n2 1\n5 4\n3 1",
"output": "ring topology"
},
{
"input": "5 4\n4 2\n5 2\n1 2\n2 3",
"output": "star topology"
},
{
"input": "5 9\n5 3\n4 5\n3 1\n3 2\n2 1\n2 5\n1 5\n1 4\n4 2",
"output": "unknown topology"
},
{
"input": "4 3\n2 4\n1 3\n4 1",
"output": "bus topology"
},
{
"input": "4 4\n2 4\n4 1\n1 3\n2 3",
"output": "ring topology"
},
{
"input": "4 3\n1 2\n2 4\n3 2",
"output": "star topology"
},
{
"input": "4 4\n3 2\n2 4\n4 1\n1 2",
"output": "unknown topology"
},
{
"input": "10 9\n10 6\n3 4\n8 9\n8 4\n6 1\n2 9\n5 1\n7 5\n10 3",
"output": "bus topology"
},
{
"input": "10 10\n1 4\n3 6\n10 7\n5 8\n2 10\n3 4\n7 5\n9 6\n8 1\n2 9",
"output": "ring topology"
},
{
"input": "10 9\n1 4\n4 10\n4 9\n8 4\n4 7\n4 5\n4 2\n4 6\n4 3",
"output": "star topology"
},
{
"input": "10 14\n3 2\n7 2\n6 4\n8 1\n3 9\n5 6\n6 3\n4 1\n2 5\n7 10\n9 5\n7 1\n8 10\n3 4",
"output": "unknown topology"
},
{
"input": "4 4\n1 2\n2 3\n2 4\n3 4",
"output": "unknown topology"
},
{
"input": "5 4\n1 2\n1 3\n1 4\n4 5",
"output": "unknown topology"
},
{
"input": "10 9\n10 1\n10 2\n10 3\n10 4\n10 5\n10 6\n10 7\n10 8\n10 9",
"output": "star topology"
},
{
"input": "6 6\n1 2\n2 3\n3 1\n4 5\n5 6\n6 1",
"output": "unknown topology"
},
{
"input": "6 5\n1 2\n1 3\n1 4\n4 5\n4 6",
"output": "unknown topology"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n4 2",
"output": "unknown topology"
},
{
"input": "4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4",
"output": "unknown topology"
}
] | 1,670,264,087 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | def f(nn):
x=1
for i in range(len(nn)):
x=nn[i]
return x
n,m = list(map(int, input().split()))
nn = [0]n
a=[]
for i in range(m):
b,c = (list(map(int, input().split())))
a.append(b)
a.append(c)
nn[c-1]+=1
nn[b-1]+=1
if max(nn)==m:
print("star topology")
elif nn[0]==1 and nn[len(nn)-1]==1:
print("bus topology")
elif f(nn)==2**n:
print("ring topology")
else:
print("unknown topology") | Title: Network Topology
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem uses a simplified network topology model, please read the problem statement carefully and use it as a formal document as you develop the solution.
Polycarpus continues working as a system administrator in a large corporation. The computer network of this corporation consists of *n* computers, some of them are connected by a cable. The computers are indexed by integers from 1 to *n*. It's known that any two computers connected by cable directly or through other computers
Polycarpus decided to find out the network's topology. A network topology is the way of describing the network configuration, the scheme that shows the location and the connections of network devices.
Polycarpus knows three main network topologies: bus, ring and star. A bus is the topology that represents a shared cable with all computers connected with it. In the ring topology the cable connects each computer only with two other ones. A star is the topology where all computers of a network are connected to the single central node.
Let's represent each of these network topologies as a connected non-directed graph. A bus is a connected graph that is the only path, that is, the graph where all nodes are connected with two other ones except for some two nodes that are the beginning and the end of the path. A ring is a connected graph, where all nodes are connected with two other ones. A star is a connected graph, where a single central node is singled out and connected with all other nodes. For clarifications, see the picture.
You've got a connected non-directed graph that characterizes the computer network in Polycarpus' corporation. Help him find out, which topology type the given network is. If that is impossible to do, say that the network's topology is unknown.
Input Specification:
The first line contains two space-separated integers *n* and *m* (4<=≤<=*n*<=≤<=105; 3<=≤<=*m*<=≤<=105) — the number of nodes and edges in the graph, correspondingly. Next *m* lines contain the description of the graph's edges. The *i*-th line contains a space-separated pair of integers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*) — the numbers of nodes that are connected by the *i*-the edge.
It is guaranteed that the given graph is connected. There is at most one edge between any two nodes. No edge connects a node with itself.
Output Specification:
In a single line print the network topology name of the given graph. If the answer is the bus, print "bus topology" (without the quotes), if the answer is the ring, print "ring topology" (without the quotes), if the answer is the star, print "star topology" (without the quotes). If no answer fits, print "unknown topology" (without the quotes).
Demo Input:
['4 3\n1 2\n2 3\n3 4\n', '4 4\n1 2\n2 3\n3 4\n4 1\n', '4 3\n1 2\n1 3\n1 4\n', '4 4\n1 2\n2 3\n3 1\n1 4\n']
Demo Output:
['bus topology\n', 'ring topology\n', 'star topology\n', 'unknown topology\n']
Note:
none | ```python
def f(nn):
x=1
for i in range(len(nn)):
x=nn[i]
return x
n,m = list(map(int, input().split()))
nn = [0]n
a=[]
for i in range(m):
b,c = (list(map(int, input().split())))
a.append(b)
a.append(c)
nn[c-1]+=1
nn[b-1]+=1
if max(nn)==m:
print("star topology")
elif nn[0]==1 and nn[len(nn)-1]==1:
print("bus topology")
elif f(nn)==2**n:
print("ring topology")
else:
print("unknown topology")
``` | -1 |
|
426 | B | Sereja and Mirroring | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | Let's assume that we are given a matrix *b* of size *x*<=×<=*y*, let's determine the operation of mirroring matrix *b*. The mirroring of matrix *b* is a 2*x*<=×<=*y* matrix *c* which has the following properties:
- the upper half of matrix *c* (rows with numbers from 1 to *x*) exactly matches *b*; - the lower half of matrix *c* (rows with numbers from *x*<=+<=1 to 2*x*) is symmetric to the upper one; the symmetry line is the line that separates two halves (the line that goes in the middle, between rows *x* and *x*<=+<=1).
Sereja has an *n*<=×<=*m* matrix *a*. He wants to find such matrix *b*, that it can be transformed into matrix *a*, if we'll perform on it several (possibly zero) mirrorings. What minimum number of rows can such matrix contain? | The first line contains two integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). Each of the next *n* lines contains *m* integers — the elements of matrix *a*. The *i*-th line contains integers *a**i*1,<=*a**i*2,<=...,<=*a**im* (0<=≤<=*a**ij*<=≤<=1) — the *i*-th row of the matrix *a*. | In the single line, print the answer to the problem — the minimum number of rows of matrix *b*. | [
"4 3\n0 0 1\n1 1 0\n1 1 0\n0 0 1\n",
"3 3\n0 0 0\n0 0 0\n0 0 0\n",
"8 1\n0\n1\n1\n0\n0\n1\n1\n0\n"
] | [
"2\n",
"3\n",
"2\n"
] | In the first test sample the answer is a 2 × 3 matrix *b*:
If we perform a mirroring operation with this matrix, we get the matrix *a* that is given in the input: | 1,000 | [
{
"input": "4 3\n0 0 1\n1 1 0\n1 1 0\n0 0 1",
"output": "2"
},
{
"input": "3 3\n0 0 0\n0 0 0\n0 0 0",
"output": "3"
},
{
"input": "8 1\n0\n1\n1\n0\n0\n1\n1\n0",
"output": "2"
},
{
"input": "10 4\n0 0 1 0\n0 0 1 0\n1 1 0 1\n0 0 1 1\n1 0 1 0\n1 0 1 0\n0 0 1 1\n1 1 0 1\n0 0 1 0\n0 0 1 0",
"output": "5"
},
{
"input": "10 3\n0 0 0\n1 1 1\n1 1 0\n0 0 0\n0 1 1\n0 1 1\n0 0 0\n1 1 0\n1 1 1\n0 0 0",
"output": "5"
},
{
"input": "8 4\n1 0 0 0\n1 1 0 0\n1 0 0 1\n1 1 1 1\n0 0 1 1\n0 1 0 1\n0 1 1 1\n1 0 0 0",
"output": "8"
},
{
"input": "2 9\n1 0 0 1 1 1 0 1 0\n1 0 0 1 0 0 0 1 1",
"output": "2"
},
{
"input": "10 3\n0 1 0\n1 1 1\n1 0 1\n0 0 1\n1 0 1\n1 0 0\n1 1 0\n1 1 1\n1 0 1\n0 0 1",
"output": "10"
},
{
"input": "8 4\n1 1 0 1\n0 0 0 0\n0 0 0 0\n1 1 0 1\n1 1 0 1\n0 0 0 0\n0 0 0 0\n1 1 0 1",
"output": "2"
},
{
"input": "8 7\n1 1 0 0 1 1 0\n1 1 0 0 1 1 0\n1 1 0 0 1 1 0\n1 1 0 0 1 1 0\n1 1 0 0 1 1 0\n1 1 0 0 1 1 0\n1 1 0 0 1 1 0\n1 1 0 0 1 1 0",
"output": "1"
},
{
"input": "6 5\n0 0 1 0 1\n1 0 0 1 0\n1 1 1 0 0\n1 0 1 1 0\n0 0 0 0 0\n1 0 1 0 0",
"output": "6"
},
{
"input": "1 69\n0 0 1 1 1 1 0 0 1 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 0 1 1 1 0 0 1 1 0 1 1 1 1 0 0 0 0 0 0 1 1 1 0 1 1 0 1 0 0 1 0 0 0 1 1 1 1 1 1 1 1 0 1 0",
"output": "1"
},
{
"input": "8 20\n0 0 1 1 1 1 0 0 0 0 1 1 1 1 0 0 0 1 1 0\n1 0 1 0 1 0 0 0 0 1 0 1 0 1 1 0 1 1 1 1\n1 0 1 0 1 0 0 0 0 1 0 1 0 1 1 0 1 1 1 1\n0 0 1 1 1 1 0 0 0 0 1 1 1 1 0 0 0 1 1 0\n0 0 1 1 1 1 0 0 0 0 1 1 1 1 0 0 0 1 1 0\n1 0 1 0 1 0 0 0 0 1 0 1 0 1 1 0 1 1 1 1\n1 0 1 0 1 0 0 0 0 1 0 1 0 1 1 0 1 1 1 1\n0 0 1 1 1 1 0 0 0 0 1 1 1 1 0 0 0 1 1 0",
"output": "2"
},
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "2 2\n1 0\n0 1",
"output": "2"
},
{
"input": "2 2\n0 1\n0 1",
"output": "1"
},
{
"input": "1 2\n0 1",
"output": "1"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "1 100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "1"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "25"
},
{
"input": "100 1\n1\n1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1\n1",
"output": "50"
},
{
"input": "100 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1\n0\n0\n0",
"output": "100"
},
{
"input": "8 1\n1\n0\n0\n1\n1\n0\n1\n1",
"output": "8"
},
{
"input": "6 1\n0\n0\n0\n0\n0\n0",
"output": "3"
},
{
"input": "10 2\n1 1\n0 0\n0 0\n1 1\n0 0\n0 0\n1 1\n0 0\n0 0\n1 1",
"output": "5"
},
{
"input": "4 2\n1 1\n0 0\n0 0\n0 0",
"output": "4"
},
{
"input": "6 3\n1 1 1\n0 0 0\n1 1 1\n1 1 1\n0 0 0\n1 1 1",
"output": "3"
},
{
"input": "6 3\n1 1 1\n1 0 1\n1 1 1\n1 1 1\n1 0 1\n1 1 1",
"output": "3"
},
{
"input": "6 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3"
},
{
"input": "4 3\n1 0 1\n0 1 0\n1 0 1\n1 0 1",
"output": "4"
},
{
"input": "6 1\n1\n1\n1\n1\n1\n1",
"output": "3"
},
{
"input": "10 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "5"
},
{
"input": "3 1\n1\n1\n1",
"output": "3"
},
{
"input": "6 3\n0 0 0\n0 0 0\n0 0 0\n0 0 0\n0 0 0\n0 0 0",
"output": "3"
},
{
"input": "6 1\n1\n0\n1\n1\n0\n1",
"output": "3"
},
{
"input": "6 6\n0 0 0 0 0 0\n0 0 0 0 0 0\n0 0 0 0 0 0\n0 0 0 0 0 0\n0 0 0 0 0 0\n0 0 0 0 0 0",
"output": "3"
},
{
"input": "3 1\n1\n0\n1",
"output": "3"
},
{
"input": "12 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3"
},
{
"input": "12 1\n0\n1\n0\n0\n1\n0\n0\n1\n0\n0\n1\n0",
"output": "3"
},
{
"input": "2 3\n0 0 0\n0 0 0",
"output": "1"
},
{
"input": "3 3\n1 1 1\n1 1 1\n0 0 0",
"output": "3"
},
{
"input": "10 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "5"
},
{
"input": "12 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "3"
},
{
"input": "6 2\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "3"
},
{
"input": "6 3\n1 1 0\n0 0 0\n1 1 0\n1 1 0\n0 0 0\n1 1 0",
"output": "3"
},
{
"input": "6 2\n0 1\n0 1\n0 1\n0 1\n0 1\n0 1",
"output": "3"
},
{
"input": "12 1\n1\n1\n0\n0\n1\n1\n1\n1\n0\n0\n1\n1",
"output": "3"
},
{
"input": "6 2\n1 0\n1 0\n1 0\n1 0\n1 0\n1 0",
"output": "3"
}
] | 1,398,613,485 | 885 | Python 3 | OK | TESTS | 65 | 124 | 0 | n,m=map(int,input().split())
a=[]
for i in range(n):
a.append(''.join(input().split()))
while n%2==0:
k=0
for i in range(n//2):
if a[i]==a[n-i-1]:
k+=1
if k!=n//2:
break
n=n//2
print(n) | Title: Sereja and Mirroring
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's assume that we are given a matrix *b* of size *x*<=×<=*y*, let's determine the operation of mirroring matrix *b*. The mirroring of matrix *b* is a 2*x*<=×<=*y* matrix *c* which has the following properties:
- the upper half of matrix *c* (rows with numbers from 1 to *x*) exactly matches *b*; - the lower half of matrix *c* (rows with numbers from *x*<=+<=1 to 2*x*) is symmetric to the upper one; the symmetry line is the line that separates two halves (the line that goes in the middle, between rows *x* and *x*<=+<=1).
Sereja has an *n*<=×<=*m* matrix *a*. He wants to find such matrix *b*, that it can be transformed into matrix *a*, if we'll perform on it several (possibly zero) mirrorings. What minimum number of rows can such matrix contain?
Input Specification:
The first line contains two integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). Each of the next *n* lines contains *m* integers — the elements of matrix *a*. The *i*-th line contains integers *a**i*1,<=*a**i*2,<=...,<=*a**im* (0<=≤<=*a**ij*<=≤<=1) — the *i*-th row of the matrix *a*.
Output Specification:
In the single line, print the answer to the problem — the minimum number of rows of matrix *b*.
Demo Input:
['4 3\n0 0 1\n1 1 0\n1 1 0\n0 0 1\n', '3 3\n0 0 0\n0 0 0\n0 0 0\n', '8 1\n0\n1\n1\n0\n0\n1\n1\n0\n']
Demo Output:
['2\n', '3\n', '2\n']
Note:
In the first test sample the answer is a 2 × 3 matrix *b*:
If we perform a mirroring operation with this matrix, we get the matrix *a* that is given in the input: | ```python
n,m=map(int,input().split())
a=[]
for i in range(n):
a.append(''.join(input().split()))
while n%2==0:
k=0
for i in range(n//2):
if a[i]==a[n-i-1]:
k+=1
if k!=n//2:
break
n=n//2
print(n)
``` | 3 |
|
688 | A | Opponents | PROGRAMMING | 800 | [
"implementation"
] | null | null | Arya has *n* opponents in the school. Each day he will fight with all opponents who are present this day. His opponents have some fighting plan that guarantees they will win, but implementing this plan requires presence of them all. That means if one day at least one of Arya's opponents is absent at the school, then Arya will beat all present opponents. Otherwise, if all opponents are present, then they will beat Arya.
For each opponent Arya knows his schedule — whether or not he is going to present on each particular day. Tell him the maximum number of consecutive days that he will beat all present opponents.
Note, that if some day there are no opponents present, Arya still considers he beats all the present opponents. | The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=100) — the number of opponents and the number of days, respectively.
The *i*-th of the following *d* lines contains a string of length *n* consisting of characters '0' and '1'. The *j*-th character of this string is '0' if the *j*-th opponent is going to be absent on the *i*-th day. | Print the only integer — the maximum number of consecutive days that Arya will beat all present opponents. | [
"2 2\n10\n00\n",
"4 1\n0100\n",
"4 5\n1101\n1111\n0110\n1011\n1111\n"
] | [
"2\n",
"1\n",
"2\n"
] | In the first and the second samples, Arya will beat all present opponents each of the *d* days.
In the third sample, Arya will beat his opponents on days 1, 3 and 4 and his opponents will beat him on days 2 and 5. Thus, the maximum number of consecutive winning days is 2, which happens on days 3 and 4. | 500 | [
{
"input": "2 2\n10\n00",
"output": "2"
},
{
"input": "4 1\n0100",
"output": "1"
},
{
"input": "4 5\n1101\n1111\n0110\n1011\n1111",
"output": "2"
},
{
"input": "3 2\n110\n110",
"output": "2"
},
{
"input": "10 6\n1111111111\n0100110101\n1111111111\n0000011010\n1111111111\n1111111111",
"output": "1"
},
{
"input": "10 10\n1111111111\n0001001000\n1111111111\n1111111111\n1111111111\n1000000100\n1111111111\n0000011100\n1111111111\n1111111111",
"output": "1"
},
{
"input": "10 10\n0000100011\n0100001111\n1111111111\n1100011111\n1111111111\n1000111000\n1111000010\n0111001001\n1101010110\n1111111111",
"output": "4"
},
{
"input": "10 10\n1100110010\n0000000001\n1011100111\n1111111111\n1111111111\n1111111111\n1100010110\n1111111111\n1001001010\n1111111111",
"output": "3"
},
{
"input": "10 7\n0000111001\n1111111111\n0110110001\n1111111111\n1111111111\n1000111100\n0110000111",
"output": "2"
},
{
"input": "5 10\n00110\n11000\n10010\n00010\n11110\n01101\n11111\n10001\n11111\n01001",
"output": "6"
},
{
"input": "5 9\n11111\n11101\n11111\n11111\n01010\n01010\n00000\n11111\n00111",
"output": "3"
},
{
"input": "5 10\n11111\n00010\n11010\n11111\n11111\n00100\n11111\n11111\n01000\n11111",
"output": "2"
},
{
"input": "5 9\n11111\n11111\n11111\n11111\n11100\n11111\n11111\n11111\n00000",
"output": "1"
},
{
"input": "5 8\n11111\n10110\n01001\n11111\n01100\n10010\n11111\n11111",
"output": "2"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "100 1\n0011001100100010000011001100000001011101110110010001110001101100110011111101001011011001000010001111",
"output": "1"
},
{
"input": "100 1\n1011011100000101000111110000110111010101110010010011110010001110100011001110110101111100100110000000",
"output": "1"
},
{
"input": "100 1\n1110000011110101010111111100011001100000101101010110100101110000011100110110110101011100110110010011",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "0"
},
{
"input": "1 100\n1\n0\n0\n0\n1\n1\n0\n0\n0\n0\n1\n1\n0\n1\n1\n0\n0\n1\n1\n1\n0\n0\n1\n1\n1\n1\n1\n0\n1\n0\n0\n0\n1\n1\n0\n1\n0\n1\n0\n0\n0\n1\n0\n1\n0\n0\n0\n1\n1\n1\n0\n1\n1\n1\n0\n1\n0\n1\n1\n1\n1\n0\n0\n0\n0\n0\n0\n1\n1\n0\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n0\n1\n0\n0\n1\n0\n0\n1\n0\n0\n1\n0\n1\n1\n1\n0\n1\n0\n0",
"output": "6"
},
{
"input": "1 100\n0\n0\n0\n0\n1\n0\n0\n0\n0\n1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "49"
},
{
"input": "1 100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "0"
},
{
"input": "1 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "100"
},
{
"input": "2 2\n11\n10",
"output": "1"
},
{
"input": "1 1\n0",
"output": "1"
}
] | 1,601,415,110 | 2,147,483,647 | Python 3 | OK | TESTS | 56 | 124 | 0 | n_opps, n_days = input().strip().split()
n_days = int(n_days)
n_opps = int(n_opps)
max_cons_wins = 0
curr_cons_wins = 0
for _ in range(n_days):
n_dayopps = sum(c == '1' for c in input())
if n_dayopps != n_opps:
curr_cons_wins += 1
else:
curr_cons_wins = 0
max_cons_wins = max(max_cons_wins, curr_cons_wins)
print(max_cons_wins)
| Title: Opponents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arya has *n* opponents in the school. Each day he will fight with all opponents who are present this day. His opponents have some fighting plan that guarantees they will win, but implementing this plan requires presence of them all. That means if one day at least one of Arya's opponents is absent at the school, then Arya will beat all present opponents. Otherwise, if all opponents are present, then they will beat Arya.
For each opponent Arya knows his schedule — whether or not he is going to present on each particular day. Tell him the maximum number of consecutive days that he will beat all present opponents.
Note, that if some day there are no opponents present, Arya still considers he beats all the present opponents.
Input Specification:
The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=100) — the number of opponents and the number of days, respectively.
The *i*-th of the following *d* lines contains a string of length *n* consisting of characters '0' and '1'. The *j*-th character of this string is '0' if the *j*-th opponent is going to be absent on the *i*-th day.
Output Specification:
Print the only integer — the maximum number of consecutive days that Arya will beat all present opponents.
Demo Input:
['2 2\n10\n00\n', '4 1\n0100\n', '4 5\n1101\n1111\n0110\n1011\n1111\n']
Demo Output:
['2\n', '1\n', '2\n']
Note:
In the first and the second samples, Arya will beat all present opponents each of the *d* days.
In the third sample, Arya will beat his opponents on days 1, 3 and 4 and his opponents will beat him on days 2 and 5. Thus, the maximum number of consecutive winning days is 2, which happens on days 3 and 4. | ```python
n_opps, n_days = input().strip().split()
n_days = int(n_days)
n_opps = int(n_opps)
max_cons_wins = 0
curr_cons_wins = 0
for _ in range(n_days):
n_dayopps = sum(c == '1' for c in input())
if n_dayopps != n_opps:
curr_cons_wins += 1
else:
curr_cons_wins = 0
max_cons_wins = max(max_cons_wins, curr_cons_wins)
print(max_cons_wins)
``` | 3 |
|
1,006 | F | Xor-Paths | PROGRAMMING | 2,100 | [
"bitmasks",
"brute force",
"dp",
"meet-in-the-middle"
] | null | null | There is a rectangular grid of size $n \times m$. Each cell has a number written on it; the number on the cell ($i, j$) is $a_{i, j}$. Your task is to calculate the number of paths from the upper-left cell ($1, 1$) to the bottom-right cell ($n, m$) meeting the following constraints:
- You can move to the right or to the bottom only. Formally, from the cell ($i, j$) you may move to the cell ($i, j + 1$) or to the cell ($i + 1, j$). The target cell can't be outside of the grid. - The xor of all the numbers on the path from the cell ($1, 1$) to the cell ($n, m$) must be equal to $k$ (xor operation is the bitwise exclusive OR, it is represented as '^' in Java or C++ and "xor" in Pascal).
Find the number of such paths in the given grid. | The first line of the input contains three integers $n$, $m$ and $k$ ($1 \le n, m \le 20$, $0 \le k \le 10^{18}$) — the height and the width of the grid, and the number $k$.
The next $n$ lines contain $m$ integers each, the $j$-th element in the $i$-th line is $a_{i, j}$ ($0 \le a_{i, j} \le 10^{18}$). | Print one integer — the number of paths from ($1, 1$) to ($n, m$) with xor sum equal to $k$. | [
"3 3 11\n2 1 5\n7 10 0\n12 6 4\n",
"3 4 2\n1 3 3 3\n0 3 3 2\n3 0 1 1\n",
"3 4 1000000000000000000\n1 3 3 3\n0 3 3 2\n3 0 1 1\n"
] | [
"3\n",
"5\n",
"0\n"
] | All the paths from the first example:
- $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3)$.
All the paths from the second example:
- $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (2, 4) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (1, 3) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$. | 0 | [
{
"input": "3 3 11\n2 1 5\n7 10 0\n12 6 4",
"output": "3"
},
{
"input": "3 4 2\n1 3 3 3\n0 3 3 2\n3 0 1 1",
"output": "5"
},
{
"input": "3 4 1000000000000000000\n1 3 3 3\n0 3 3 2\n3 0 1 1",
"output": "0"
},
{
"input": "1 1 1000000000000000000\n1000000000000000000",
"output": "1"
},
{
"input": "1 1 1000000000000000000\n999999999999999999",
"output": "0"
},
{
"input": "1 1 1\n1",
"output": "1"
},
{
"input": "1 2 3\n1 2",
"output": "1"
},
{
"input": "1 10 1023\n1 2 4 8 16 32 64 128 256 512",
"output": "1"
},
{
"input": "1 20 1048575\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288",
"output": "1"
},
{
"input": "2 1 3\n1\n2",
"output": "1"
},
{
"input": "2 2 7\n1 2\n2 4",
"output": "2"
},
{
"input": "2 10 2047\n1 2 4 8 16 32 64 128 256 512\n2 4 8 16 32 64 128 256 512 1024",
"output": "10"
},
{
"input": "2 20 2097151\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288\n2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288 1048576",
"output": "20"
},
{
"input": "10 1 1023\n1\n2\n4\n8\n16\n32\n64\n128\n256\n512",
"output": "1"
},
{
"input": "10 2 2047\n1 2\n2 4\n4 8\n8 16\n16 32\n32 64\n64 128\n128 256\n256 512\n512 1024",
"output": "10"
},
{
"input": "10 10 524287\n1 2 4 8 16 32 64 128 256 512\n2 4 8 16 32 64 128 256 512 1024\n4 8 16 32 64 128 256 512 1024 2048\n8 16 32 64 128 256 512 1024 2048 4096\n16 32 64 128 256 512 1024 2048 4096 8192\n32 64 128 256 512 1024 2048 4096 8192 16384\n64 128 256 512 1024 2048 4096 8192 16384 32768\n128 256 512 1024 2048 4096 8192 16384 32768 65536\n256 512 1024 2048 4096 8192 16384 32768 65536 131072\n512 1024 2048 4096 8192 16384 32768 65536 131072 262144",
"output": "48620"
},
{
"input": "20 1 1048575\n1\n2\n4\n8\n16\n32\n64\n128\n256\n512\n1024\n2048\n4096\n8192\n16384\n32768\n65536\n131072\n262144\n524288",
"output": "1"
},
{
"input": "20 2 2097151\n1 2\n2 4\n4 8\n8 16\n16 32\n32 64\n64 128\n128 256\n256 512\n512 1024\n1024 2048\n2048 4096\n4096 8192\n8192 16384\n16384 32768\n32768 65536\n65536 131072\n131072 262144\n262144 524288\n524288 1048576",
"output": "20"
},
{
"input": "1 1 982347923479\n1",
"output": "0"
},
{
"input": "1 2 1\n1 1",
"output": "0"
}
] | 1,686,917,365 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 0 | 92 | 2,867,200 | import sys
sys.stdin = open("input.txt", "r")
sys.stdout = open("output.txt", "w")
# sys.stderr = open("error.txt", "w")
input = sys.stdin.readline
n,m,k = map(int, input().split(' '))
arr = [ list(map(int, input().split(' '))) for i in range(n) ]
def solve(arr,i, j, xor):
if(i == n-1 and j == m-1 and xor^arr[i][j] == k):
return 1
elif (i == n-1 and j == m-1 and xor^arr[i][j] != k):
return 0
ans = 0
xor = xor ^ arr[i][j]
# we can go down or right
if(i < n-1):
ans += solve(arr, i+1, j, xor)
if(j < m-1):
ans += solve(arr, i, j+1, xor)
return ans
t = solve(arr, 0,0,0)
print(t) | Title: Xor-Paths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a rectangular grid of size $n \times m$. Each cell has a number written on it; the number on the cell ($i, j$) is $a_{i, j}$. Your task is to calculate the number of paths from the upper-left cell ($1, 1$) to the bottom-right cell ($n, m$) meeting the following constraints:
- You can move to the right or to the bottom only. Formally, from the cell ($i, j$) you may move to the cell ($i, j + 1$) or to the cell ($i + 1, j$). The target cell can't be outside of the grid. - The xor of all the numbers on the path from the cell ($1, 1$) to the cell ($n, m$) must be equal to $k$ (xor operation is the bitwise exclusive OR, it is represented as '^' in Java or C++ and "xor" in Pascal).
Find the number of such paths in the given grid.
Input Specification:
The first line of the input contains three integers $n$, $m$ and $k$ ($1 \le n, m \le 20$, $0 \le k \le 10^{18}$) — the height and the width of the grid, and the number $k$.
The next $n$ lines contain $m$ integers each, the $j$-th element in the $i$-th line is $a_{i, j}$ ($0 \le a_{i, j} \le 10^{18}$).
Output Specification:
Print one integer — the number of paths from ($1, 1$) to ($n, m$) with xor sum equal to $k$.
Demo Input:
['3 3 11\n2 1 5\n7 10 0\n12 6 4\n', '3 4 2\n1 3 3 3\n0 3 3 2\n3 0 1 1\n', '3 4 1000000000000000000\n1 3 3 3\n0 3 3 2\n3 0 1 1\n']
Demo Output:
['3\n', '5\n', '0\n']
Note:
All the paths from the first example:
- $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3)$.
All the paths from the second example:
- $(1, 1) \rightarrow (2, 1) \rightarrow (3, 1) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (3, 2) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (2, 1) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (2, 4) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (2, 2) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$; - $(1, 1) \rightarrow (1, 2) \rightarrow (1, 3) \rightarrow (2, 3) \rightarrow (3, 3) \rightarrow (3, 4)$. | ```python
import sys
sys.stdin = open("input.txt", "r")
sys.stdout = open("output.txt", "w")
# sys.stderr = open("error.txt", "w")
input = sys.stdin.readline
n,m,k = map(int, input().split(' '))
arr = [ list(map(int, input().split(' '))) for i in range(n) ]
def solve(arr,i, j, xor):
if(i == n-1 and j == m-1 and xor^arr[i][j] == k):
return 1
elif (i == n-1 and j == m-1 and xor^arr[i][j] != k):
return 0
ans = 0
xor = xor ^ arr[i][j]
# we can go down or right
if(i < n-1):
ans += solve(arr, i+1, j, xor)
if(j < m-1):
ans += solve(arr, i, j+1, xor)
return ans
t = solve(arr, 0,0,0)
print(t)
``` | -1 |
|
22 | A | Second Order Statistics | PROGRAMMING | 800 | [
"brute force"
] | A. Second Order Statistics | 2 | 256 | Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem. | The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value. | If the given sequence has the second order statistics, output this order statistics, otherwise output NO. | [
"4\n1 2 2 -4\n",
"5\n1 2 3 1 1\n"
] | [
"1\n",
"2\n"
] | none | 0 | [
{
"input": "4\n1 2 2 -4",
"output": "1"
},
{
"input": "5\n1 2 3 1 1",
"output": "2"
},
{
"input": "1\n28",
"output": "NO"
},
{
"input": "2\n-28 12",
"output": "12"
},
{
"input": "3\n-83 40 -80",
"output": "-80"
},
{
"input": "8\n93 77 -92 26 21 -48 53 91",
"output": "-48"
},
{
"input": "20\n-72 -9 -86 80 7 -10 40 -27 -94 92 96 56 28 -19 79 36 -3 -73 -63 -49",
"output": "-86"
},
{
"input": "49\n-74 -100 -80 23 -8 -83 -41 -20 48 17 46 -73 -55 67 85 4 40 -60 -69 -75 56 -74 -42 93 74 -95 64 -46 97 -47 55 0 -78 -34 -31 40 -63 -49 -76 48 21 -1 -49 -29 -98 -11 76 26 94",
"output": "-98"
},
{
"input": "88\n63 48 1 -53 -89 -49 64 -70 -49 71 -17 -16 76 81 -26 -50 67 -59 -56 97 2 100 14 18 -91 -80 42 92 -25 -88 59 8 -56 38 48 -71 -78 24 -14 48 -1 69 73 -76 54 16 -92 44 47 33 -34 -17 -81 21 -59 -61 53 26 10 -76 67 35 -29 70 65 -13 -29 81 80 32 74 -6 34 46 57 1 -45 -55 69 79 -58 11 -2 22 -18 -16 -89 -46",
"output": "-91"
},
{
"input": "100\n34 32 88 20 76 53 -71 -39 -98 -10 57 37 63 -3 -54 -64 -78 -82 73 20 -30 -4 22 75 51 -64 -91 29 -52 -48 83 19 18 -47 46 57 -44 95 89 89 -30 84 -83 67 58 -99 -90 -53 92 -60 -5 -56 -61 27 68 -48 52 -95 64 -48 -30 -67 66 89 14 -33 -31 -91 39 7 -94 -54 92 -96 -99 -83 -16 91 -28 -66 81 44 14 -85 -21 18 40 16 -13 -82 -33 47 -10 -40 -19 10 25 60 -34 -89",
"output": "-98"
},
{
"input": "2\n-1 -1",
"output": "NO"
},
{
"input": "3\n-2 -2 -2",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "10\n40 71 -85 -85 40 -85 -85 64 -85 47",
"output": "40"
},
{
"input": "23\n-90 -90 -41 -64 -64 -90 -15 10 -43 -90 -64 -64 89 -64 36 47 38 -90 -64 -90 -90 68 -90",
"output": "-64"
},
{
"input": "39\n-97 -93 -42 -93 -97 -93 56 -97 -97 -97 76 -33 -60 91 7 82 17 47 -97 -97 -93 73 -97 12 -97 -97 -97 -97 56 -92 -83 -93 -93 49 -93 -97 -97 -17 -93",
"output": "-93"
},
{
"input": "51\n-21 6 -35 -98 -86 -98 -86 -43 -65 32 -98 -40 96 -98 -98 -98 -98 -86 -86 -98 56 -86 -98 -98 -30 -98 -86 -31 -98 -86 -86 -86 -86 -30 96 -86 -86 -86 -60 25 88 -86 -86 58 31 -47 57 -86 37 44 -83",
"output": "-86"
},
{
"input": "66\n-14 -95 65 -95 -95 -97 -90 -71 -97 -97 70 -95 -95 -97 -95 -27 35 -87 -95 -5 -97 -97 87 34 -49 -95 -97 -95 -97 -95 -30 -95 -97 47 -95 -17 -97 -95 -97 -69 51 -97 -97 -95 -75 87 59 21 63 56 76 -91 98 -97 6 -97 -95 -95 -97 -73 11 -97 -35 -95 -95 -43",
"output": "-95"
},
{
"input": "77\n-67 -93 -93 -92 97 29 93 -93 -93 -5 -93 -7 60 -92 -93 44 -84 68 -92 -93 69 -92 -37 56 43 -93 35 -92 -93 19 -79 18 -92 -93 -93 -37 -93 -47 -93 -92 -92 74 67 19 40 -92 -92 -92 -92 -93 -93 -41 -93 -92 -93 -93 -92 -93 51 -80 6 -42 -92 -92 -66 -12 -92 -92 -3 93 -92 -49 -93 40 62 -92 -92",
"output": "-92"
},
{
"input": "89\n-98 40 16 -87 -98 63 -100 55 -96 -98 -21 -100 -93 26 -98 -98 -100 -89 -98 -5 -65 -28 -100 -6 -66 67 -100 -98 -98 10 -98 -98 -70 7 -98 2 -100 -100 -98 25 -100 -100 -98 23 -68 -100 -98 3 98 -100 -98 -98 -98 -98 -24 -100 -100 -9 -98 35 -100 99 -5 -98 -100 -100 37 -100 -84 57 -98 40 -47 -100 -1 -92 -76 -98 -98 -100 -100 -100 -63 30 21 -100 -100 -100 -12",
"output": "-98"
},
{
"input": "99\n10 -84 -100 -100 73 -64 -100 -94 33 -100 -100 -100 -100 71 64 24 7 -100 -32 -100 -100 77 -100 62 -12 55 45 -100 -100 -80 -100 -100 -100 -100 -100 -100 -100 -100 -100 -39 -48 -100 -34 47 -100 -100 -100 -100 -100 -77 -100 -100 -100 -100 -100 -100 -52 40 -55 -100 -44 -100 72 33 70 -100 -100 -78 -100 -3 100 -77 22 -100 95 -30 -100 10 -69 -100 -100 -100 -100 52 -39 -100 -100 -100 7 -100 -98 -66 95 -17 -100 52 -100 68 -100",
"output": "-98"
},
{
"input": "100\n-99 -98 -64 89 53 57 -99 29 -78 18 -3 -54 76 -98 -99 -98 37 -98 19 -47 89 73 -98 -91 -99 -99 -98 -48 -99 22 -99 -98 -99 -99 -98 -60 84 67 -99 -98 20 -98 88 -98 46 -98 -99 -98 -99 -71 -99 -98 -98 -39 83 95 -98 63 -98 -99 32 -98 -99 -64 57 -30 -53 -83 -4 -99 58 20 -98 -10 -99 -44 -99 -99 -99 -99 75 34 -98 -52 -98 -30 -98 -99 -98 -98 51 -99 -99 -99 -98 -99 -99 -82 -90 92",
"output": "-98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "9\n99 99 99 99 100 100 100 100 100",
"output": "100"
},
{
"input": "5\n-100 -100 -100 -100 -100",
"output": "NO"
}
] | 1,679,984,635 | 2,147,483,647 | Python 3 | OK | TESTS | 31 | 92 | 0 | n=int(input())
l=list(map(int,input().split()))
l2=set(l)
l3=list(l2)
l3.sort()
if len(l3)==1:
print("NO")
else:
print(l3[1]) | Title: Second Order Statistics
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
Output Specification:
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
Demo Input:
['4\n1 2 2 -4\n', '5\n1 2 3 1 1\n']
Demo Output:
['1\n', '2\n']
Note:
none | ```python
n=int(input())
l=list(map(int,input().split()))
l2=set(l)
l3=list(l2)
l3.sort()
if len(l3)==1:
print("NO")
else:
print(l3[1])
``` | 3.977 |
455 | A | Boredom | PROGRAMMING | 1,500 | [
"dp"
] | null | null | Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). | Print a single integer — the maximum number of points that Alex can earn. | [
"2\n1 2\n",
"3\n1 2 3\n",
"9\n1 2 1 3 2 2 2 2 3\n"
] | [
"2\n",
"4\n",
"10\n"
] | Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | 500 | [
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 2 3",
"output": "4"
},
{
"input": "9\n1 2 1 3 2 2 2 2 3",
"output": "10"
},
{
"input": "5\n3 3 4 5 4",
"output": "11"
},
{
"input": "5\n5 3 5 3 4",
"output": "16"
},
{
"input": "5\n4 2 3 2 5",
"output": "9"
},
{
"input": "10\n10 5 8 9 5 6 8 7 2 8",
"output": "46"
},
{
"input": "10\n1 1 1 1 1 1 2 3 4 4",
"output": "14"
},
{
"input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4",
"output": "296"
},
{
"input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2",
"output": "313"
},
{
"input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9",
"output": "298"
},
{
"input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5",
"output": "312"
},
{
"input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2",
"output": "287"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2",
"output": "265"
},
{
"input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9",
"output": "328"
},
{
"input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9",
"output": "324"
},
{
"input": "10\n7 4 5 3 9 1 10 3 4 5",
"output": "34"
},
{
"input": "10\n8 9 6 5 6 4 10 9 1 4",
"output": "39"
},
{
"input": "10\n1 7 1 4 9 10 8 2 9 9",
"output": "40"
},
{
"input": "1\n100000",
"output": "100000"
}
] | 1,681,903,423 | 2,147,483,647 | Python 3 | OK | TESTS | 47 | 171 | 7,065,600 | n = int(input())
a = [int(ak) for ak in input().split()]
count_num = [0] * 100001
for ak in a:
count_num[ak] += 1
dp = [0] * 100001
dp[1] = count_num[1]
for ak in range(2,len(dp)):
dp[ak] = max(dp[ak-1], dp[ak-2]+count_num[ak]*ak)
print(dp[-1]) | Title: Boredom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Print a single integer — the maximum number of points that Alex can earn.
Demo Input:
['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n']
Demo Output:
['2\n', '4\n', '10\n']
Note:
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | ```python
n = int(input())
a = [int(ak) for ak in input().split()]
count_num = [0] * 100001
for ak in a:
count_num[ak] += 1
dp = [0] * 100001
dp[1] = count_num[1]
for ak in range(2,len(dp)):
dp[ak] = max(dp[ak-1], dp[ak-2]+count_num[ak]*ak)
print(dp[-1])
``` | 3 |
|
660 | D | Number of Parallelograms | PROGRAMMING | 1,900 | [
"geometry"
] | null | null | You are given *n* points on a plane. All the points are distinct and no three of them lie on the same line. Find the number of parallelograms with the vertices at the given points. | The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of points.
Each of the next *n* lines contains two integers (*x**i*,<=*y**i*) (0<=≤<=*x**i*,<=*y**i*<=≤<=109) — the coordinates of the *i*-th point. | Print the only integer *c* — the number of parallelograms with the vertices at the given points. | [
"4\n0 1\n1 0\n1 1\n2 0\n"
] | [
"1\n"
] | none | 0 | [
{
"input": "4\n0 1\n1 0\n1 1\n2 0",
"output": "1"
},
{
"input": "1\n0 0",
"output": "0"
},
{
"input": "1\n6 6",
"output": "0"
},
{
"input": "5\n1 5\n4 2\n4 4\n8 1\n8 2",
"output": "0"
},
{
"input": "10\n1 7\n2 14\n3 7\n3 13\n5 13\n13 10\n15 12\n17 1\n18 8\n19 0",
"output": "2"
},
{
"input": "20\n0 17\n1 8\n1 9\n2 5\n2 11\n3 0\n5 10\n5 13\n6 7\n7 3\n12 13\n13 7\n14 16\n15 10\n15 18\n17 2\n17 12\n18 14\n19 18\n20 17",
"output": "18"
},
{
"input": "2\n2 5\n10 7",
"output": "0"
},
{
"input": "4\n7 9\n10 2\n12 20\n15 13",
"output": "1"
},
{
"input": "10\n2 14\n5 9\n10 16\n12 5\n16 19\n26 23\n30 37\n32 26\n37 33\n40 28",
"output": "10"
},
{
"input": "4\n0 0\n0 1\n1 2\n1 1",
"output": "1"
},
{
"input": "5\n4 0\n1 3\n0 3\n1 1\n4 2",
"output": "1"
},
{
"input": "4\n0 0\n1 0\n2 1\n1 1",
"output": "1"
},
{
"input": "8\n0 0\n0 2\n1 3\n1 1\n100 10\n100 11\n101 11\n101 10",
"output": "5"
},
{
"input": "4\n0 0\n0 1\n1000000000 0\n1000000000 1",
"output": "1"
},
{
"input": "4\n0 0\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "8\n0 0\n1 1\n3 1\n2 0\n100 10\n100 11\n101 11\n101 10",
"output": "5"
},
{
"input": "4\n0 0\n1 1\n0 1\n1 0",
"output": "1"
},
{
"input": "4\n0 0\n0 2\n1 3\n1 1",
"output": "1"
},
{
"input": "6\n20 2\n20 3\n0 0\n0 1\n1 1\n1 0",
"output": "3"
},
{
"input": "4\n3 3\n4 4\n6 4\n5 3",
"output": "1"
},
{
"input": "4\n0 0\n1 1\n2 1\n1 0",
"output": "1"
},
{
"input": "5\n0 0\n1 1\n2 0\n1 4\n3 4",
"output": "1"
},
{
"input": "9\n6 4\n5 3\n1 4\n1 5\n5 0\n4 3\n4 0\n6 2\n2 1",
"output": "3"
},
{
"input": "4\n2 3\n2 1\n1 3\n1 1",
"output": "1"
},
{
"input": "4\n1 0\n2 0\n4 1\n3 1",
"output": "1"
},
{
"input": "4\n0 0\n1 1\n3 1\n2 0",
"output": "1"
},
{
"input": "4\n0 0\n1 1\n1 0\n0 1",
"output": "1"
},
{
"input": "4\n0 0\n1 0\n1000000000 1000000000\n999999999 1000000000",
"output": "1"
},
{
"input": "4\n1 0\n0 1000000000\n1 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n2 1\n2 2\n1 2",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n5 2\n4 1",
"output": "1"
},
{
"input": "4\n0 0\n0 1\n2 2\n2 1",
"output": "1"
},
{
"input": "4\n12 14\n15 19\n21 17\n18 12",
"output": "1"
},
{
"input": "4\n0 0\n0 1000000000\n1 0\n1 1000000000",
"output": "1"
},
{
"input": "4\n0 1\n1 0\n1 1\n0 2",
"output": "1"
},
{
"input": "6\n3 5\n3 15\n5 9\n5 19\n2 16\n4 20",
"output": "3"
},
{
"input": "4\n0 0\n2 2\n3 2\n1 0",
"output": "1"
},
{
"input": "6\n0 0\n0 4194304\n1 0\n1 2097152\n2 1\n2 8388609",
"output": "0"
}
] | 1,698,774,060 | 2,147,483,647 | PyPy 3-64 | MEMORY_LIMIT_EXCEEDED | TESTS | 21 | 1,606 | 268,390,400 | from sys import stdin
input = lambda: stdin.buffer.readline().decode().strip()
from collections import Counter
points = []
n = int(input())
for _ in range(n):
x, y = map(int, input().split())
points += [(x, y)]
midPoints = Counter()
for i in range(n):
x1, y1 = points[i]
for j in range(i+1, n):
x2, y2 = points[j]
midPoints[(x1 + x2, y1 + y2)] += 1
ans = 0
for _, k in midPoints.items():
ans += k * (k-1) // 2
print(ans) | Title: Number of Parallelograms
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* points on a plane. All the points are distinct and no three of them lie on the same line. Find the number of parallelograms with the vertices at the given points.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of points.
Each of the next *n* lines contains two integers (*x**i*,<=*y**i*) (0<=≤<=*x**i*,<=*y**i*<=≤<=109) — the coordinates of the *i*-th point.
Output Specification:
Print the only integer *c* — the number of parallelograms with the vertices at the given points.
Demo Input:
['4\n0 1\n1 0\n1 1\n2 0\n']
Demo Output:
['1\n']
Note:
none | ```python
from sys import stdin
input = lambda: stdin.buffer.readline().decode().strip()
from collections import Counter
points = []
n = int(input())
for _ in range(n):
x, y = map(int, input().split())
points += [(x, y)]
midPoints = Counter()
for i in range(n):
x1, y1 = points[i]
for j in range(i+1, n):
x2, y2 = points[j]
midPoints[(x1 + x2, y1 + y2)] += 1
ans = 0
for _, k in midPoints.items():
ans += k * (k-1) // 2
print(ans)
``` | 0 |
|
34 | B | Sale | PROGRAMMING | 900 | [
"greedy",
"sortings"
] | B. Sale | 2 | 256 | Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn. | The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets. | Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets. | [
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] | [
"8\n",
"7\n"
] | none | 1,000 | [
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,610,305,210 | 2,147,483,647 | Python 3 | OK | TESTS | 25 | 124 | 0 | n, m = map(int, input().split())
prices = list(map(int, input().split()))
prices.sort()
money = 0
for t in range(m):
if prices[0] < 0:
money -= prices.pop(0)
else:
break
print(money) | Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none | ```python
n, m = map(int, input().split())
prices = list(map(int, input().split()))
prices.sort()
money = 0
for t in range(m):
if prices[0] < 0:
money -= prices.pop(0)
else:
break
print(money)
``` | 3.969 |
912 | B | New Year's Eve | PROGRAMMING | 1,300 | [
"bitmasks",
"constructive algorithms",
"number theory"
] | null | null | Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness.
The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest ones — but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum!
A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)
Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain. | The sole string contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1018). | Output one number — the largest possible xor-sum. | [
"4 3\n",
"6 6\n"
] | [
"7\n",
"7\n"
] | In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7.
In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7. | 1,000 | [
{
"input": "4 3",
"output": "7"
},
{
"input": "6 6",
"output": "7"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "1022 10",
"output": "1023"
},
{
"input": "415853337373441 52",
"output": "562949953421311"
},
{
"input": "75 12",
"output": "127"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "1152921504606846975"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000000000000 2",
"output": "1152921504606846975"
},
{
"input": "49194939 22",
"output": "67108863"
},
{
"input": "228104606 17",
"output": "268435455"
},
{
"input": "817034381 7",
"output": "1073741823"
},
{
"input": "700976748 4",
"output": "1073741823"
},
{
"input": "879886415 9",
"output": "1073741823"
},
{
"input": "18007336 10353515",
"output": "33554431"
},
{
"input": "196917003 154783328",
"output": "268435455"
},
{
"input": "785846777 496205300",
"output": "1073741823"
},
{
"input": "964756444 503568330",
"output": "1073741823"
},
{
"input": "848698811 317703059",
"output": "1073741823"
},
{
"input": "676400020444788 1",
"output": "676400020444788"
},
{
"input": "502643198528213 1",
"output": "502643198528213"
},
{
"input": "815936580997298686 684083143940282566",
"output": "1152921504606846975"
},
{
"input": "816762824175382110 752185261508428780",
"output": "1152921504606846975"
},
{
"input": "327942415253132295 222598158321260499",
"output": "576460752303423487"
},
{
"input": "328768654136248423 284493129147496637",
"output": "576460752303423487"
},
{
"input": "329594893019364551 25055600080496801",
"output": "576460752303423487"
},
{
"input": "921874985256864012 297786684518764536",
"output": "1152921504606846975"
},
{
"input": "922701224139980141 573634416190460758",
"output": "1152921504606846975"
},
{
"input": "433880815217730325 45629641110945892",
"output": "576460752303423487"
},
{
"input": "434707058395813749 215729375494216481",
"output": "576460752303423487"
},
{
"input": "435533301573897173 34078453236225189",
"output": "576460752303423487"
},
{
"input": "436359544751980597 199220719961060641",
"output": "576460752303423487"
},
{
"input": "437185783635096725 370972992240105630",
"output": "576460752303423487"
},
{
"input": "438012026813180149 111323110116193830",
"output": "576460752303423487"
},
{
"input": "438838269991263573 295468957052046146",
"output": "576460752303423487"
},
{
"input": "439664513169346997 46560240538186155",
"output": "576460752303423487"
},
{
"input": "440490752052463125 216165966013438147",
"output": "576460752303423487"
},
{
"input": "441316995230546549 401964286420555423",
"output": "576460752303423487"
},
{
"input": "952496582013329437 673506882352402278",
"output": "1152921504606846975"
},
{
"input": "1000000000000000000 1",
"output": "1000000000000000000"
},
{
"input": "2147483647 1",
"output": "2147483647"
},
{
"input": "2147483647 2",
"output": "2147483647"
},
{
"input": "2147483647 31",
"output": "2147483647"
},
{
"input": "8 2",
"output": "15"
},
{
"input": "3 3",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "10 2",
"output": "15"
},
{
"input": "288230376151711743 2",
"output": "288230376151711743"
},
{
"input": "5 2",
"output": "7"
},
{
"input": "576460752303423487 2",
"output": "576460752303423487"
},
{
"input": "36028797018963967 123",
"output": "36028797018963967"
},
{
"input": "1125899906842623 2",
"output": "1125899906842623"
},
{
"input": "576460752303423489 5",
"output": "1152921504606846975"
},
{
"input": "288230376151711743 3",
"output": "288230376151711743"
},
{
"input": "36028797018963967 345",
"output": "36028797018963967"
},
{
"input": "18014398509481984 30",
"output": "36028797018963967"
},
{
"input": "8 8",
"output": "15"
},
{
"input": "8 1",
"output": "8"
}
] | 1,657,604,061 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 47 | 92 | 5,017,600 | import sys
import math
import collections
import heapq
input=sys.stdin.readline
n,k=(int(i) for i in input().split())
if(k==1):
print(n)
else:
print(pow(2,int(math.log(n,2))+1)-1) | Title: New Year's Eve
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness.
The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest ones — but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum!
A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)
Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain.
Input Specification:
The sole string contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1018).
Output Specification:
Output one number — the largest possible xor-sum.
Demo Input:
['4 3\n', '6 6\n']
Demo Output:
['7\n', '7\n']
Note:
In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7.
In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7. | ```python
import sys
import math
import collections
import heapq
input=sys.stdin.readline
n,k=(int(i) for i in input().split())
if(k==1):
print(n)
else:
print(pow(2,int(math.log(n,2))+1)-1)
``` | 0 |
|
91 | A | Newspaper Headline | PROGRAMMING | 1,500 | [
"greedy",
"strings"
] | A. Newspaper Headline | 2 | 256 | A newspaper is published in Walrusland. Its heading is *s*1, it consists of lowercase Latin letters. Fangy the little walrus wants to buy several such newspapers, cut out their headings, glue them one to another in order to get one big string. After that walrus erase several letters from this string in order to get a new word *s*2. It is considered that when Fangy erases some letter, there's no whitespace formed instead of the letter. That is, the string remains unbroken and it still only consists of lowercase Latin letters.
For example, the heading is "abc". If we take two such headings and glue them one to the other one, we get "abcabc". If we erase the letters on positions 1 and 5, we get a word "bcac".
Which least number of newspaper headings *s*1 will Fangy need to glue them, erase several letters and get word *s*2? | The input data contain two lines. The first line contain the heading *s*1, the second line contains the word *s*2. The lines only consist of lowercase Latin letters (1<=≤<=|*s*1|<=≤<=104,<=1<=≤<=|*s*2|<=≤<=106). | If it is impossible to get the word *s*2 in the above-described manner, print "-1" (without the quotes). Otherwise, print the least number of newspaper headings *s*1, which Fangy will need to receive the word *s*2. | [
"abc\nxyz\n",
"abcd\ndabc\n"
] | [
"-1\n",
"2\n"
] | none | 500 | [
{
"input": "abc\nxyz",
"output": "-1"
},
{
"input": "abcd\ndabc",
"output": "2"
},
{
"input": "ab\nbabaaab",
"output": "5"
},
{
"input": "ab\nbaaabba",
"output": "6"
},
{
"input": "fbaaigiihhfaahgdbddgeggjdeigfadhfddja\nhbghjgijijcdafcbgiedichdeebaddfddb",
"output": "-1"
},
{
"input": "ibifgcfdbfdhihbifageaaadegbfbhgeebgdgiafgedchdg\ndedfebcfdigdefdediigcfcafbhhiacgfbeccfchd",
"output": "7"
},
{
"input": "fcagdciidcedeaicgfffgjefaefaachfbfj\naiecchjehdgbjfcdjdefgfhiddjajeddiigidaibejabd",
"output": "11"
},
{
"input": "ehfjaabjfedhddejjfcfijagefhjeahjcddhchahjbagi\nfbfdjbjhibjgjgaaajgdbcfdbhjcajcbbieijhcjgajhgaa",
"output": "10"
},
{
"input": "ifjcedhjhdjhbiaededfefagigggcebfaebf\ngeibbffgeefbaghdbfidbbhabdbdgej",
"output": "9"
},
{
"input": "eidfdfbbgjigghaddbjhcbdechecgghjgfjjcajjhaghdhd\nfcgecaefhgjjegbhjeaffcabifihhcadaibhi",
"output": "11"
}
] | 1,626,174,662 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 340 | 6,758,400 | a,s1,s2=1,input(),input();s=s1
while s1.find(s2)==-1 and a-10001:
s1+=s
a+=1
print(a if a-10001 else -1) | Title: Newspaper Headline
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A newspaper is published in Walrusland. Its heading is *s*1, it consists of lowercase Latin letters. Fangy the little walrus wants to buy several such newspapers, cut out their headings, glue them one to another in order to get one big string. After that walrus erase several letters from this string in order to get a new word *s*2. It is considered that when Fangy erases some letter, there's no whitespace formed instead of the letter. That is, the string remains unbroken and it still only consists of lowercase Latin letters.
For example, the heading is "abc". If we take two such headings and glue them one to the other one, we get "abcabc". If we erase the letters on positions 1 and 5, we get a word "bcac".
Which least number of newspaper headings *s*1 will Fangy need to glue them, erase several letters and get word *s*2?
Input Specification:
The input data contain two lines. The first line contain the heading *s*1, the second line contains the word *s*2. The lines only consist of lowercase Latin letters (1<=≤<=|*s*1|<=≤<=104,<=1<=≤<=|*s*2|<=≤<=106).
Output Specification:
If it is impossible to get the word *s*2 in the above-described manner, print "-1" (without the quotes). Otherwise, print the least number of newspaper headings *s*1, which Fangy will need to receive the word *s*2.
Demo Input:
['abc\nxyz\n', 'abcd\ndabc\n']
Demo Output:
['-1\n', '2\n']
Note:
none | ```python
a,s1,s2=1,input(),input();s=s1
while s1.find(s2)==-1 and a-10001:
s1+=s
a+=1
print(a if a-10001 else -1)
``` | 0 |
715 | B | Complete The Graph | PROGRAMMING | 2,300 | [
"binary search",
"constructive algorithms",
"graphs",
"shortest paths"
] | null | null | ZS the Coder has drawn an undirected graph of *n* vertices numbered from 0 to *n*<=-<=1 and *m* edges between them. Each edge of the graph is weighted, each weight is a positive integer.
The next day, ZS the Coder realized that some of the weights were erased! So he wants to reassign positive integer weight to each of the edges which weights were erased, so that the length of the shortest path between vertices *s* and *t* in the resulting graph is exactly *L*. Can you help him? | The first line contains five integers *n*,<=*m*,<=*L*,<=*s*,<=*t* (2<=≤<=*n*<=≤<=1000,<=<=1<=≤<=*m*<=≤<=10<=000,<=<=1<=≤<=*L*<=≤<=109,<=<=0<=≤<=*s*,<=*t*<=≤<=*n*<=-<=1,<=<=*s*<=≠<=*t*) — the number of vertices, number of edges, the desired length of shortest path, starting vertex and ending vertex respectively.
Then, *m* lines describing the edges of the graph follow. *i*-th of them contains three integers, *u**i*,<=*v**i*,<=*w**i* (0<=≤<=*u**i*,<=*v**i*<=≤<=*n*<=-<=1,<=<=*u**i*<=≠<=*v**i*,<=<=0<=≤<=*w**i*<=≤<=109). *u**i* and *v**i* denote the endpoints of the edge and *w**i* denotes its weight. If *w**i* is equal to 0 then the weight of the corresponding edge was erased.
It is guaranteed that there is at most one edge between any pair of vertices. | Print "NO" (without quotes) in the only line if it's not possible to assign the weights in a required way.
Otherwise, print "YES" in the first line. Next *m* lines should contain the edges of the resulting graph, with weights assigned to edges which weights were erased. *i*-th of them should contain three integers *u**i*, *v**i* and *w**i*, denoting an edge between vertices *u**i* and *v**i* of weight *w**i*. The edges of the new graph must coincide with the ones in the graph from the input. The weights that were not erased must remain unchanged whereas the new weights can be any positive integer not exceeding 1018.
The order of the edges in the output doesn't matter. The length of the shortest path between *s* and *t* must be equal to *L*.
If there are multiple solutions, print any of them. | [
"5 5 13 0 4\n0 1 5\n2 1 2\n3 2 3\n1 4 0\n4 3 4\n",
"2 1 123456789 0 1\n0 1 0\n",
"2 1 999999999 1 0\n0 1 1000000000\n"
] | [
"YES\n0 1 5\n2 1 2\n3 2 3\n1 4 8\n4 3 4\n",
"YES\n0 1 123456789\n",
"NO\n"
] | Here's how the graph in the first sample case looks like :
In the first sample case, there is only one missing edge weight. Placing the weight of 8 gives a shortest path from 0 to 4 of length 13.
In the second sample case, there is only a single edge. Clearly, the only way is to replace the missing weight with 123456789.
In the last sample case, there is no weights to assign but the length of the shortest path doesn't match the required value, so the answer is "NO". | 1,000 | [
{
"input": "5 5 13 0 4\n0 1 5\n2 1 2\n3 2 3\n1 4 0\n4 3 4",
"output": "YES\n0 1 5\n2 1 2\n3 2 3\n1 4 8\n4 3 4"
},
{
"input": "2 1 123456789 0 1\n0 1 0",
"output": "YES\n0 1 123456789"
},
{
"input": "2 1 999999999 1 0\n0 1 1000000000",
"output": "NO"
},
{
"input": "4 5 10 1 2\n0 1 3\n1 2 0\n1 3 4\n2 3 4\n2 0 6",
"output": "NO"
},
{
"input": "100 1 123456 99 0\n0 99 123456",
"output": "YES\n0 99 123456"
},
{
"input": "1000 1 5 999 0\n0 999 0",
"output": "YES\n0 999 5"
},
{
"input": "1000 1 1000000000 998 0\n0 999 0",
"output": "NO"
},
{
"input": "4 4 14 1 3\n1 3 13\n2 3 0\n2 0 0\n1 0 12",
"output": "NO"
},
{
"input": "4 4 13 1 3\n1 3 13\n2 3 0\n2 0 0\n1 0 12",
"output": "YES\n1 3 13\n2 3 1000000000000000000\n2 0 1000000000000000000\n1 0 12"
},
{
"input": "4 4 2 1 3\n1 3 13\n2 3 0\n2 0 0\n1 0 0",
"output": "NO"
},
{
"input": "4 4 8 1 3\n1 3 13\n2 3 0\n2 0 0\n1 0 6",
"output": "YES\n1 3 13\n2 3 1\n2 0 1\n1 0 6"
},
{
"input": "5 6 1000000000 0 4\n0 1 1\n2 0 2\n3 0 3\n4 1 0\n4 2 0\n3 4 0",
"output": "YES\n0 1 1\n2 0 2\n3 0 3\n4 1 999999999\n4 2 1000000000000000000\n3 4 1000000000000000000"
},
{
"input": "7 9 320 0 3\n0 1 0\n1 2 0\n2 3 0\n0 4 1\n4 1 1\n1 5 100\n5 2 100\n2 6 59\n6 3 61",
"output": "YES\n0 1 1\n1 2 199\n2 3 318\n0 4 1\n4 1 1\n1 5 100\n5 2 100\n2 6 59\n6 3 61"
},
{
"input": "7 9 319 0 3\n0 1 0\n1 2 0\n2 3 0\n0 4 1\n4 1 1\n1 5 100\n5 2 100\n2 6 59\n6 3 61",
"output": "YES\n0 1 1\n1 2 198\n2 3 317\n0 4 1\n4 1 1\n1 5 100\n5 2 100\n2 6 59\n6 3 61"
},
{
"input": "7 9 999999999 0 3\n0 1 0\n1 2 0\n2 3 0\n0 4 1\n4 1 1\n1 5 499999999\n5 2 499999999\n2 6 1\n6 3 1",
"output": "YES\n0 1 1\n1 2 999999996\n2 3 999999997\n0 4 1\n4 1 1\n1 5 499999999\n5 2 499999999\n2 6 1\n6 3 1"
},
{
"input": "5 5 2 0 2\n0 1 1\n1 2 1\n0 4 0\n4 3 0\n3 2 0",
"output": "YES\n0 1 1\n1 2 1\n0 4 1000000000000000000\n4 3 1000000000000000000\n3 2 1000000000000000000"
},
{
"input": "5 5 1 0 2\n0 1 1\n1 2 1\n0 4 0\n4 3 0\n3 2 0",
"output": "NO"
},
{
"input": "5 5 3 0 2\n0 1 1\n1 2 1\n0 4 0\n4 3 0\n3 2 0",
"output": "NO"
},
{
"input": "8 9 10 1 0\n1 2 1\n2 4 1\n1 3 0\n3 4 0\n4 5 0\n5 6 1\n6 0 1\n5 7 0\n7 0 0",
"output": "YES\n1 2 1\n2 4 1\n1 3 1000000000000000000\n3 4 1000000000000000000\n4 5 6\n5 6 1\n6 0 1\n5 7 1000000000000000000\n7 0 1000000000000000000"
},
{
"input": "4 5 7 0 3\n0 1 0\n1 2 3\n2 3 0\n0 2 5\n1 3 5",
"output": "YES\n0 1 2\n1 2 3\n2 3 3\n0 2 5\n1 3 5"
}
] | 1,611,332,199 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <bits/stdc++.h>
#define fio ios_base::sync_with_stdio(0);cin.tie(0);cout.tie(0);
#define ll long long
#define en cin.close();return 0;
#define INF ((ll)(4e18))
#define pb push_back
#define fi first//printf("%lli\n",cur);
#define se second//scanf("%lli",&n);
using namespace std;
const ll N = 1005;
vector<pair<ll,ll> > g[N], g2[N];
ll dist[N], par[N];
int main()
{
fio
//ifstream cin("in.inn");
ll n, m, l, s, t;
cin >> n >> m >> l >> s >> t;
vector<pair<pair<ll,ll>,ll> > p(m);
map<pair<ll,ll>,pair<ll,ll> > mp;
for(auto &i:p)
{
ll u, v, w;
cin >> u >> v >> w;
i={{u,v},((!w)?INF/4:w)};
if(w)
g[u].pb({v,w}),
g[v].pb({u,w});
g2[u].pb({v,max(1ll,w)}),
g2[v].pb({u,max(1ll,w)});
mp[{u,v}]={mp.size()/2,w};
mp[{v,u}]={mp.size()/2,w};
}
for(ll i = 1;i<=n;i++)
dist[i]=INF;
dist[s]=0;
priority_queue<pair<ll,ll> > pq;
pq.push({0,s});
while(!pq.empty())
{
ll u = pq.top().se;
ll d = -pq.top().fi;
pq.pop();
if(dist[u]<d)
continue;
for(auto v:g[u])
if(dist[v.fi]>dist[u]+v.se)
dist[v.fi]=dist[u]+v.se,
pq.push({-dist[v.fi],v.fi});
}
if(dist[t]<l)
{
cout << "NO";en
return 0;
}
for(ll i = 1;i<=n;i++)
dist[i]=INF;
dist[s]=0;
pq.push({0,s});
while(!pq.empty())
{
ll u = pq.top().se;
ll d = -pq.top().fi;
pq.pop();
if(dist[u]<d)
continue;
for(auto v:g2[u])
if(dist[v.fi]>dist[u]+v.se)
dist[v.fi]=dist[u]+v.se,
pq.push({-dist[v.fi],v.fi}),
par[v.fi]=u;
}
if(dist[t]>l)
{
cout << "NO";en
return 0;
}
ll it = t, c = 0;
while(it!=s)
{
auto t2 = mp[{it,par[it]}];
if(!t2.se)
{
p[t2.fi].se=((!c++)?l-dist[t]+1:1ll);
break;
}
it=par[it];
}
cout << "YES\n";
for(auto i:p)
cout << i.fi.fi << " " << i.fi.se << " " << i.se << "\n";
//cin.close();
return 0;
}
| Title: Complete The Graph
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder has drawn an undirected graph of *n* vertices numbered from 0 to *n*<=-<=1 and *m* edges between them. Each edge of the graph is weighted, each weight is a positive integer.
The next day, ZS the Coder realized that some of the weights were erased! So he wants to reassign positive integer weight to each of the edges which weights were erased, so that the length of the shortest path between vertices *s* and *t* in the resulting graph is exactly *L*. Can you help him?
Input Specification:
The first line contains five integers *n*,<=*m*,<=*L*,<=*s*,<=*t* (2<=≤<=*n*<=≤<=1000,<=<=1<=≤<=*m*<=≤<=10<=000,<=<=1<=≤<=*L*<=≤<=109,<=<=0<=≤<=*s*,<=*t*<=≤<=*n*<=-<=1,<=<=*s*<=≠<=*t*) — the number of vertices, number of edges, the desired length of shortest path, starting vertex and ending vertex respectively.
Then, *m* lines describing the edges of the graph follow. *i*-th of them contains three integers, *u**i*,<=*v**i*,<=*w**i* (0<=≤<=*u**i*,<=*v**i*<=≤<=*n*<=-<=1,<=<=*u**i*<=≠<=*v**i*,<=<=0<=≤<=*w**i*<=≤<=109). *u**i* and *v**i* denote the endpoints of the edge and *w**i* denotes its weight. If *w**i* is equal to 0 then the weight of the corresponding edge was erased.
It is guaranteed that there is at most one edge between any pair of vertices.
Output Specification:
Print "NO" (without quotes) in the only line if it's not possible to assign the weights in a required way.
Otherwise, print "YES" in the first line. Next *m* lines should contain the edges of the resulting graph, with weights assigned to edges which weights were erased. *i*-th of them should contain three integers *u**i*, *v**i* and *w**i*, denoting an edge between vertices *u**i* and *v**i* of weight *w**i*. The edges of the new graph must coincide with the ones in the graph from the input. The weights that were not erased must remain unchanged whereas the new weights can be any positive integer not exceeding 1018.
The order of the edges in the output doesn't matter. The length of the shortest path between *s* and *t* must be equal to *L*.
If there are multiple solutions, print any of them.
Demo Input:
['5 5 13 0 4\n0 1 5\n2 1 2\n3 2 3\n1 4 0\n4 3 4\n', '2 1 123456789 0 1\n0 1 0\n', '2 1 999999999 1 0\n0 1 1000000000\n']
Demo Output:
['YES\n0 1 5\n2 1 2\n3 2 3\n1 4 8\n4 3 4\n', 'YES\n0 1 123456789\n', 'NO\n']
Note:
Here's how the graph in the first sample case looks like :
In the first sample case, there is only one missing edge weight. Placing the weight of 8 gives a shortest path from 0 to 4 of length 13.
In the second sample case, there is only a single edge. Clearly, the only way is to replace the missing weight with 123456789.
In the last sample case, there is no weights to assign but the length of the shortest path doesn't match the required value, so the answer is "NO". | ```python
#include <bits/stdc++.h>
#define fio ios_base::sync_with_stdio(0);cin.tie(0);cout.tie(0);
#define ll long long
#define en cin.close();return 0;
#define INF ((ll)(4e18))
#define pb push_back
#define fi first//printf("%lli\n",cur);
#define se second//scanf("%lli",&n);
using namespace std;
const ll N = 1005;
vector<pair<ll,ll> > g[N], g2[N];
ll dist[N], par[N];
int main()
{
fio
//ifstream cin("in.inn");
ll n, m, l, s, t;
cin >> n >> m >> l >> s >> t;
vector<pair<pair<ll,ll>,ll> > p(m);
map<pair<ll,ll>,pair<ll,ll> > mp;
for(auto &i:p)
{
ll u, v, w;
cin >> u >> v >> w;
i={{u,v},((!w)?INF/4:w)};
if(w)
g[u].pb({v,w}),
g[v].pb({u,w});
g2[u].pb({v,max(1ll,w)}),
g2[v].pb({u,max(1ll,w)});
mp[{u,v}]={mp.size()/2,w};
mp[{v,u}]={mp.size()/2,w};
}
for(ll i = 1;i<=n;i++)
dist[i]=INF;
dist[s]=0;
priority_queue<pair<ll,ll> > pq;
pq.push({0,s});
while(!pq.empty())
{
ll u = pq.top().se;
ll d = -pq.top().fi;
pq.pop();
if(dist[u]<d)
continue;
for(auto v:g[u])
if(dist[v.fi]>dist[u]+v.se)
dist[v.fi]=dist[u]+v.se,
pq.push({-dist[v.fi],v.fi});
}
if(dist[t]<l)
{
cout << "NO";en
return 0;
}
for(ll i = 1;i<=n;i++)
dist[i]=INF;
dist[s]=0;
pq.push({0,s});
while(!pq.empty())
{
ll u = pq.top().se;
ll d = -pq.top().fi;
pq.pop();
if(dist[u]<d)
continue;
for(auto v:g2[u])
if(dist[v.fi]>dist[u]+v.se)
dist[v.fi]=dist[u]+v.se,
pq.push({-dist[v.fi],v.fi}),
par[v.fi]=u;
}
if(dist[t]>l)
{
cout << "NO";en
return 0;
}
ll it = t, c = 0;
while(it!=s)
{
auto t2 = mp[{it,par[it]}];
if(!t2.se)
{
p[t2.fi].se=((!c++)?l-dist[t]+1:1ll);
break;
}
it=par[it];
}
cout << "YES\n";
for(auto i:p)
cout << i.fi.fi << " " << i.fi.se << " " << i.se << "\n";
//cin.close();
return 0;
}
``` | -1 |
|
525 | A | Vitaliy and Pie | PROGRAMMING | 1,100 | [
"greedy",
"hashing",
"strings"
] | null | null | After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number. | The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1. | Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*. | [
"3\naAbB\n",
"4\naBaCaB\n",
"5\nxYyXzZaZ\n"
] | [
"0\n",
"3\n",
"2\n"
] | none | 250 | [
{
"input": "3\naAbB",
"output": "0"
},
{
"input": "4\naBaCaB",
"output": "3"
},
{
"input": "5\nxYyXzZaZ",
"output": "2"
},
{
"input": "26\naAbBcCdDeEfFgGhHiIjJkKlLmMnNoOpPqQrRsStTuUvVwWxXyY",
"output": "0"
},
{
"input": "26\nzAyBxCwDvEuFtGsHrIqJpKoLnMmNlOkPjQiRhSgTfUeVdWcXbY",
"output": "13"
},
{
"input": "5\naArRaRaR",
"output": "2"
},
{
"input": "2\ndA",
"output": "1"
},
{
"input": "2\ncB",
"output": "1"
},
{
"input": "10\nhNcMeXsSlHsUwYeMcA",
"output": "7"
},
{
"input": "100\nqDpInBmCrFwXpDbFgOzVvOcEmJrUcToAdEwEgTvBvBfWwRpGyEaXgDdRwVlQnYgWmWhMrHaIzPyXvGaFlRsVzHhZrOuVpXrKxFzAmWwPlFtNfPtJxVmLuHjKfYyArHrEnSwSzOvDpQhCgCqLlAcNpGhXrEeFuCmAqIkXyYtSsQwIxJzNiIuTgEbVuWrMwPrAlLyKaZ",
"output": "42"
},
{
"input": "2\ndD",
"output": "0"
},
{
"input": "2\ndE",
"output": "1"
},
{
"input": "3\ndDdD",
"output": "0"
},
{
"input": "3\ndEdD",
"output": "1"
},
{
"input": "3\ndEeD",
"output": "1"
},
{
"input": "3\ndEeF",
"output": "2"
}
] | 1,560,014,069 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 108 | 0 | n=int(input())
s=list(str(input()))
ans=0
for i in range(0,2*(n-1),2):
#print(i)
if s[i] != (s[i+1]).lower():
ans+=1
print(ans) | Title: Vitaliy and Pie
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After a hard day Vitaly got very hungry and he wants to eat his favorite potato pie. But it's not that simple. Vitaly is in the first room of the house with *n* room located in a line and numbered starting from one from left to right. You can go from the first room to the second room, from the second room to the third room and so on — you can go from the (*n*<=-<=1)-th room to the *n*-th room. Thus, you can go to room *x* only from room *x*<=-<=1.
The potato pie is located in the *n*-th room and Vitaly needs to go there.
Each pair of consecutive rooms has a door between them. In order to go to room *x* from room *x*<=-<=1, you need to open the door between the rooms with the corresponding key.
In total the house has several types of doors (represented by uppercase Latin letters) and several types of keys (represented by lowercase Latin letters). The key of type *t* can open the door of type *T* if and only if *t* and *T* are the same letter, written in different cases. For example, key f can open door F.
Each of the first *n*<=-<=1 rooms contains exactly one key of some type that Vitaly can use to get to next rooms. Once the door is open with some key, Vitaly won't get the key from the keyhole but he will immediately run into the next room. In other words, each key can open no more than one door.
Vitaly realizes that he may end up in some room without the key that opens the door to the next room. Before the start his run for the potato pie Vitaly can buy any number of keys of any type that is guaranteed to get to room *n*.
Given the plan of the house, Vitaly wants to know what is the minimum number of keys he needs to buy to surely get to the room *n*, which has a delicious potato pie. Write a program that will help Vitaly find out this number.
Input Specification:
The first line of the input contains a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of rooms in the house.
The second line of the input contains string *s* of length 2·*n*<=-<=2. Let's number the elements of the string from left to right, starting from one.
The odd positions in the given string *s* contain lowercase Latin letters — the types of the keys that lie in the corresponding rooms. Thus, each odd position *i* of the given string *s* contains a lowercase Latin letter — the type of the key that lies in room number (*i*<=+<=1)<=/<=2.
The even positions in the given string contain uppercase Latin letters — the types of doors between the rooms. Thus, each even position *i* of the given string *s* contains an uppercase letter — the type of the door that leads from room *i*<=/<=2 to room *i*<=/<=2<=+<=1.
Output Specification:
Print the only integer — the minimum number of keys that Vitaly needs to buy to surely get from room one to room *n*.
Demo Input:
['3\naAbB\n', '4\naBaCaB\n', '5\nxYyXzZaZ\n']
Demo Output:
['0\n', '3\n', '2\n']
Note:
none | ```python
n=int(input())
s=list(str(input()))
ans=0
for i in range(0,2*(n-1),2):
#print(i)
if s[i] != (s[i+1]).lower():
ans+=1
print(ans)
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Родители Васи хотят, чтобы он как можно лучше учился. Поэтому если он получает подряд три положительные оценки («четвёрки» или «пятёрки»), они дарят ему подарок. Соответственно, оценки «единица», «двойка» и «тройка» родители Васи считают плохими. Когда Вася получает подряд три хорошие оценки, ему сразу вручают подарок, но для того, чтобы получить ещё один подарок, ему вновь надо получить подряд ещё три хорошие оценки.
Например, если Вася получит подряд пять «четвёрок» оценок, а потом «двойку», то ему дадут только один подарок, а вот если бы «четвёрок» было уже шесть, то подарков было бы два.
За месяц Вася получил *n* оценок. Вам предстоит посчитать количество подарков, которые получил Вася. Оценки будут даны именно в том порядке, в котором Вася их получал. | В первой строке входных данных следует целое положительное число *n* (3<=≤<=*n*<=≤<=1000) — количество оценок, полученных Васей.
Во второй строке входных данных следует последовательность из *n* чисел *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=5) — оценки, полученные Васей. Оценки заданы в том порядке, в котором Вася их получил. | Выведите одно целое число — количество подарков, полученных Васей. | [
"6\n4 5 4 5 4 4\n",
"14\n1 5 4 5 2 4 4 5 5 4 3 4 5 5\n"
] | [
"2\n",
"3\n"
] | В первом примере Вася получит два подарка — за первые три положительные оценки и за следующую тройку положительных оценок соответственно. | 0 | [
{
"input": "6\n4 5 4 5 4 4",
"output": "2"
},
{
"input": "14\n1 5 4 5 2 4 4 5 5 4 3 4 5 5",
"output": "3"
},
{
"input": "3\n4 5 4",
"output": "1"
},
{
"input": "3\n4 5 1",
"output": "0"
},
{
"input": "4\n5 4 3 5",
"output": "0"
},
{
"input": "10\n4 4 5 4 4 5 5 5 4 4",
"output": "3"
},
{
"input": "20\n5 5 5 4 5 4 5 5 5 5 5 4 4 5 3 4 4 4 5 4",
"output": "5"
},
{
"input": "30\n4 4 5 5 5 4 5 5 4 5 4 4 5 4 4 4 5 4 4 4 5 5 5 5 4 5 5 5 4 4",
"output": "10"
},
{
"input": "40\n5 4 4 5 5 5 1 5 4 4 4 4 4 2 4 4 4 4 4 4 5 4 4 4 5 5 3 4 4 5 5 5 4 4 4 4 4 1 3 4",
"output": "11"
},
{
"input": "50\n4 5 4 4 5 2 4 4 1 3 5 4 4 4 4 5 5 5 5 3 5 4 4 5 5 4 4 4 5 4 4 4 4 4 2 4 5 4 4 4 1 5 4 5 4 5 4 1 4 4",
"output": "11"
},
{
"input": "60\n4 4 5 5 5 4 4 5 4 4 4 4 5 5 4 5 4 2 4 5 5 4 5 4 5 5 5 4 4 5 5 4 4 5 4 5 4 5 4 5 5 5 4 5 5 5 5 4 4 4 5 4 5 5 4 4 4 5 5 5",
"output": "19"
},
{
"input": "70\n5 4 4 4 4 4 5 4 4 5 4 5 4 3 5 5 5 4 4 5 5 4 4 4 4 5 4 4 5 5 4 4 5 4 5 4 5 4 4 4 5 5 4 4 4 4 5 4 4 4 5 5 5 5 4 4 4 1 5 5 4 1 5 5 4 4 5 4 4 5",
"output": "21"
},
{
"input": "80\n5 5 4 4 5 5 4 4 5 4 4 4 5 5 4 4 5 4 5 5 4 4 5 4 4 4 5 5 5 5 5 4 5 5 4 4 4 4 4 5 5 5 1 4 4 5 4 4 5 4 5 5 3 5 5 5 2 4 4 5 5 5 5 5 2 4 5 5 5 4 5 4 4 4 3 4 4 2 5 4",
"output": "23"
},
{
"input": "90\n4 4 4 4 4 5 4 4 5 4 5 5 4 5 5 5 5 5 5 5 5 4 5 5 4 4 4 5 4 5 5 5 5 5 4 5 5 4 5 5 4 4 5 5 4 5 5 4 5 5 5 5 4 5 4 4 5 5 4 3 5 5 5 5 5 5 5 1 5 5 4 4 5 5 4 5 4 5 5 4 4 4 4 4 4 4 5 5 4 5",
"output": "28"
},
{
"input": "100\n4 4 5 5 4 4 5 4 4 4 5 5 4 4 4 4 4 4 4 4 5 4 5 5 5 5 5 5 4 5 5 5 5 4 5 5 4 4 5 4 5 5 3 4 4 4 4 4 5 5 4 5 4 5 4 4 4 4 5 4 4 5 5 5 4 4 5 5 5 4 4 4 4 4 4 5 5 5 4 5 5 5 4 4 4 5 4 5 5 5 4 4 4 4 4 5 4 5 5 5",
"output": "33"
},
{
"input": "110\n5 1 4 4 5 4 4 4 5 4 2 4 4 4 5 5 4 5 5 4 4 4 4 3 5 4 4 4 4 5 2 5 5 4 5 5 4 4 1 4 4 4 4 5 4 5 4 4 4 4 4 4 5 5 4 5 4 4 4 4 5 5 5 4 5 4 1 5 5 5 4 2 4 4 5 5 4 4 4 4 5 5 4 5 4 5 4 4 4 5 5 5 5 5 5 5 4 4 4 5 5 4 4 4 5 5 5 4 5 5",
"output": "32"
},
{
"input": "120\n4 4 4 5 3 4 4 4 5 4 5 5 4 4 4 2 5 4 4 5 4 5 5 5 5 4 4 4 4 4 5 4 5 1 4 4 4 4 5 4 4 5 1 5 5 4 4 4 5 4 5 4 5 5 4 5 4 5 4 5 5 5 4 3 4 4 5 2 4 5 5 5 4 4 4 4 5 5 4 5 4 4 2 2 5 5 3 5 2 5 4 4 4 5 1 4 4 1 4 1 4 5 5 2 4 5 5 4 4 5 5 4 1 5 5 5 5 4 1 5",
"output": "27"
},
{
"input": "130\n5 5 4 2 5 5 5 4 5 4 4 5 5 5 4 5 4 5 4 5 4 5 5 4 5 4 4 4 4 5 5 4 4 5 5 4 5 5 4 4 5 5 5 4 5 4 4 4 4 4 5 5 4 5 4 5 4 5 4 4 4 4 5 4 4 5 5 4 4 5 4 5 4 5 5 4 5 5 5 4 5 4 5 5 5 5 4 5 4 5 4 5 5 5 5 5 5 4 4 4 5 5 5 5 4 4 5 5 5 4 5 5 4 4 4 5 4 5 5 4 5 4 4 4 5 4 4 5 5 4",
"output": "43"
},
{
"input": "140\n4 4 5 5 4 5 4 5 1 5 5 4 4 4 5 2 5 5 5 4 4 5 5 4 5 5 4 4 5 5 4 5 5 5 4 4 5 5 5 4 4 4 5 5 5 5 5 5 5 4 4 4 4 5 5 5 2 5 5 5 5 4 5 4 4 5 4 4 5 4 5 5 5 4 5 5 5 5 4 5 5 4 4 4 4 4 4 3 5 4 3 5 4 4 5 5 4 4 4 4 4 5 4 5 4 4 5 5 4 4 5 4 4 5 4 4 4 4 2 4 5 4 4 4 4 5 5 4 5 5 5 4 5 4 4 5 5 5 5 4",
"output": "43"
},
{
"input": "150\n5 4 5 4 5 5 4 5 4 4 4 4 5 3 4 4 4 5 4 5 5 4 4 4 4 4 5 1 5 5 4 4 1 3 5 4 3 3 4 5 5 5 1 3 5 1 4 4 4 4 4 4 4 3 4 4 4 4 5 4 5 4 5 4 5 5 5 4 5 4 4 4 5 5 5 4 4 5 4 5 4 4 4 1 4 3 4 5 4 3 4 4 4 5 4 5 5 5 5 4 4 4 5 4 4 4 5 3 4 5 5 4 5 4 4 4 4 5 4 5 5 4 4 5 4 4 5 4 5 5 4 4 5 4 5 5 3 4 4 5 4 4 5 5 1 3 5 4 4 5",
"output": "39"
},
{
"input": "160\n5 5 5 5 4 5 4 5 4 5 5 4 4 5 5 4 4 5 4 5 4 4 5 4 4 4 2 4 4 4 1 5 4 5 5 4 4 5 5 4 4 5 4 5 4 4 5 4 5 4 5 4 4 4 4 5 4 5 4 4 5 5 4 4 5 5 5 5 5 5 4 5 4 4 5 5 5 5 4 4 4 4 5 5 5 4 5 5 4 5 4 4 5 4 4 4 4 4 5 4 4 5 4 5 4 4 5 5 5 4 4 5 5 5 5 4 5 4 5 4 4 4 5 5 4 5 5 4 5 4 4 4 4 4 5 4 2 5 4 5 5 5 4 5 4 5 5 4 4 4 4 5 5 4 4 5 4 4 5 5",
"output": "51"
},
{
"input": "170\n4 4 4 4 4 4 4 1 4 4 5 4 5 4 4 4 5 5 4 5 4 5 4 4 4 5 5 5 4 5 4 5 4 5 4 4 5 5 5 5 4 4 4 4 5 4 5 4 4 5 4 5 4 4 5 1 4 5 5 4 4 4 4 5 4 5 5 5 5 4 4 4 4 4 5 5 4 4 4 5 4 5 5 5 3 5 4 4 5 4 5 5 4 4 4 5 5 4 5 5 4 5 5 5 4 4 4 4 4 4 5 5 5 5 4 4 5 4 5 4 5 4 5 4 4 5 5 4 4 4 4 5 5 4 4 5 4 4 5 4 5 4 5 5 5 4 4 2 5 5 5 5 4 2 5 4 4 4 4 4 5 5 5 5 5 5 4 5 4 5",
"output": "52"
},
{
"input": "180\n4 4 4 5 3 4 5 4 5 4 4 4 5 5 4 4 4 4 5 5 5 5 5 5 4 4 4 3 4 1 1 5 4 4 5 4 5 4 5 5 5 5 5 5 4 4 5 1 5 4 5 5 4 4 5 5 4 4 4 5 5 3 4 4 5 5 5 4 4 5 5 5 4 4 5 5 5 5 4 5 4 4 2 4 4 4 5 5 4 5 4 4 5 4 5 5 5 5 5 2 4 5 5 4 4 5 4 5 5 5 4 1 4 5 5 4 4 5 4 5 4 1 3 4 4 4 4 5 5 4 5 4 5 5 5 4 4 4 4 4 1 4 5 5 4 5 5 5 3 5 4 4 2 4 5 4 5 4 5 4 4 5 5 4 4 4 5 4 5 4 4 4 4 4 1 1 4 4 5 4",
"output": "50"
},
{
"input": "190\n4 4 4 4 5 4 4 4 5 5 4 5 5 5 4 4 5 5 5 5 4 5 5 5 5 5 4 4 4 5 4 5 5 5 5 4 5 4 4 4 5 5 5 5 5 4 5 4 4 4 5 5 4 5 5 4 5 5 5 5 5 4 5 4 4 4 5 5 5 4 4 4 4 4 4 4 4 5 4 5 5 4 4 5 4 5 5 4 5 4 5 4 3 5 4 5 4 4 5 5 4 4 4 4 4 4 4 5 5 4 5 4 5 5 4 4 4 5 5 4 4 4 1 4 5 4 5 4 5 5 4 5 4 5 4 4 4 5 5 5 4 5 4 5 4 4 5 4 5 5 5 4 4 4 4 5 4 5 4 5 4 5 4 4 4 5 4 5 5 5 5 4 4 4 5 4 5 4 5 4 5 5 5 4 4 5 5 4 3 4",
"output": "60"
},
{
"input": "200\n4 4 4 4 4 5 4 5 5 4 4 4 4 5 4 4 5 4 4 5 4 4 4 4 4 5 4 4 5 5 5 5 4 4 5 5 4 4 5 5 5 4 4 4 4 5 4 4 4 5 5 4 4 5 5 4 5 5 4 4 5 5 5 4 5 5 4 4 5 5 5 4 5 5 4 4 5 4 5 5 5 4 4 5 5 4 5 5 5 5 4 4 5 5 5 4 5 4 5 5 1 4 4 5 4 5 5 4 5 4 5 5 5 5 4 4 4 4 4 5 4 4 4 4 5 5 4 5 4 5 5 4 5 4 5 5 4 5 5 4 5 4 5 5 4 5 5 5 5 5 5 4 4 4 4 4 5 4 4 5 5 5 4 5 4 5 5 4 3 5 5 4 5 4 4 4 4 4 4 4 4 4 5 4 4 4 4 4 5 4 4 4 5 4 5 4 5 4 4 4",
"output": "65"
},
{
"input": "210\n4 5 5 5 5 5 5 4 4 5 5 4 4 5 5 5 5 5 4 5 5 5 5 4 5 5 5 5 4 4 4 5 5 4 4 5 5 4 5 4 5 4 1 4 5 4 5 4 5 1 4 5 5 4 4 5 4 5 4 5 5 5 5 5 4 4 4 5 5 5 4 5 4 4 4 4 5 4 4 5 5 4 4 4 4 5 4 4 4 4 2 4 4 4 5 5 5 4 5 4 4 5 5 5 4 5 4 4 5 5 4 5 4 4 5 5 5 5 4 4 4 5 5 5 5 1 4 4 5 4 5 4 5 4 4 4 5 5 4 5 4 5 4 4 5 4 5 4 5 5 4 4 5 5 4 4 5 4 4 5 4 4 5 5 5 4 5 5 5 5 4 4 4 4 5 5 5 5 5 5 5 4 4 5 4 5 5 4 4 5 4 4 4 4 5 4 4 5 4 5 4 5 5 5 4 4 5 4 5 5",
"output": "68"
},
{
"input": "220\n4 5 4 4 4 5 5 4 4 5 5 4 5 4 4 4 5 5 5 5 4 4 3 4 4 4 5 4 3 4 5 4 5 4 4 5 4 4 4 4 4 4 4 4 4 5 5 4 1 5 5 4 4 4 5 1 3 4 5 4 1 5 5 1 4 4 5 4 5 5 4 5 4 4 4 4 5 4 2 4 4 5 2 3 5 4 4 4 1 4 3 4 5 4 5 5 5 5 1 5 3 2 5 4 5 4 5 5 4 5 4 4 5 5 4 4 5 5 4 4 5 4 4 4 5 4 4 5 4 4 4 5 5 2 4 5 5 2 5 4 5 2 4 3 4 4 4 4 4 4 4 4 3 5 4 5 4 4 4 5 1 5 4 4 4 2 4 4 4 4 4 5 5 5 1 4 4 4 4 5 5 4 4 4 4 5 3 4 5 4 5 5 4 3 5 4 4 4 4 5 4 5 4 2 4 4 4 5 4 5 5 4 2 4 2 2 5 5 5 2",
"output": "55"
},
{
"input": "230\n4 4 5 5 5 5 5 4 4 4 5 5 5 4 5 4 4 4 5 5 4 5 4 4 5 4 5 4 5 4 4 4 5 4 5 5 5 4 4 4 4 4 4 4 4 4 5 4 5 5 5 5 4 4 5 4 5 5 5 5 5 4 4 4 4 5 5 4 4 5 5 5 4 4 4 5 4 4 4 5 4 4 5 5 5 5 4 4 5 5 4 4 4 4 4 5 5 5 2 4 4 4 5 5 1 5 5 4 5 4 4 4 5 4 5 5 5 4 4 5 5 4 5 5 4 4 4 4 4 4 4 4 5 5 4 5 4 5 4 5 5 4 4 4 4 5 4 4 4 4 5 5 5 4 4 4 5 4 5 4 5 5 4 4 4 5 5 4 4 4 5 5 5 4 4 5 5 5 4 4 4 5 4 5 5 4 5 4 5 5 5 5 4 5 4 4 4 4 5 4 4 4 4 4 4 4 5 4 4 4 4 3 5 4 4 4 4 5 5 5 4 5 5 4 5 4 5 4 5 5",
"output": "74"
},
{
"input": "240\n5 5 4 4 5 4 5 4 5 5 5 4 5 4 4 5 4 5 5 4 5 4 1 4 4 5 4 4 5 4 1 4 4 4 5 4 5 4 5 5 5 4 4 5 4 5 5 5 4 4 4 5 5 4 4 4 5 5 5 5 5 4 4 4 4 4 4 4 4 5 5 4 5 4 4 4 4 4 4 5 4 5 5 4 4 4 5 4 4 5 5 5 4 4 4 5 4 4 4 4 5 4 4 5 4 5 5 5 4 5 4 5 4 4 4 5 1 4 4 4 4 4 5 5 4 5 4 5 5 4 4 5 5 4 4 4 5 4 4 5 5 4 5 5 5 4 5 5 5 5 5 4 4 5 5 5 4 4 4 5 5 5 5 4 4 4 4 4 4 5 5 5 5 3 4 5 4 4 4 4 4 5 5 5 4 5 5 4 5 5 4 4 4 5 4 5 5 4 4 5 5 5 4 5 5 4 5 5 5 5 4 4 5 5 4 5 4 5 3 4 5 5 4 4 4 5 4 5 5 4 4 4 5 5 4 4 4 4 4 5",
"output": "76"
},
{
"input": "250\n4 4 2 5 1 5 5 4 5 4 4 4 4 4 4 5 5 4 4 5 4 5 1 5 5 4 1 5 5 4 5 5 4 4 4 4 5 4 4 5 5 5 5 5 4 5 4 5 5 4 5 4 4 4 4 4 4 5 5 4 5 5 1 4 4 4 5 1 5 3 4 5 4 4 4 4 4 5 5 4 4 4 4 4 5 4 5 5 5 4 4 5 4 4 4 5 5 5 5 4 5 4 5 4 5 5 5 5 4 4 4 4 5 5 5 5 5 5 4 4 3 4 4 5 5 3 5 4 4 4 4 4 4 5 5 5 4 5 4 4 4 2 4 5 5 5 5 5 5 5 4 5 5 4 5 3 5 4 4 5 5 5 5 4 3 5 5 1 5 5 5 5 4 4 5 4 4 4 4 5 4 5 4 4 4 5 5 3 4 5 5 4 4 4 5 4 4 4 4 4 4 4 5 5 4 4 5 4 5 4 4 5 4 4 5 5 5 4 5 4 1 4 4 5 4 4 4 4 5 2 4 4 5 5 5 4 5 4 5 5 5 4 4 4 4 4 4 1 5 5",
"output": "69"
},
{
"input": "7\n4 5 3 4 5 4 1",
"output": "1"
},
{
"input": "9\n4 5 4 3 3 3 4 4 4",
"output": "2"
},
{
"input": "10\n4 5 4 5 4 5 4 5 3 4",
"output": "2"
},
{
"input": "10\n4 3 4 5 4 5 4 5 4 3",
"output": "2"
},
{
"input": "6\n4 5 3 4 5 4",
"output": "1"
},
{
"input": "6\n3 3 3 4 5 5",
"output": "1"
},
{
"input": "11\n5 5 5 5 5 5 5 5 5 5 5",
"output": "3"
},
{
"input": "18\n4 5 4 3 3 3 2 2 2 4 4 4 1 1 1 4 5 4",
"output": "3"
},
{
"input": "8\n4 4 4 4 5 5 5 5",
"output": "2"
},
{
"input": "9\n5 5 5 4 4 4 3 4 4",
"output": "2"
}
] | 1,458,813,035 | 6,635 | Python 3 | WRONG_ANSWER | PRETESTS | 2 | 46 | 4,608,000 | n = int(input())
a = []
r = 0
a = input().split()
for i in range(n) :
a[i] = int(a[i])
scane = 0
while scane < ( n - 3 ) :
plus = 0
if a[scane] > 3 :
plus+=1
if a[scane+1] > 3 and a[scane+2] > 3 :
r+=1
plus+=1
scane+=(plus)
else :
scane+=1
print(r)
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Родители Васи хотят, чтобы он как можно лучше учился. Поэтому если он получает подряд три положительные оценки («четвёрки» или «пятёрки»), они дарят ему подарок. Соответственно, оценки «единица», «двойка» и «тройка» родители Васи считают плохими. Когда Вася получает подряд три хорошие оценки, ему сразу вручают подарок, но для того, чтобы получить ещё один подарок, ему вновь надо получить подряд ещё три хорошие оценки.
Например, если Вася получит подряд пять «четвёрок» оценок, а потом «двойку», то ему дадут только один подарок, а вот если бы «четвёрок» было уже шесть, то подарков было бы два.
За месяц Вася получил *n* оценок. Вам предстоит посчитать количество подарков, которые получил Вася. Оценки будут даны именно в том порядке, в котором Вася их получал.
Input Specification:
В первой строке входных данных следует целое положительное число *n* (3<=≤<=*n*<=≤<=1000) — количество оценок, полученных Васей.
Во второй строке входных данных следует последовательность из *n* чисел *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=5) — оценки, полученные Васей. Оценки заданы в том порядке, в котором Вася их получил.
Output Specification:
Выведите одно целое число — количество подарков, полученных Васей.
Demo Input:
['6\n4 5 4 5 4 4\n', '14\n1 5 4 5 2 4 4 5 5 4 3 4 5 5\n']
Demo Output:
['2\n', '3\n']
Note:
В первом примере Вася получит два подарка — за первые три положительные оценки и за следующую тройку положительных оценок соответственно. | ```python
n = int(input())
a = []
r = 0
a = input().split()
for i in range(n) :
a[i] = int(a[i])
scane = 0
while scane < ( n - 3 ) :
plus = 0
if a[scane] > 3 :
plus+=1
if a[scane+1] > 3 and a[scane+2] > 3 :
r+=1
plus+=1
scane+=(plus)
else :
scane+=1
print(r)
``` | 0 |
|
821 | A | Okabe and Future Gadget Laboratory | PROGRAMMING | 800 | [
"implementation"
] | null | null | Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column.
Help Okabe determine whether a given lab is good! | The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab.
The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105). | Print "Yes" if the given lab is good and "No" otherwise.
You can output each letter in upper or lower case. | [
"3\n1 1 2\n2 3 1\n6 4 1\n",
"3\n1 5 2\n1 1 1\n1 2 3\n"
] | [
"Yes\n",
"No\n"
] | In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes".
In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No". | 500 | [
{
"input": "3\n1 1 2\n2 3 1\n6 4 1",
"output": "Yes"
},
{
"input": "3\n1 5 2\n1 1 1\n1 2 3",
"output": "No"
},
{
"input": "1\n1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 11 1 2\n2 5 1 4\n3 9 4 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 7 1 1\n1 3 1 2\n2 6 3 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 12 1 2\n4 4 1 3\n5 10 6 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n5 11 6 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n7 11 6 1",
"output": "No"
},
{
"input": "4\n1 1 1 1\n1 14 1 6\n4 5 1 5\n3 8 2 1",
"output": "Yes"
},
{
"input": "10\n3 2 6 5 1 2 1 1 2 1\n1 2 2 3 1 4 1 1 1 1\n1 1 3 1 2 2 2 1 1 1\n1 3 1 2 1 2 1 1 1 1\n12 1 4 3 3 1 1 1 2 1\n8 1 1 1 1 3 6 5 1 3\n1 1 1 2 4 1 3 2 1 1\n1 1 1 1 1 1 1 2 1 1\n1 2 1 1 1 1 1 1 1 1\n2 1 1 1 1 1 1 1 1 2",
"output": "Yes"
},
{
"input": "4\n1 2 3 5\n1 1 1 1\n1 1 1 1\n1 1 1 1",
"output": "No"
},
{
"input": "1\n2",
"output": "No"
},
{
"input": "3\n1 1 4\n1 1 2\n1 1 2",
"output": "No"
},
{
"input": "1\n5",
"output": "No"
},
{
"input": "3\n1 2 1\n2 2 3\n1 3 1",
"output": "No"
},
{
"input": "3\n2 1 1\n2 1 1\n2 1 1",
"output": "No"
},
{
"input": "1\n60000",
"output": "No"
}
] | 1,498,443,798 | 2,147,483,647 | Python 3 | OK | TESTS | 31 | 967 | 5,529,600 | # Time : 2017-6-26 10:30
# Auther : Anjone
# URL : http://codeforces.com/contest/821/problem/A
n = int(input())
arr = [ list(map(int,input().split())) for i in range(n)]
for i in range(n):
for j in range(n):
if( arr[i][j] != 1):
cnt = 0
for k in range(n):
for l in range(n):
if(arr[i][k] + arr[l][j] == arr[i][j]):
cnt += 1
if(cnt == 0):
print("No")
exit(0)
print ("Yes") | Title: Okabe and Future Gadget Laboratory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column.
Help Okabe determine whether a given lab is good!
Input Specification:
The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab.
The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105).
Output Specification:
Print "Yes" if the given lab is good and "No" otherwise.
You can output each letter in upper or lower case.
Demo Input:
['3\n1 1 2\n2 3 1\n6 4 1\n', '3\n1 5 2\n1 1 1\n1 2 3\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes".
In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No". | ```python
# Time : 2017-6-26 10:30
# Auther : Anjone
# URL : http://codeforces.com/contest/821/problem/A
n = int(input())
arr = [ list(map(int,input().split())) for i in range(n)]
for i in range(n):
for j in range(n):
if( arr[i][j] != 1):
cnt = 0
for k in range(n):
for l in range(n):
if(arr[i][k] + arr[l][j] == arr[i][j]):
cnt += 1
if(cnt == 0):
print("No")
exit(0)
print ("Yes")
``` | 3 |
|
387 | C | George and Number | PROGRAMMING | 1,700 | [
"greedy",
"implementation"
] | null | null | George is a cat, so he really likes to play. Most of all he likes to play with his array of positive integers *b*. During the game, George modifies the array by using special changes. Let's mark George's current array as *b*1,<=*b*2,<=...,<=*b*|*b*| (record |*b*| denotes the current length of the array). Then one change is a sequence of actions:
- Choose two distinct indexes *i* and *j* (1<=≤<=*i*,<=*j*<=≤<=|*b*|; *i*<=≠<=*j*), such that *b**i*<=≥<=*b**j*. - Get number *v*<==<=*concat*(*b**i*,<=*b**j*), where *concat*(*x*,<=*y*) is a number obtained by adding number *y* to the end of the decimal record of number *x*. For example, *concat*(500,<=10)<==<=50010, *concat*(2,<=2)<==<=22. - Add number *v* to the end of the array. The length of the array will increase by one. - Remove from the array numbers with indexes *i* and *j*. The length of the array will decrease by two, and elements of the array will become re-numbered from 1 to current length of the array.
George played for a long time with his array *b* and received from array *b* an array consisting of exactly one number *p*. Now George wants to know: what is the maximum number of elements array *b* could contain originally? Help him find this number. Note that originally the array could contain only positive integers. | The first line of the input contains a single integer *p* (1<=≤<=*p*<=<<=10100000). It is guaranteed that number *p* doesn't contain any leading zeroes. | Print an integer — the maximum number of elements array *b* could contain originally. | [
"9555\n",
"10000000005\n",
"800101\n",
"45\n",
"1000000000000001223300003342220044555\n",
"19992000\n",
"310200\n"
] | [
"4",
"2",
"3",
"1",
"17",
"1",
"2"
] | Let's consider the test examples:
- Originally array *b* can be equal to {5, 9, 5, 5}. The sequence of George's changes could have been: {5, 9, 5, 5} → {5, 5, 95} → {95, 55} → {9555}. - Originally array *b* could be equal to {1000000000, 5}. Please note that the array *b* cannot contain zeros. - Originally array *b* could be equal to {800, 10, 1}. - Originally array *b* could be equal to {45}. It cannot be equal to {4, 5}, because George can get only array {54} from this array in one operation.
Note that the numbers can be very large. | 1,500 | [
{
"input": "9555",
"output": "4"
},
{
"input": "10000000005",
"output": "2"
},
{
"input": "800101",
"output": "3"
},
{
"input": "45",
"output": "1"
},
{
"input": "1000000000000001223300003342220044555",
"output": "17"
},
{
"input": "19992000",
"output": "1"
},
{
"input": "310200",
"output": "2"
},
{
"input": "63100605000394089000505000600600062000170273350000",
"output": "21"
},
{
"input": "20900000000090009000070069000026000000000000020008",
"output": "10"
},
{
"input": "60000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "7",
"output": "1"
},
{
"input": "6944262915652659458125599978116114458736683259866511789545994938161622536342972115877623999684282136",
"output": "99"
},
{
"input": "45000",
"output": "1"
},
{
"input": "10",
"output": "1"
},
{
"input": "1",
"output": "1"
},
{
"input": "456",
"output": "2"
},
{
"input": "542",
"output": "3"
},
{
"input": "54000",
"output": "1"
},
{
"input": "999",
"output": "3"
},
{
"input": "11",
"output": "2"
},
{
"input": "11001000",
"output": "2"
},
{
"input": "10001000",
"output": "2"
},
{
"input": "112000",
"output": "1"
},
{
"input": "1111200",
"output": "5"
},
{
"input": "10000000000000000000000000000000000000400500000000000000000000000000000000030020010300000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000500000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "2"
},
{
"input": "110003000054",
"output": "3"
}
] | 1,545,669,963 | 2,147,483,647 | Python 3 | OK | TESTS | 57 | 171 | 204,800 | p = input().strip()
n = len(p)
j = n - 1
ans = 0
while(j >= 0):
k = j
while p[k] == '0':
k -= 1
ln = j - k + 1
if ln > k:
ans += 1
j = -1
elif ln == k:
if (p[0] >= p[k]):
j = k - 1
else:
j = -1
ans += 1
else:
ans += 1
j = k - 1
print(ans)
| Title: George and Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George is a cat, so he really likes to play. Most of all he likes to play with his array of positive integers *b*. During the game, George modifies the array by using special changes. Let's mark George's current array as *b*1,<=*b*2,<=...,<=*b*|*b*| (record |*b*| denotes the current length of the array). Then one change is a sequence of actions:
- Choose two distinct indexes *i* and *j* (1<=≤<=*i*,<=*j*<=≤<=|*b*|; *i*<=≠<=*j*), such that *b**i*<=≥<=*b**j*. - Get number *v*<==<=*concat*(*b**i*,<=*b**j*), where *concat*(*x*,<=*y*) is a number obtained by adding number *y* to the end of the decimal record of number *x*. For example, *concat*(500,<=10)<==<=50010, *concat*(2,<=2)<==<=22. - Add number *v* to the end of the array. The length of the array will increase by one. - Remove from the array numbers with indexes *i* and *j*. The length of the array will decrease by two, and elements of the array will become re-numbered from 1 to current length of the array.
George played for a long time with his array *b* and received from array *b* an array consisting of exactly one number *p*. Now George wants to know: what is the maximum number of elements array *b* could contain originally? Help him find this number. Note that originally the array could contain only positive integers.
Input Specification:
The first line of the input contains a single integer *p* (1<=≤<=*p*<=<<=10100000). It is guaranteed that number *p* doesn't contain any leading zeroes.
Output Specification:
Print an integer — the maximum number of elements array *b* could contain originally.
Demo Input:
['9555\n', '10000000005\n', '800101\n', '45\n', '1000000000000001223300003342220044555\n', '19992000\n', '310200\n']
Demo Output:
['4', '2', '3', '1', '17', '1', '2']
Note:
Let's consider the test examples:
- Originally array *b* can be equal to {5, 9, 5, 5}. The sequence of George's changes could have been: {5, 9, 5, 5} → {5, 5, 95} → {95, 55} → {9555}. - Originally array *b* could be equal to {1000000000, 5}. Please note that the array *b* cannot contain zeros. - Originally array *b* could be equal to {800, 10, 1}. - Originally array *b* could be equal to {45}. It cannot be equal to {4, 5}, because George can get only array {54} from this array in one operation.
Note that the numbers can be very large. | ```python
p = input().strip()
n = len(p)
j = n - 1
ans = 0
while(j >= 0):
k = j
while p[k] == '0':
k -= 1
ln = j - k + 1
if ln > k:
ans += 1
j = -1
elif ln == k:
if (p[0] >= p[k]):
j = k - 1
else:
j = -1
ans += 1
else:
ans += 1
j = k - 1
print(ans)
``` | 3 |
|
275 | A | Lights Out | PROGRAMMING | 900 | [
"implementation"
] | null | null | Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light. | The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed. | Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0". | [
"1 0 0\n0 0 0\n0 0 1\n",
"1 0 1\n8 8 8\n2 0 3\n"
] | [
"001\n010\n100\n",
"010\n011\n100\n"
] | none | 500 | [
{
"input": "1 0 0\n0 0 0\n0 0 1",
"output": "001\n010\n100"
},
{
"input": "1 0 1\n8 8 8\n2 0 3",
"output": "010\n011\n100"
},
{
"input": "13 85 77\n25 50 45\n65 79 9",
"output": "000\n010\n000"
},
{
"input": "96 95 5\n8 84 74\n67 31 61",
"output": "011\n011\n101"
},
{
"input": "24 54 37\n60 63 6\n1 84 26",
"output": "110\n101\n011"
},
{
"input": "23 10 40\n15 6 40\n92 80 77",
"output": "101\n100\n000"
},
{
"input": "62 74 80\n95 74 93\n2 47 95",
"output": "010\n001\n110"
},
{
"input": "80 83 48\n26 0 66\n47 76 37",
"output": "000\n000\n010"
},
{
"input": "32 15 65\n7 54 36\n5 51 3",
"output": "111\n101\n001"
},
{
"input": "22 97 12\n71 8 24\n100 21 64",
"output": "100\n001\n100"
},
{
"input": "46 37 13\n87 0 50\n90 8 55",
"output": "111\n011\n000"
},
{
"input": "57 43 58\n20 82 83\n66 16 52",
"output": "111\n010\n110"
},
{
"input": "45 56 93\n47 51 59\n18 51 63",
"output": "101\n011\n100"
},
{
"input": "47 66 67\n14 1 37\n27 81 69",
"output": "001\n001\n110"
},
{
"input": "26 69 69\n85 18 23\n14 22 74",
"output": "110\n001\n010"
},
{
"input": "10 70 65\n94 27 25\n74 66 30",
"output": "111\n010\n100"
},
{
"input": "97 1 74\n15 99 1\n88 68 86",
"output": "001\n011\n000"
},
{
"input": "36 48 42\n45 41 66\n26 64 1",
"output": "001\n111\n010"
},
{
"input": "52 81 97\n29 77 71\n66 11 2",
"output": "100\n100\n111"
},
{
"input": "18 66 33\n19 49 49\n48 46 26",
"output": "011\n100\n000"
},
{
"input": "68 79 52\n51 39 100\n29 14 26",
"output": "110\n000\n111"
},
{
"input": "91 69 77\n91 26 64\n91 88 57",
"output": "001\n011\n110"
},
{
"input": "16 69 64\n48 21 80\n81 51 51",
"output": "010\n101\n111"
},
{
"input": "96 14 2\n100 18 12\n65 34 89",
"output": "111\n010\n010"
},
{
"input": "93 95 90\n8 59 42\n53 13 19",
"output": "100\n001\n111"
},
{
"input": "71 84 18\n100 19 67\n9 76 15",
"output": "010\n010\n001"
},
{
"input": "38 93 85\n21 88 64\n4 96 25",
"output": "111\n011\n000"
},
{
"input": "75 20 20\n60 5 78\n77 4 69",
"output": "011\n001\n000"
},
{
"input": "65 70 96\n19 6 83\n33 37 82",
"output": "100\n000\n011"
},
{
"input": "11 13 60\n17 13 46\n42 21 39",
"output": "000\n011\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 0",
"output": "111\n111\n111"
},
{
"input": "0 0 0\n0 1 0\n0 0 0",
"output": "101\n000\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 1",
"output": "111\n110\n100"
}
] | 1,662,043,138 | 2,147,483,647 | Python 3 | OK | TESTS | 33 | 46 | 0 | a,b,c = map(int, input().split())
d,e,f = map(int, input().split())
g,h,i = map(int, input().split())
a1, b1, c1, d1, e1, f1, g1, h1, i1= 1,1,1,1,1,1,1,1,1
def lightControl(x):
if x == 1:
return x-1
else:
return x + 1
if a>0 and a%2 == 1:
a1 = lightControl(a1)
b1 = lightControl(b1)
d1 = lightControl(d1)
if b>0 and b%2 == 1:
a1 = lightControl(a1)
b1 = lightControl(b1)
c1 = lightControl(c1)
e1 = lightControl(e1)
if c>0 and c%2 == 1:
b1 = lightControl(b1)
c1 = lightControl(c1)
f1 = lightControl(f1)
if d%2 == 1 and d>0:
a1 = lightControl(a1)
d1 = lightControl(d1)
e1 = lightControl(e1)
g1 = lightControl(g1)
if e%2 == 1 and e>0:
b1 = lightControl(b1)
d1 = lightControl(d1)
e1 = lightControl(e1)
f1 = lightControl(f1)
h1 = lightControl(h1)
if f%2 == 1 and f>0:
c1 = lightControl(c1)
e1 = lightControl(e1)
f1 = lightControl(f1)
i1 = lightControl(i1)
if g%2 == 1 and g>0:
d1 = lightControl(d1)
g1 = lightControl(g1)
h1 = lightControl(h1)
if h%2 == 1 and h>0:
e1 = lightControl(e1)
g1 = lightControl(g1)
h1 = lightControl(h1)
i1 = lightControl(i1)
if i%2 == 1 and i>0:
f1 = lightControl(f1)
h1 = lightControl(h1)
i1 = lightControl(i1)
lst1 = []
lst1.append(str(a1))
lst1.append(str(b1))
lst1.append(str(c1))
lst2 = []
lst2.append(str(d1))
lst2.append(str(e1))
lst2.append(str(f1))
lst3 = []
lst3.append(str(g1))
lst3.append(str(h1))
lst3.append(str(i1))
print(''.join(lst1))
print(''.join(lst2))
print(''.join(lst3)) | Title: Lights Out
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
Input Specification:
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
Output Specification:
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
Demo Input:
['1 0 0\n0 0 0\n0 0 1\n', '1 0 1\n8 8 8\n2 0 3\n']
Demo Output:
['001\n010\n100\n', '010\n011\n100\n']
Note:
none | ```python
a,b,c = map(int, input().split())
d,e,f = map(int, input().split())
g,h,i = map(int, input().split())
a1, b1, c1, d1, e1, f1, g1, h1, i1= 1,1,1,1,1,1,1,1,1
def lightControl(x):
if x == 1:
return x-1
else:
return x + 1
if a>0 and a%2 == 1:
a1 = lightControl(a1)
b1 = lightControl(b1)
d1 = lightControl(d1)
if b>0 and b%2 == 1:
a1 = lightControl(a1)
b1 = lightControl(b1)
c1 = lightControl(c1)
e1 = lightControl(e1)
if c>0 and c%2 == 1:
b1 = lightControl(b1)
c1 = lightControl(c1)
f1 = lightControl(f1)
if d%2 == 1 and d>0:
a1 = lightControl(a1)
d1 = lightControl(d1)
e1 = lightControl(e1)
g1 = lightControl(g1)
if e%2 == 1 and e>0:
b1 = lightControl(b1)
d1 = lightControl(d1)
e1 = lightControl(e1)
f1 = lightControl(f1)
h1 = lightControl(h1)
if f%2 == 1 and f>0:
c1 = lightControl(c1)
e1 = lightControl(e1)
f1 = lightControl(f1)
i1 = lightControl(i1)
if g%2 == 1 and g>0:
d1 = lightControl(d1)
g1 = lightControl(g1)
h1 = lightControl(h1)
if h%2 == 1 and h>0:
e1 = lightControl(e1)
g1 = lightControl(g1)
h1 = lightControl(h1)
i1 = lightControl(i1)
if i%2 == 1 and i>0:
f1 = lightControl(f1)
h1 = lightControl(h1)
i1 = lightControl(i1)
lst1 = []
lst1.append(str(a1))
lst1.append(str(b1))
lst1.append(str(c1))
lst2 = []
lst2.append(str(d1))
lst2.append(str(e1))
lst2.append(str(f1))
lst3 = []
lst3.append(str(g1))
lst3.append(str(h1))
lst3.append(str(i1))
print(''.join(lst1))
print(''.join(lst2))
print(''.join(lst3))
``` | 3 |
|
180 | C | Letter | PROGRAMMING | 1,400 | [
"dp"
] | null | null | Patrick has just finished writing a message to his sweetheart Stacey when he noticed that the message didn't look fancy. Patrick was nervous while writing the message, so some of the letters there were lowercase and some of them were uppercase.
Patrick believes that a message is fancy if any uppercase letter stands to the left of any lowercase one. In other words, this rule describes the strings where first go zero or more uppercase letters, and then — zero or more lowercase letters.
To make the message fancy, Patrick can erase some letter and add the same letter in the same place in the opposite case (that is, he can replace an uppercase letter with the lowercase one and vice versa). Patrick got interested in the following question: what minimum number of actions do we need to make a message fancy? Changing a letter's case in the message counts as one action. Patrick cannot perform any other actions. | The only line of the input contains a non-empty string consisting of uppercase and lowercase letters. The string's length does not exceed 105. | Print a single number — the least number of actions needed to make the message fancy. | [
"PRuvetSTAaYA\n",
"OYPROSTIYAOPECHATALSYAPRIVETSTASYA\n",
"helloworld\n"
] | [
"5\n",
"0\n",
"0\n"
] | none | 0 | [
{
"input": "PRuvetSTAaYA",
"output": "5"
},
{
"input": "OYPROSTIYAOPECHATALSYAPRIVETSTASYA",
"output": "0"
},
{
"input": "helloworld",
"output": "0"
},
{
"input": "P",
"output": "0"
},
{
"input": "t",
"output": "0"
},
{
"input": "XdJ",
"output": "1"
},
{
"input": "FSFlNEelYY",
"output": "3"
},
{
"input": "lgtyasficu",
"output": "0"
},
{
"input": "WYKUDTDDBT",
"output": "0"
},
{
"input": "yysxwlyqboatikfnpxczmpijziiojbvadlfozjqldssffcxdegyxfrvohoxvgsrvlzjlkcuffoeisrpvagxtbkapkpzcafadzzjd",
"output": "0"
},
{
"input": "mnAkOBuKxaiJwXhKnlcCvjxYXGXDoIqfUYkiLrdSYWhMemgWFzsgpoKOtHqooxbLYFuABWQSXuHdbyPVWyrkeEfqOsnEBikiqhfu",
"output": "43"
},
{
"input": "MMVESdOCALHJCTBTUWWQRGUUVTTTABKKAAdIINAdKLRLLVLODHDXDPMcQfUhPNHFBJSDRGsHZNORSCPNvKOOIuZnZAmTPUCoPNlR",
"output": "13"
},
{
"input": "MMbJIBhgFXPVpdQHLkWJkAHFIfJSpITTCRzRCzvRPRYECCheOknfINZWuKATDBOrEVKTcWXiYPjtzQMGUSGPNTMCUrvYCSWQHqAi",
"output": "27"
},
{
"input": "ZnqXEBOABXVbHRFFqDLWpWBBLqZIagmbRAYMDKJAYyFQXnPYwvDyRXKHLQnMLHGEOnRKmXtGqyQkoBCSmgKPcEIEugwJyxDOtTVn",
"output": "31"
}
] | 1,576,586,385 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 12 | 186 | 0 | s = input()
l = 0
b = 0
fl = False
for i in s:
if i.islower():
fl = True
if fl:
if i.isupper():
b += 1
else:
l += 1
if b == 0:
print(0)
else:
lb = l > b
c = 0
fl = False
for i in s:
if lb:
if fl and i.isupper():
c += 1
if i.islower():
fl = True
else:
if i.islower():
c += 1
print(c) | Title: Letter
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Patrick has just finished writing a message to his sweetheart Stacey when he noticed that the message didn't look fancy. Patrick was nervous while writing the message, so some of the letters there were lowercase and some of them were uppercase.
Patrick believes that a message is fancy if any uppercase letter stands to the left of any lowercase one. In other words, this rule describes the strings where first go zero or more uppercase letters, and then — zero or more lowercase letters.
To make the message fancy, Patrick can erase some letter and add the same letter in the same place in the opposite case (that is, he can replace an uppercase letter with the lowercase one and vice versa). Patrick got interested in the following question: what minimum number of actions do we need to make a message fancy? Changing a letter's case in the message counts as one action. Patrick cannot perform any other actions.
Input Specification:
The only line of the input contains a non-empty string consisting of uppercase and lowercase letters. The string's length does not exceed 105.
Output Specification:
Print a single number — the least number of actions needed to make the message fancy.
Demo Input:
['PRuvetSTAaYA\n', 'OYPROSTIYAOPECHATALSYAPRIVETSTASYA\n', 'helloworld\n']
Demo Output:
['5\n', '0\n', '0\n']
Note:
none | ```python
s = input()
l = 0
b = 0
fl = False
for i in s:
if i.islower():
fl = True
if fl:
if i.isupper():
b += 1
else:
l += 1
if b == 0:
print(0)
else:
lb = l > b
c = 0
fl = False
for i in s:
if lb:
if fl and i.isupper():
c += 1
if i.islower():
fl = True
else:
if i.islower():
c += 1
print(c)
``` | 0 |
|
81 | A | Plug-in | PROGRAMMING | 1,400 | [
"implementation"
] | A. Plug-in | 1 | 256 | Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result. | The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters. | Print the given string after it is processed. It is guaranteed that the result will contain at least one character. | [
"hhoowaaaareyyoouu\n",
"reallazy\n",
"abacabaabacabaa\n"
] | [
"wre",
"rezy",
"a"
] | none | 500 | [
{
"input": "hhoowaaaareyyoouu",
"output": "wre"
},
{
"input": "reallazy",
"output": "rezy"
},
{
"input": "abacabaabacabaa",
"output": "a"
},
{
"input": "xraccabccbry",
"output": "xy"
},
{
"input": "a",
"output": "a"
},
{
"input": "b",
"output": "b"
},
{
"input": "il",
"output": "il"
},
{
"input": "gfj",
"output": "gfj"
},
{
"input": "babbbbbababa",
"output": "babababa"
},
{
"input": "babbbbabbabbbababbabbbbbbabaabaababaaabbbbbabbbbaaaaabbaaabbaabaabbbbabbbababbabaaabbababaaababbbaaa",
"output": "babababababababababababa"
},
{
"input": "aab",
"output": "b"
},
{
"input": "abb",
"output": "a"
},
{
"input": "aba",
"output": "aba"
},
{
"input": "ab",
"output": "ab"
}
] | 1,618,504,029 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 218 | 2,867,200 | if __name__ == '__main__':
s, r = list(input()), []
for c in s:
if r and c == r[-1]:r.pop()
else:r.append(c)
print("".join(r)) | Title: Plug-in
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result.
Input Specification:
The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters.
Output Specification:
Print the given string after it is processed. It is guaranteed that the result will contain at least one character.
Demo Input:
['hhoowaaaareyyoouu\n', 'reallazy\n', 'abacabaabacabaa\n']
Demo Output:
['wre', 'rezy', 'a']
Note:
none | ```python
if __name__ == '__main__':
s, r = list(input()), []
for c in s:
if r and c == r[-1]:r.pop()
else:r.append(c)
print("".join(r))
``` | 3.885659 |
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,678,422,815 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 81 | 154 | 0 | #******************************
#import os
#import sys
from math import *
#import re
#import random
#sys.set_int_max_str_digits(int(1e9))
def solve():
a=[]
b=[]
c=[]
for i in range(int(input())):
#for _ in range(1):
#n = int(input())
p, q, r= [int(x) for x in input().split()]
a.append(p)
b.append(q)
c.append(r)
if(sum(a) == 0 and sum(b) == 0 and sum(c) == 0): print("YES");
else: print("NO")
solve() | Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
#******************************
#import os
#import sys
from math import *
#import re
#import random
#sys.set_int_max_str_digits(int(1e9))
def solve():
a=[]
b=[]
c=[]
for i in range(int(input())):
#for _ in range(1):
#n = int(input())
p, q, r= [int(x) for x in input().split()]
a.append(p)
b.append(q)
c.append(r)
if(sum(a) == 0 and sum(b) == 0 and sum(c) == 0): print("YES");
else: print("NO")
solve()
``` | 3.9615 |
591 | A | Wizards' Duel | PROGRAMMING | 900 | [
"implementation",
"math"
] | null | null | Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight. | The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively. | Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if . | [
"100\n50\n50\n",
"199\n60\n40\n"
] | [
"50\n",
"119.4\n"
] | In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor. | 500 | [
{
"input": "100\n50\n50",
"output": "50"
},
{
"input": "199\n60\n40",
"output": "119.4"
},
{
"input": "1\n1\n1",
"output": "0.5"
},
{
"input": "1\n1\n500",
"output": "0.001996007984"
},
{
"input": "1\n500\n1",
"output": "0.998003992"
},
{
"input": "1\n500\n500",
"output": "0.5"
},
{
"input": "1000\n1\n1",
"output": "500"
},
{
"input": "1000\n1\n500",
"output": "1.996007984"
},
{
"input": "1000\n500\n1",
"output": "998.003992"
},
{
"input": "1000\n500\n500",
"output": "500"
},
{
"input": "101\n11\n22",
"output": "33.66666667"
},
{
"input": "987\n1\n3",
"output": "246.75"
},
{
"input": "258\n25\n431",
"output": "14.14473684"
},
{
"input": "979\n39\n60",
"output": "385.6666667"
},
{
"input": "538\n479\n416",
"output": "287.9351955"
},
{
"input": "583\n112\n248",
"output": "181.3777778"
},
{
"input": "978\n467\n371",
"output": "545.0190931"
},
{
"input": "980\n322\n193",
"output": "612.7378641"
},
{
"input": "871\n401\n17",
"output": "835.576555"
},
{
"input": "349\n478\n378",
"output": "194.885514"
},
{
"input": "425\n458\n118",
"output": "337.9340278"
},
{
"input": "919\n323\n458",
"output": "380.0729834"
},
{
"input": "188\n59\n126",
"output": "59.95675676"
},
{
"input": "644\n428\n484",
"output": "302.2280702"
},
{
"input": "253\n80\n276",
"output": "56.85393258"
},
{
"input": "745\n152\n417",
"output": "199.0158172"
},
{
"input": "600\n221\n279",
"output": "265.2"
},
{
"input": "690\n499\n430",
"output": "370.6243272"
},
{
"input": "105\n68\n403",
"output": "15.15923567"
},
{
"input": "762\n462\n371",
"output": "422.6218487"
},
{
"input": "903\n460\n362",
"output": "505.3284672"
},
{
"input": "886\n235\n95",
"output": "630.9393939"
},
{
"input": "655\n203\n18",
"output": "601.6515837"
},
{
"input": "718\n29\n375",
"output": "51.53960396"
},
{
"input": "296\n467\n377",
"output": "163.7819905"
},
{
"input": "539\n61\n56",
"output": "281.017094"
},
{
"input": "133\n53\n124",
"output": "39.82485876"
},
{
"input": "998\n224\n65",
"output": "773.5363322"
},
{
"input": "961\n173\n47",
"output": "755.6954545"
},
{
"input": "285\n468\n62",
"output": "251.6603774"
},
{
"input": "496\n326\n429",
"output": "214.1668874"
},
{
"input": "627\n150\n285",
"output": "216.2068966"
},
{
"input": "961\n443\n50",
"output": "863.535497"
},
{
"input": "623\n422\n217",
"output": "411.4334898"
},
{
"input": "678\n295\n29",
"output": "617.3148148"
}
] | 1,627,889,859 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 77 | 20,172,800 | n = int(input())
p = int(input())
q = int(input())
print(n*max(p,q)/100) | Title: Wizards' Duel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
Input Specification:
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Output Specification:
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['100\n50\n50\n', '199\n60\n40\n']
Demo Output:
['50\n', '119.4\n']
Note:
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor. | ```python
n = int(input())
p = int(input())
q = int(input())
print(n*max(p,q)/100)
``` | 0 |
|
144 | A | Arrival of the General | PROGRAMMING | 800 | [
"implementation"
] | null | null | A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct. | The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different. | Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like. | [
"4\n33 44 11 22\n",
"7\n10 10 58 31 63 40 76\n"
] | [
"2\n",
"10\n"
] | In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10) | 500 | [
{
"input": "4\n33 44 11 22",
"output": "2"
},
{
"input": "7\n10 10 58 31 63 40 76",
"output": "10"
},
{
"input": "2\n88 89",
"output": "1"
},
{
"input": "5\n100 95 100 100 88",
"output": "0"
},
{
"input": "7\n48 48 48 48 45 45 45",
"output": "0"
},
{
"input": "10\n68 47 67 29 63 71 71 65 54 56",
"output": "10"
},
{
"input": "15\n77 68 96 60 92 75 61 60 66 79 80 65 60 95 92",
"output": "4"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "20\n30 30 30 14 30 14 30 30 30 14 30 14 14 30 14 14 30 14 14 14",
"output": "0"
},
{
"input": "35\n37 41 46 39 47 39 44 47 44 42 44 43 47 39 46 39 38 42 39 37 40 44 41 42 41 42 39 42 36 36 42 36 42 42 42",
"output": "7"
},
{
"input": "40\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 98 99 99 99 99 99 99 99 99 100 99 99 99 99 99 99",
"output": "47"
},
{
"input": "50\n48 52 44 54 53 56 62 49 39 41 53 39 40 64 53 50 62 48 40 52 51 48 40 52 61 62 62 61 48 64 55 57 56 40 48 58 41 60 60 56 64 50 64 45 48 45 46 63 59 57",
"output": "50"
},
{
"input": "57\n7 24 17 19 6 19 10 11 12 22 14 5 5 11 13 10 24 19 24 24 24 11 21 20 4 14 24 24 18 13 24 3 20 3 3 3 3 9 3 9 22 22 16 3 3 3 15 11 3 3 8 17 10 13 3 14 13",
"output": "3"
},
{
"input": "65\n58 50 35 44 35 37 36 58 38 36 58 56 56 49 48 56 58 43 40 44 52 44 58 58 57 50 43 35 55 39 38 49 53 56 50 42 41 56 34 57 49 38 34 51 56 38 58 40 53 46 48 34 38 43 49 49 58 56 41 43 44 34 38 48 36",
"output": "3"
},
{
"input": "69\n70 48 49 48 49 71 48 53 55 69 48 53 54 58 53 63 48 48 69 67 72 75 71 75 74 74 57 63 65 60 48 48 65 48 48 51 50 49 62 53 76 68 76 56 76 76 64 76 76 57 61 76 73 51 59 76 65 50 69 50 76 67 76 63 62 74 74 58 73",
"output": "73"
},
{
"input": "75\n70 65 64 71 71 64 71 64 68 71 65 64 65 68 71 66 66 69 68 63 69 65 71 69 68 68 71 67 71 65 65 65 71 71 65 69 63 66 62 67 64 63 62 64 67 65 62 69 62 64 69 62 67 64 67 70 64 63 64 64 69 62 62 64 70 62 62 68 67 69 62 64 66 70 68",
"output": "7"
},
{
"input": "84\n92 95 84 85 94 80 90 86 80 92 95 84 86 83 86 83 93 91 95 92 84 88 82 84 84 84 80 94 93 80 94 80 95 83 85 80 95 95 80 84 86 92 83 81 90 87 81 89 92 93 80 87 90 85 93 85 93 94 93 89 94 83 93 91 80 83 90 94 95 80 95 92 85 84 93 94 94 82 91 95 95 89 85 94",
"output": "15"
},
{
"input": "90\n86 87 72 77 82 71 75 78 61 67 79 90 64 94 94 74 85 87 73 76 71 71 60 69 77 73 76 80 82 57 62 57 57 83 76 72 75 87 72 94 77 85 59 82 86 69 62 80 95 73 83 94 79 85 91 68 85 74 93 95 68 75 89 93 83 78 95 78 83 77 81 85 66 92 63 65 75 78 67 91 77 74 59 86 77 76 90 67 70 64",
"output": "104"
},
{
"input": "91\n94 98 96 94 95 98 98 95 98 94 94 98 95 95 99 97 97 94 95 98 94 98 96 98 96 98 97 95 94 94 94 97 94 96 98 98 98 94 96 95 94 95 97 97 97 98 94 98 96 95 98 96 96 98 94 97 96 98 97 95 97 98 94 95 94 94 97 94 96 97 97 93 94 95 95 94 96 98 97 96 94 98 98 96 96 96 96 96 94 96 97",
"output": "33"
},
{
"input": "92\n44 28 32 29 41 41 36 39 40 39 41 35 41 28 35 27 41 34 28 38 43 43 41 38 27 26 28 36 30 29 39 32 35 35 32 30 39 30 37 27 41 41 28 30 43 31 35 33 36 28 44 40 41 35 31 42 37 38 37 34 39 40 27 40 33 33 44 43 34 33 34 34 35 38 38 37 30 39 35 41 45 42 41 32 33 33 31 30 43 41 43 43",
"output": "145"
},
{
"input": "93\n46 32 52 36 39 30 57 63 63 30 32 44 27 59 46 38 40 45 44 62 35 36 51 48 39 58 36 51 51 51 48 58 59 36 29 35 31 49 64 60 34 38 42 56 33 42 52 31 63 34 45 51 35 45 33 53 33 62 31 38 66 29 51 54 28 61 32 45 57 41 36 34 47 36 31 28 67 48 52 46 32 40 64 58 27 53 43 57 34 66 43 39 26",
"output": "76"
},
{
"input": "94\n56 55 54 31 32 42 46 29 24 54 40 40 20 45 35 56 32 33 51 39 26 56 21 56 51 27 29 39 56 52 54 43 43 55 48 51 44 49 52 49 23 19 19 28 20 26 45 33 35 51 42 36 25 25 38 23 21 35 54 50 41 20 37 28 42 20 22 43 37 34 55 21 24 38 19 41 45 34 19 33 44 54 38 31 23 53 35 32 47 40 39 31 20 34",
"output": "15"
},
{
"input": "95\n57 71 70 77 64 64 76 81 81 58 63 75 81 77 71 71 71 60 70 70 69 67 62 64 78 64 69 62 76 76 57 70 68 77 70 68 73 77 79 73 60 57 69 60 74 65 58 75 75 74 73 73 65 75 72 57 81 62 62 70 67 58 76 57 79 81 68 64 58 77 70 59 79 64 80 58 71 59 81 71 80 64 78 80 78 65 70 68 78 80 57 63 64 76 81",
"output": "11"
},
{
"input": "96\n96 95 95 95 96 97 95 97 96 95 98 96 97 95 98 96 98 96 98 96 98 95 96 95 95 95 97 97 95 95 98 98 95 96 96 95 97 96 98 96 95 97 97 95 97 97 95 94 96 96 97 96 97 97 96 94 94 97 95 95 95 96 95 96 95 97 97 95 97 96 95 94 97 97 97 96 97 95 96 94 94 95 97 94 94 97 97 97 95 97 97 95 94 96 95 95",
"output": "13"
},
{
"input": "97\n14 15 12 12 13 15 12 15 12 12 12 12 12 14 15 15 13 12 15 15 12 12 12 13 14 15 15 13 14 15 14 14 14 14 12 13 12 13 13 12 15 12 13 13 15 12 15 13 12 13 13 13 14 13 12 15 14 13 14 15 13 14 14 13 14 12 15 12 14 12 13 14 15 14 13 15 13 12 15 15 15 13 15 15 13 14 16 16 16 13 15 13 15 14 15 15 15",
"output": "104"
},
{
"input": "98\n37 69 35 70 58 69 36 47 41 63 60 54 49 35 55 50 35 53 52 43 35 41 40 49 38 35 48 70 42 35 35 65 56 54 44 59 59 48 51 49 59 67 35 60 69 35 58 50 35 44 48 69 41 58 44 45 35 47 70 61 49 47 37 39 35 51 44 70 72 65 36 41 63 63 48 66 45 50 50 71 37 52 72 67 72 39 72 39 36 64 48 72 69 49 45 72 72 67",
"output": "100"
},
{
"input": "99\n31 31 16 15 19 31 19 22 29 27 12 22 28 30 25 33 26 25 19 22 34 21 17 33 31 22 16 26 22 30 31 17 13 33 13 17 28 25 18 33 27 22 31 22 13 27 20 22 23 15 24 32 29 13 16 20 32 33 14 33 19 27 16 28 25 17 17 28 18 26 32 33 19 23 30 13 14 23 24 28 14 28 22 20 30 14 24 23 17 29 18 28 29 21 28 18 16 24 32",
"output": "107"
},
{
"input": "100\n37 54 39 29 32 49 21 13 34 21 16 42 34 27 16 26 7 34 51 9 11 27 16 40 36 7 48 52 30 42 42 52 51 11 32 26 6 7 28 54 48 51 6 54 42 20 51 48 46 4 4 31 47 6 9 16 8 23 36 50 49 30 47 37 45 24 48 26 8 50 18 24 27 13 39 7 37 34 5 43 42 19 34 23 52 38 35 6 29 11 53 49 21 29 36 22 45 33 51 22",
"output": "50"
},
{
"input": "100\n41 5 20 23 5 47 28 28 64 5 12 14 34 56 22 48 6 52 39 55 62 40 24 54 39 28 56 27 35 51 14 24 38 10 55 20 39 62 52 2 30 55 49 48 15 23 59 44 31 28 66 29 62 59 31 13 28 12 50 45 41 47 29 27 64 66 14 39 62 22 44 63 24 5 63 17 42 7 25 41 49 33 31 51 63 3 37 66 19 9 2 40 16 45 56 21 34 29 39 61",
"output": "59"
},
{
"input": "100\n66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95",
"output": "99"
},
{
"input": "100\n81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "2\n100 99",
"output": "0"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "197"
},
{
"input": "100\n87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87",
"output": "0"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 3 2",
"output": "2"
}
] | 1,698,604,076 | 2,147,483,647 | Python 3 | OK | TESTS | 39 | 62 | 0 | N = int(input())
järjend = list(map(int,input().split()))
pikk = max(järjend)
lühike = min(järjend)
pikka_asukoht = 0
for i in range(N):
if järjend[i] == pikk:
pikka_asukoht = i
break
lühikese_asukoht = 0
for i in range(N):
if järjend[i] == lühike:
lühikese_asukoht = i
kokku = ((N-1)-lühikese_asukoht) + pikka_asukoht
if pikka_asukoht > lühikese_asukoht:
kokku -= 1
print(kokku)
| Title: Arrival of the General
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
Input Specification:
The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
Output Specification:
Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like.
Demo Input:
['4\n33 44 11 22\n', '7\n10 10 58 31 63 40 76\n']
Demo Output:
['2\n', '10\n']
Note:
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10) | ```python
N = int(input())
järjend = list(map(int,input().split()))
pikk = max(järjend)
lühike = min(järjend)
pikka_asukoht = 0
for i in range(N):
if järjend[i] == pikk:
pikka_asukoht = i
break
lühikese_asukoht = 0
for i in range(N):
if järjend[i] == lühike:
lühikese_asukoht = i
kokku = ((N-1)-lühikese_asukoht) + pikka_asukoht
if pikka_asukoht > lühikese_asukoht:
kokku -= 1
print(kokku)
``` | 3 |
|
919 | B | Perfect Number | PROGRAMMING | 1,100 | [
"binary search",
"brute force",
"dp",
"implementation",
"number theory"
] | null | null | We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer. | A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$). | A single number, denoting the $k$-th smallest perfect integer. | [
"1\n",
"2\n"
] | [
"19\n",
"28\n"
] | The first perfect integer is $19$ and the second one is $28$. | 750 | [
{
"input": "1",
"output": "19"
},
{
"input": "2",
"output": "28"
},
{
"input": "13",
"output": "136"
},
{
"input": "101",
"output": "1432"
},
{
"input": "1023",
"output": "100270"
},
{
"input": "9999",
"output": "10800010"
},
{
"input": "10000",
"output": "10800100"
},
{
"input": "2333",
"output": "310060"
},
{
"input": "9139",
"output": "10134010"
},
{
"input": "9859",
"output": "10422001"
},
{
"input": "5987",
"output": "2221201"
},
{
"input": "3",
"output": "37"
},
{
"input": "4",
"output": "46"
},
{
"input": "5",
"output": "55"
},
{
"input": "7",
"output": "73"
},
{
"input": "9",
"output": "91"
},
{
"input": "10",
"output": "109"
},
{
"input": "15",
"output": "154"
},
{
"input": "51",
"output": "613"
},
{
"input": "99",
"output": "1414"
},
{
"input": "138",
"output": "2224"
},
{
"input": "233",
"output": "5050"
},
{
"input": "666",
"output": "27100"
},
{
"input": "1234",
"output": "110206"
},
{
"input": "3567",
"output": "1033003"
},
{
"input": "4445",
"output": "1221301"
},
{
"input": "5689",
"output": "2114002"
},
{
"input": "6666",
"output": "3102004"
},
{
"input": "7777",
"output": "5300200"
},
{
"input": "8888",
"output": "10110061"
},
{
"input": "9411",
"output": "10214200"
},
{
"input": "5539",
"output": "2101114"
},
{
"input": "6259",
"output": "2511100"
},
{
"input": "2387",
"output": "312220"
},
{
"input": "8515",
"output": "10030114"
}
] | 1,696,700,817 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 4 | 31 | 0 | res = []
for number in range(1, 10000):
if sum([int(i) for i in str(number)]) == 10:
res.append(number)
print(res[int(input()) - 1]) | Title: Perfect Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer.
Input Specification:
A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$).
Output Specification:
A single number, denoting the $k$-th smallest perfect integer.
Demo Input:
['1\n', '2\n']
Demo Output:
['19\n', '28\n']
Note:
The first perfect integer is $19$ and the second one is $28$. | ```python
res = []
for number in range(1, 10000):
if sum([int(i) for i in str(number)]) == 10:
res.append(number)
print(res[int(input()) - 1])
``` | -1 |
|
784 | F | Crunching Numbers Just for You | PROGRAMMING | 1,900 | [
"*special",
"implementation"
] | null | null | You are developing a new feature for the website which sells airline tickets: being able to sort tickets by price! You have already extracted the tickets' prices, so there's just the last step to be done...
You are given an array of integers. Sort it in non-descending order. | The input consists of a single line of space-separated integers. The first number is *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The following *n* numbers are the elements of the array (1<=≤<=*a**i*<=≤<=100). | Output space-separated elements of the sorted array. | [
"3 3 1 2\n"
] | [
"1 2 3 \n"
] | Remember, this is a very important feature, and you have to make sure the customers appreciate it! | 0 | [
{
"input": "3 3 1 2",
"output": "1 2 3 "
},
{
"input": "10 54 100 27 1 33 27 80 49 27 6",
"output": "1 6 27 27 27 33 49 54 80 100 "
}
] | 1,617,051,921 | 5,121 | Python 3 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | print('1 2 3') | Title: Crunching Numbers Just for You
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are developing a new feature for the website which sells airline tickets: being able to sort tickets by price! You have already extracted the tickets' prices, so there's just the last step to be done...
You are given an array of integers. Sort it in non-descending order.
Input Specification:
The input consists of a single line of space-separated integers. The first number is *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The following *n* numbers are the elements of the array (1<=≤<=*a**i*<=≤<=100).
Output Specification:
Output space-separated elements of the sorted array.
Demo Input:
['3 3 1 2\n']
Demo Output:
['1 2 3 \n']
Note:
Remember, this is a very important feature, and you have to make sure the customers appreciate it! | ```python
print('1 2 3')
``` | 0 |
|
228 | A | Is your horseshoe on the other hoof? | PROGRAMMING | 800 | [
"implementation"
] | null | null | Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. | The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers. | Print a single integer — the minimum number of horseshoes Valera needs to buy. | [
"1 7 3 3\n",
"7 7 7 7\n"
] | [
"1\n",
"3\n"
] | none | 500 | [
{
"input": "1 7 3 3",
"output": "1"
},
{
"input": "7 7 7 7",
"output": "3"
},
{
"input": "81170865 673572653 756938629 995577259",
"output": "0"
},
{
"input": "3491663 217797045 522540872 715355328",
"output": "0"
},
{
"input": "251590420 586975278 916631563 586975278",
"output": "1"
},
{
"input": "259504825 377489979 588153796 377489979",
"output": "1"
},
{
"input": "652588203 931100304 931100304 652588203",
"output": "2"
},
{
"input": "391958720 651507265 391958720 651507265",
"output": "2"
},
{
"input": "90793237 90793237 90793237 90793237",
"output": "3"
},
{
"input": "551651653 551651653 551651653 551651653",
"output": "3"
},
{
"input": "156630260 609654355 668943582 973622757",
"output": "0"
},
{
"input": "17061017 110313588 434481173 796661222",
"output": "0"
},
{
"input": "24975422 256716298 337790533 690960249",
"output": "0"
},
{
"input": "255635360 732742923 798648949 883146723",
"output": "0"
},
{
"input": "133315691 265159773 734556507 265159773",
"output": "1"
},
{
"input": "28442865 741657755 978106882 978106882",
"output": "1"
},
{
"input": "131245479 174845575 497483467 131245479",
"output": "1"
},
{
"input": "139159884 616215581 958341883 616215581",
"output": "1"
},
{
"input": "147784432 947653080 947653080 947653080",
"output": "2"
},
{
"input": "94055790 756126496 756126496 94055790",
"output": "2"
},
{
"input": "240458500 511952208 240458500 511952208",
"output": "2"
},
{
"input": "681828506 972810624 972810624 681828506",
"output": "2"
},
{
"input": "454961014 454961014 454961014 454961014",
"output": "3"
},
{
"input": "915819430 915819430 915819430 915819430",
"output": "3"
},
{
"input": "671645142 671645142 671645142 671645142",
"output": "3"
},
{
"input": "132503558 132503558 132503558 132503558",
"output": "3"
},
{
"input": "5 5 999999 6",
"output": "1"
},
{
"input": "1 1 2 5",
"output": "1"
},
{
"input": "2 1 2 3",
"output": "1"
},
{
"input": "1 1 3 5",
"output": "1"
},
{
"input": "1 1 3 3",
"output": "2"
},
{
"input": "2 2 2 1",
"output": "2"
},
{
"input": "3 1 1 1",
"output": "2"
},
{
"input": "1 2 2 2",
"output": "2"
}
] | 1,694,045,151 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 92 | 0 | numeros = str(input())
lista = []
spacePlace = numeros.find(" ")
iguales = []
for i in range(4):
if (spacePlace != -1):
lista.append(int(numeros[:spacePlace + 1]))
numeros = numeros[(spacePlace + 1):]
spacePlace = numeros.find(' ')
else:
lista.append(int(numeros))
for item in lista:
if item not in iguales:
iguales.append(item)
print(4 - (len(iguales)))
| Title: Is your horseshoe on the other hoof?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
Input Specification:
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers.
Output Specification:
Print a single integer — the minimum number of horseshoes Valera needs to buy.
Demo Input:
['1 7 3 3\n', '7 7 7 7\n']
Demo Output:
['1\n', '3\n']
Note:
none | ```python
numeros = str(input())
lista = []
spacePlace = numeros.find(" ")
iguales = []
for i in range(4):
if (spacePlace != -1):
lista.append(int(numeros[:spacePlace + 1]))
numeros = numeros[(spacePlace + 1):]
spacePlace = numeros.find(' ')
else:
lista.append(int(numeros))
for item in lista:
if item not in iguales:
iguales.append(item)
print(4 - (len(iguales)))
``` | 3 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,617,396,074 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 60 | 0 | M_str = input()
M = int(M_str)
N_str = input("How many columns on the rectangular board?:\n")
N = int(N_str)
if M < 1 or M > 1000000 and N < 1 or N > 1000000 :
print ('The number of columns and rows should be between 1 and 1000000.')
else:
number_of_squares = M * N
print (number_of_squares // 2)
| Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
M_str = input()
M = int(M_str)
N_str = input("How many columns on the rectangular board?:\n")
N = int(N_str)
if M < 1 or M > 1000000 and N < 1 or N > 1000000 :
print ('The number of columns and rows should be between 1 and 1000000.')
else:
number_of_squares = M * N
print (number_of_squares // 2)
``` | -1 |
631 | C | Report | PROGRAMMING | 1,700 | [
"data structures",
"sortings"
] | null | null | Each month Blake gets the report containing main economic indicators of the company "Blake Technologies". There are *n* commodities produced by the company. For each of them there is exactly one integer in the final report, that denotes corresponding revenue. Before the report gets to Blake, it passes through the hands of *m* managers. Each of them may reorder the elements in some order. Namely, the *i*-th manager either sorts first *r**i* numbers in non-descending or non-ascending order and then passes the report to the manager *i*<=+<=1, or directly to Blake (if this manager has number *i*<==<=*m*).
Employees of the "Blake Technologies" are preparing the report right now. You know the initial sequence *a**i* of length *n* and the description of each manager, that is value *r**i* and his favourite order. You are asked to speed up the process and determine how the final report will look like. | The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the number of commodities in the report and the number of managers, respectively.
The second line contains *n* integers *a**i* (|*a**i*|<=≤<=109) — the initial report before it gets to the first manager.
Then follow *m* lines with the descriptions of the operations managers are going to perform. The *i*-th of these lines contains two integers *t**i* and *r**i* (, 1<=≤<=*r**i*<=≤<=*n*), meaning that the *i*-th manager sorts the first *r**i* numbers either in the non-descending (if *t**i*<==<=1) or non-ascending (if *t**i*<==<=2) order. | Print *n* integers — the final report, which will be passed to Blake by manager number *m*. | [
"3 1\n1 2 3\n2 2\n",
"4 2\n1 2 4 3\n2 3\n1 2\n"
] | [
"2 1 3 ",
"2 4 1 3 "
] | In the first sample, the initial report looked like: 1 2 3. After the first manager the first two numbers were transposed: 2 1 3. The report got to Blake in this form.
In the second sample the original report was like this: 1 2 4 3. After the first manager the report changed to: 4 2 1 3. After the second manager the report changed to: 2 4 1 3. This report was handed over to Blake. | 1,500 | [
{
"input": "3 1\n1 2 3\n2 2",
"output": "2 1 3 "
},
{
"input": "4 2\n1 2 4 3\n2 3\n1 2",
"output": "2 4 1 3 "
},
{
"input": "4 1\n4 3 2 1\n1 4",
"output": "1 2 3 4 "
},
{
"input": "5 1\n1 2 3 4 5\n2 5",
"output": "5 4 3 2 1 "
},
{
"input": "6 2\n3 1 2 6 4 5\n1 6\n2 3",
"output": "3 2 1 4 5 6 "
},
{
"input": "10 3\n6 4 0 2 -3 7 8 -9 1 5\n1 8\n1 4\n2 2",
"output": "-3 -9 0 2 4 6 7 8 1 5 "
},
{
"input": "100 30\n65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 74 57 115 16 55 88 79 97 21 80 41 56 49 103 61 66 1 36 44 43 82 37 38 106 27 114 51 112 55 87 41 69 31 86 58 27 46 99 18 105 91 38 5 9 2 109 39 2 27 47\n2 38\n2 32\n1 46\n1 37\n1 20\n1 5\n2 42\n2 18\n1 35\n1 36\n2 44\n1 36\n1 20\n2 21\n2 14\n1 13\n2 2\n1 15\n2 50\n2 35\n1 42\n1 21\n1 50\n2 50\n1 1\n2 48\n2 24\n1 34\n1 23\n2 9",
"output": "65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 74 57 115 16 55 88 79 97 21 80 41 56 49 103 61 66 1 36 44 43 82 37 38 106 27 114 51 112 55 87 41 69 31 86 58 27 46 99 18 105 91 38 5 9 2 109 39 2 27 47 "
},
{
"input": "1 1\n1234\n1 1",
"output": "1234 "
},
{
"input": "1 1\n1000000000\n2 1",
"output": "1000000000 "
},
{
"input": "1 2\n-1000000000\n1 1\n2 1",
"output": "-1000000000 "
},
{
"input": "30 13\n15 44 5 56 84 15 24 72 97 3 61 97 36 33 98 49 1 40 76 94 7 46 85 53 79 68 78 54 80 33\n2 18\n1 9\n1 6\n2 30\n2 15\n2 4\n2 17\n2 16\n2 20\n2 16\n2 7\n2 12\n1 20",
"output": "40 44 46 49 53 54 56 61 68 72 76 78 79 80 84 85 94 97 97 98 36 33 33 24 15 15 7 5 3 1 "
}
] | 1,459,428,670 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 7 | 2,000 | 30,924,800 | a, b = (int(i) for i in input().split())
f = []
t = input().split()
for i in range(a):
f.append(int(t[i]))
d = []
for i in range(b):
c, e = (int(t) for t in input().split())
d.append([c, e])
for i in range(b):
u = int(d[i][1])
if d[i][0] == 1:
g = sorted(f[:u])
f[:u] = g
else:
g = sorted(f[:u])[::-1]
f[:u] = g
for i in range(a):
print(f[i],end = ' ')
| Title: Report
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Each month Blake gets the report containing main economic indicators of the company "Blake Technologies". There are *n* commodities produced by the company. For each of them there is exactly one integer in the final report, that denotes corresponding revenue. Before the report gets to Blake, it passes through the hands of *m* managers. Each of them may reorder the elements in some order. Namely, the *i*-th manager either sorts first *r**i* numbers in non-descending or non-ascending order and then passes the report to the manager *i*<=+<=1, or directly to Blake (if this manager has number *i*<==<=*m*).
Employees of the "Blake Technologies" are preparing the report right now. You know the initial sequence *a**i* of length *n* and the description of each manager, that is value *r**i* and his favourite order. You are asked to speed up the process and determine how the final report will look like.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the number of commodities in the report and the number of managers, respectively.
The second line contains *n* integers *a**i* (|*a**i*|<=≤<=109) — the initial report before it gets to the first manager.
Then follow *m* lines with the descriptions of the operations managers are going to perform. The *i*-th of these lines contains two integers *t**i* and *r**i* (, 1<=≤<=*r**i*<=≤<=*n*), meaning that the *i*-th manager sorts the first *r**i* numbers either in the non-descending (if *t**i*<==<=1) or non-ascending (if *t**i*<==<=2) order.
Output Specification:
Print *n* integers — the final report, which will be passed to Blake by manager number *m*.
Demo Input:
['3 1\n1 2 3\n2 2\n', '4 2\n1 2 4 3\n2 3\n1 2\n']
Demo Output:
['2 1 3 ', '2 4 1 3 ']
Note:
In the first sample, the initial report looked like: 1 2 3. After the first manager the first two numbers were transposed: 2 1 3. The report got to Blake in this form.
In the second sample the original report was like this: 1 2 4 3. After the first manager the report changed to: 4 2 1 3. After the second manager the report changed to: 2 4 1 3. This report was handed over to Blake. | ```python
a, b = (int(i) for i in input().split())
f = []
t = input().split()
for i in range(a):
f.append(int(t[i]))
d = []
for i in range(b):
c, e = (int(t) for t in input().split())
d.append([c, e])
for i in range(b):
u = int(d[i][1])
if d[i][0] == 1:
g = sorted(f[:u])
f[:u] = g
else:
g = sorted(f[:u])[::-1]
f[:u] = g
for i in range(a):
print(f[i],end = ' ')
``` | 0 |
|
81 | A | Plug-in | PROGRAMMING | 1,400 | [
"implementation"
] | A. Plug-in | 1 | 256 | Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result. | The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters. | Print the given string after it is processed. It is guaranteed that the result will contain at least one character. | [
"hhoowaaaareyyoouu\n",
"reallazy\n",
"abacabaabacabaa\n"
] | [
"wre",
"rezy",
"a"
] | none | 500 | [
{
"input": "hhoowaaaareyyoouu",
"output": "wre"
},
{
"input": "reallazy",
"output": "rezy"
},
{
"input": "abacabaabacabaa",
"output": "a"
},
{
"input": "xraccabccbry",
"output": "xy"
},
{
"input": "a",
"output": "a"
},
{
"input": "b",
"output": "b"
},
{
"input": "il",
"output": "il"
},
{
"input": "gfj",
"output": "gfj"
},
{
"input": "babbbbbababa",
"output": "babababa"
},
{
"input": "babbbbabbabbbababbabbbbbbabaabaababaaabbbbbabbbbaaaaabbaaabbaabaabbbbabbbababbabaaabbababaaababbbaaa",
"output": "babababababababababababa"
},
{
"input": "aab",
"output": "b"
},
{
"input": "abb",
"output": "a"
},
{
"input": "aba",
"output": "aba"
},
{
"input": "ab",
"output": "ab"
}
] | 1,572,756,321 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 342 | 2,560,000 | def plugin(string):
stack = []
for i in string:
if len(stack) == 0:
stack.append(i)
else:
if stack[-1] == i:
stack.pop()
else:
stack.append(i)
return "".join(stack)
string = input()
print(plugin(string)) | Title: Plug-in
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result.
Input Specification:
The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters.
Output Specification:
Print the given string after it is processed. It is guaranteed that the result will contain at least one character.
Demo Input:
['hhoowaaaareyyoouu\n', 'reallazy\n', 'abacabaabacabaa\n']
Demo Output:
['wre', 'rezy', 'a']
Note:
none | ```python
def plugin(string):
stack = []
for i in string:
if len(stack) == 0:
stack.append(i)
else:
if stack[-1] == i:
stack.pop()
else:
stack.append(i)
return "".join(stack)
string = input()
print(plugin(string))
``` | 3.824232 |
821 | A | Okabe and Future Gadget Laboratory | PROGRAMMING | 800 | [
"implementation"
] | null | null | Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column.
Help Okabe determine whether a given lab is good! | The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab.
The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105). | Print "Yes" if the given lab is good and "No" otherwise.
You can output each letter in upper or lower case. | [
"3\n1 1 2\n2 3 1\n6 4 1\n",
"3\n1 5 2\n1 1 1\n1 2 3\n"
] | [
"Yes\n",
"No\n"
] | In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes".
In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No". | 500 | [
{
"input": "3\n1 1 2\n2 3 1\n6 4 1",
"output": "Yes"
},
{
"input": "3\n1 5 2\n1 1 1\n1 2 3",
"output": "No"
},
{
"input": "1\n1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 11 1 2\n2 5 1 4\n3 9 4 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 7 1 1\n1 3 1 2\n2 6 3 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 12 1 2\n4 4 1 3\n5 10 6 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n5 11 6 1",
"output": "Yes"
},
{
"input": "4\n1 1 1 1\n1 13 1 2\n4 5 1 3\n7 11 6 1",
"output": "No"
},
{
"input": "4\n1 1 1 1\n1 14 1 6\n4 5 1 5\n3 8 2 1",
"output": "Yes"
},
{
"input": "10\n3 2 6 5 1 2 1 1 2 1\n1 2 2 3 1 4 1 1 1 1\n1 1 3 1 2 2 2 1 1 1\n1 3 1 2 1 2 1 1 1 1\n12 1 4 3 3 1 1 1 2 1\n8 1 1 1 1 3 6 5 1 3\n1 1 1 2 4 1 3 2 1 1\n1 1 1 1 1 1 1 2 1 1\n1 2 1 1 1 1 1 1 1 1\n2 1 1 1 1 1 1 1 1 2",
"output": "Yes"
},
{
"input": "4\n1 2 3 5\n1 1 1 1\n1 1 1 1\n1 1 1 1",
"output": "No"
},
{
"input": "1\n2",
"output": "No"
},
{
"input": "3\n1 1 4\n1 1 2\n1 1 2",
"output": "No"
},
{
"input": "1\n5",
"output": "No"
},
{
"input": "3\n1 2 1\n2 2 3\n1 3 1",
"output": "No"
},
{
"input": "3\n2 1 1\n2 1 1\n2 1 1",
"output": "No"
},
{
"input": "1\n60000",
"output": "No"
}
] | 1,598,046,009 | 2,147,483,647 | PyPy 3 | OK | TESTS | 31 | 171 | 22,630,400 | n = int(input())
aij = [list(map(int,input().split())) for i in range(n)]
ans = "YES"
for i in range(n):
for j in range(n):
if aij[i][j] != 1:
flag = 0
for i2 in range(n):
for j2 in range(n):
if i2 != i and j2 != j and aij[i2][j] + aij[i][j2] == aij[i][j]:
flag = 1
if flag == 0:
ans = "NO"
print(ans)
| Title: Okabe and Future Gadget Laboratory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Okabe needs to renovate the Future Gadget Laboratory after he tried doing some crazy experiments! The lab is represented as an *n* by *n* square grid of integers. A good lab is defined as a lab in which every number not equal to 1 can be expressed as the sum of a number in the same row and a number in the same column. In other words, for every *x*,<=*y* such that 1<=≤<=*x*,<=*y*<=≤<=*n* and *a**x*,<=*y*<=≠<=1, there should exist two indices *s* and *t* so that *a**x*,<=*y*<==<=*a**x*,<=*s*<=+<=*a**t*,<=*y*, where *a**i*,<=*j* denotes the integer in *i*-th row and *j*-th column.
Help Okabe determine whether a given lab is good!
Input Specification:
The first line of input contains the integer *n* (1<=≤<=*n*<=≤<=50) — the size of the lab.
The next *n* lines contain *n* space-separated integers denoting a row of the grid. The *j*-th integer in the *i*-th row is *a**i*,<=*j* (1<=≤<=*a**i*,<=*j*<=≤<=105).
Output Specification:
Print "Yes" if the given lab is good and "No" otherwise.
You can output each letter in upper or lower case.
Demo Input:
['3\n1 1 2\n2 3 1\n6 4 1\n', '3\n1 5 2\n1 1 1\n1 2 3\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first sample test, the 6 in the bottom left corner is valid because it is the sum of the 2 above it and the 4 on the right. The same holds for every number not equal to 1 in this table, so the answer is "Yes".
In the second sample test, the 5 cannot be formed as the sum of an integer in the same row and an integer in the same column. Thus the answer is "No". | ```python
n = int(input())
aij = [list(map(int,input().split())) for i in range(n)]
ans = "YES"
for i in range(n):
for j in range(n):
if aij[i][j] != 1:
flag = 0
for i2 in range(n):
for j2 in range(n):
if i2 != i and j2 != j and aij[i2][j] + aij[i][j2] == aij[i][j]:
flag = 1
if flag == 0:
ans = "NO"
print(ans)
``` | 3 |
|
34 | A | Reconnaissance 2 | PROGRAMMING | 800 | [
"implementation"
] | A. Reconnaissance 2 | 2 | 256 | *n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit. | The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction. | Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle. | [
"5\n10 12 13 15 10\n",
"4\n10 20 30 40\n"
] | [
"5 1\n",
"1 2\n"
] | none | 500 | [
{
"input": "5\n10 12 13 15 10",
"output": "5 1"
},
{
"input": "4\n10 20 30 40",
"output": "1 2"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "2 3"
},
{
"input": "5\n826 747 849 687 437",
"output": "1 2"
},
{
"input": "5\n999 999 993 969 999",
"output": "1 2"
},
{
"input": "5\n4 24 6 1 15",
"output": "3 4"
},
{
"input": "2\n511 32",
"output": "1 2"
},
{
"input": "3\n907 452 355",
"output": "2 3"
},
{
"input": "4\n303 872 764 401",
"output": "4 1"
},
{
"input": "10\n684 698 429 694 956 812 594 170 937 764",
"output": "1 2"
},
{
"input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695",
"output": "7 8"
},
{
"input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000",
"output": "12 13"
},
{
"input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58",
"output": "16 17"
},
{
"input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000",
"output": "1 2"
},
{
"input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4",
"output": "1 2"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "86 87"
},
{
"input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25",
"output": "7 8"
},
{
"input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964",
"output": "1 2"
},
{
"input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967",
"output": "81 82"
},
{
"input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17",
"output": "36 37"
}
] | 1,588,939,295 | 2,147,483,647 | Python 3 | OK | TESTS | 20 | 248 | 7,065,600 | import copy
import math
n=int(input())
a=list(map(int,input().split()))
x=[]
for i in range(0,n-1):
c=int(math.fabs(a[i]-a[i+1]))
x.append(c)
c=int(math.fabs(a[0]-a[n-1]))
x.append(c)
d=min(x)
for i in range(0,n):
if d==x[i]:
if i==n-1:
print(1,n)
else:
print(i+1,i+2)
break
else:
continue
| Title: Reconnaissance 2
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output Specification:
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
Demo Input:
['5\n10 12 13 15 10\n', '4\n10 20 30 40\n']
Demo Output:
['5 1\n', '1 2\n']
Note:
none | ```python
import copy
import math
n=int(input())
a=list(map(int,input().split()))
x=[]
for i in range(0,n-1):
c=int(math.fabs(a[i]-a[i+1]))
x.append(c)
c=int(math.fabs(a[0]-a[n-1]))
x.append(c)
d=min(x)
for i in range(0,n):
if d==x[i]:
if i==n-1:
print(1,n)
else:
print(i+1,i+2)
break
else:
continue
``` | 3.924839 |
387 | B | George and Round | PROGRAMMING | 1,200 | [
"brute force",
"greedy",
"two pointers"
] | null | null | George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity. | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George. | Print a single integer — the answer to the problem. | [
"3 5\n1 2 3\n1 2 2 3 3\n",
"3 5\n1 2 3\n1 1 1 1 1\n",
"3 1\n2 3 4\n1\n"
] | [
"0\n",
"2\n",
"3\n"
] | In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4. | 1,000 | [
{
"input": "3 5\n1 2 3\n1 2 2 3 3",
"output": "0"
},
{
"input": "3 5\n1 2 3\n1 1 1 1 1",
"output": "2"
},
{
"input": "3 1\n2 3 4\n1",
"output": "3"
},
{
"input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98",
"output": "24"
}
] | 1,566,440,791 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 109 | 0 | def main():
nk = list(map(int, input("").split()))
set1 = set(map(int, input("").split()))
set2 = set(map(int, input("").split()))
n = nk[0]
k = nk[1]
print(len(set1 - set2))
if __name__ == '__main__':
main() | Title: George and Round
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n']
Demo Output:
['0\n', '2\n', '3\n']
Note:
In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4. | ```python
def main():
nk = list(map(int, input("").split()))
set1 = set(map(int, input("").split()))
set2 = set(map(int, input("").split()))
n = nk[0]
k = nk[1]
print(len(set1 - set2))
if __name__ == '__main__':
main()
``` | 0 |
|
225 | C | Barcode | PROGRAMMING | 1,700 | [
"dp",
"matrices"
] | null | null | You've got an *n*<=×<=*m* pixel picture. Each pixel can be white or black. Your task is to change the colors of as few pixels as possible to obtain a barcode picture.
A picture is a barcode if the following conditions are fulfilled:
- All pixels in each column are of the same color. - The width of each monochrome vertical line is at least *x* and at most *y* pixels. In other words, if we group all neighbouring columns of the pixels with equal color, the size of each group can not be less than *x* or greater than *y*. | The first line contains four space-separated integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*,<=*x*,<=*y*<=≤<=1000; *x*<=≤<=*y*).
Then follow *n* lines, describing the original image. Each of these lines contains exactly *m* characters. Character "." represents a white pixel and "#" represents a black pixel. The picture description doesn't have any other characters besides "." and "#". | In the first line print the minimum number of pixels to repaint. It is guaranteed that the answer exists. | [
"6 5 1 2\n##.#.\n.###.\n###..\n#...#\n.##.#\n###..\n",
"2 5 1 1\n#####\n.....\n"
] | [
"11\n",
"5\n"
] | In the first test sample the picture after changing some colors can looks as follows:
In the second test sample the picture after changing some colors can looks as follows: | 1,500 | [
{
"input": "6 5 1 2\n##.#.\n.###.\n###..\n#...#\n.##.#\n###..",
"output": "11"
},
{
"input": "10 5 3 7\n.####\n###..\n##.##\n#..#.\n.#...\n#.##.\n.##..\n.#.##\n#.#..\n.#..#",
"output": "24"
},
{
"input": "6 3 1 4\n##.\n#..\n#..\n..#\n.#.\n#.#",
"output": "6"
},
{
"input": "5 10 4 16\n.#####....\n##..#..##.\n.#..##.#..\n##..#####.\n...#.##..#",
"output": "21"
},
{
"input": "5 4 1 4\n####\n..##\n##..\n..#.\n#..#",
"output": "8"
},
{
"input": "1 1 1 2\n.",
"output": "0"
},
{
"input": "3 44 2 18\n####..###.#.##........##...###.####.#.....##\n...#....##.###.###.##.#####.#######.#..#..#.\n#...#.####.#.##.#.#.#.....##.##..###.#....##",
"output": "39"
},
{
"input": "69 1 1 2\n#\n.\n#\n#\n.\n#\n#\n.\n.\n#\n.\n.\n#\n.\n#\n#\n.\n#\n#\n#\n#\n#\n.\n#\n.\n.\n#\n#\n#\n.\n.\n.\n.\n#\n#\n.\n#\n#\n.\n#\n.\n.\n#\n.\n.\n.\n#\n.\n.\n#\n#\n.\n.\n#\n.\n.\n.\n#\n#\n#\n#\n#\n.\n#\n.\n#\n#\n#\n#",
"output": "31"
},
{
"input": "56 2 2 2\n##\n##\n##\n..\n..\n##\n.#\n#.\n..\n##\n##\n..\n..\n#.\n#.\n#.\n#.\n##\n..\n.#\n..\n##\n##\n.#\n#.\n.#\n..\n..\n#.\n..\n##\n..\n#.\n.#\n#.\n#.\n#.\n##\n#.\n##\n##\n.#\n#.\n##\n..\n.#\n#.\n#.\n##\n..\n..\n#.\n##\n..\n..\n##",
"output": "55"
}
] | 1,653,742,428 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 62 | 0 | n,m,x1,y=map(int,input().split());a=[]
for i in range(n):
s=list(map(str,str(input())))
a.append(s)
o=0;l=0;h=n-2;p=0
while h<n:
x=x1
for i in range(x,y+1):
if n==6:
l=1
for j in range(m):
if a[i][j]=='#':
p+=1
x+=1
if p==0:
o=0;break
if o==0:
break
h+=y
if l==1:
p=n+m
else:
p=0
for i in range(m):
p+=1
print(p)
| Title: Barcode
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got an *n*<=×<=*m* pixel picture. Each pixel can be white or black. Your task is to change the colors of as few pixels as possible to obtain a barcode picture.
A picture is a barcode if the following conditions are fulfilled:
- All pixels in each column are of the same color. - The width of each monochrome vertical line is at least *x* and at most *y* pixels. In other words, if we group all neighbouring columns of the pixels with equal color, the size of each group can not be less than *x* or greater than *y*.
Input Specification:
The first line contains four space-separated integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*,<=*x*,<=*y*<=≤<=1000; *x*<=≤<=*y*).
Then follow *n* lines, describing the original image. Each of these lines contains exactly *m* characters. Character "." represents a white pixel and "#" represents a black pixel. The picture description doesn't have any other characters besides "." and "#".
Output Specification:
In the first line print the minimum number of pixels to repaint. It is guaranteed that the answer exists.
Demo Input:
['6 5 1 2\n##.#.\n.###.\n###..\n#...#\n.##.#\n###..\n', '2 5 1 1\n#####\n.....\n']
Demo Output:
['11\n', '5\n']
Note:
In the first test sample the picture after changing some colors can looks as follows:
In the second test sample the picture after changing some colors can looks as follows: | ```python
n,m,x1,y=map(int,input().split());a=[]
for i in range(n):
s=list(map(str,str(input())))
a.append(s)
o=0;l=0;h=n-2;p=0
while h<n:
x=x1
for i in range(x,y+1):
if n==6:
l=1
for j in range(m):
if a[i][j]=='#':
p+=1
x+=1
if p==0:
o=0;break
if o==0:
break
h+=y
if l==1:
p=n+m
else:
p=0
for i in range(m):
p+=1
print(p)
``` | 0 |
|
129 | A | Cookies | PROGRAMMING | 900 | [
"implementation"
] | null | null | Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even? | The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag. | Print in the only line the only number — the sought number of ways. If there are no such ways print 0. | [
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] | [
"1\n",
"8\n",
"1\n"
] | In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies. | 500 | [
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,658,337,878 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | n=str(input())
z=n.count('0')
o=n.count('1')
if z>7 or o>7:
print("YES")
else:print("NO") | Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies. | ```python
n=str(input())
z=n.count('0')
o=n.count('1')
if z>7 or o>7:
print("YES")
else:print("NO")
``` | 0 |
|
136 | A | Presents | PROGRAMMING | 800 | [
"implementation"
] | null | null | Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. | The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. | Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. | [
"4\n2 3 4 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] | [
"4 1 2 3\n",
"1 3 2\n",
"1 2\n"
] | none | 500 | [
{
"input": "4\n2 3 4 1",
"output": "4 1 2 3"
},
{
"input": "3\n1 3 2",
"output": "1 3 2"
},
{
"input": "2\n1 2",
"output": "1 2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 3 2 6 4 5 7 9 8 10",
"output": "1 3 2 5 6 4 7 9 8 10"
},
{
"input": "5\n5 4 3 2 1",
"output": "5 4 3 2 1"
},
{
"input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19"
},
{
"input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19",
"output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19"
},
{
"input": "10\n3 4 5 6 7 8 9 10 1 2",
"output": "9 10 1 2 3 4 5 6 7 8"
},
{
"input": "8\n1 5 3 7 2 6 4 8",
"output": "1 5 3 7 2 6 4 8"
},
{
"input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47",
"output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19"
},
{
"input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17",
"output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25"
},
{
"input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85",
"output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30"
},
{
"input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49",
"output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49"
},
{
"input": "12\n3 8 7 4 6 5 2 1 11 9 10 12",
"output": "8 7 1 4 6 5 3 2 10 11 9 12"
},
{
"input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76",
"output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4"
},
{
"input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43",
"output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1"
},
{
"input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27",
"output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3"
},
{
"input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22",
"output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53"
},
{
"input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13",
"output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24"
},
{
"input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21",
"output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61"
},
{
"input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33",
"output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14"
},
{
"input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23",
"output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21"
},
{
"input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12",
"output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9"
},
{
"input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31",
"output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13"
},
{
"input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3",
"output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16"
},
{
"input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8",
"output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6"
},
{
"input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71",
"output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90"
},
{
"input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9",
"output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9"
},
{
"input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44",
"output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20"
},
{
"input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17",
"output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28"
},
{
"input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7",
"output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5"
},
{
"input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16",
"output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43"
},
{
"input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65",
"output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43"
},
{
"input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16",
"output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45"
},
{
"input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51",
"output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64"
},
{
"input": "12\n12 3 1 5 11 6 7 10 2 8 9 4",
"output": "3 9 2 12 4 6 7 10 11 8 5 1"
},
{
"input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17",
"output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44"
},
{
"input": "8\n1 3 5 2 4 8 6 7",
"output": "1 4 2 5 3 7 8 6"
},
{
"input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14",
"output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12"
},
{
"input": "10\n2 9 4 6 10 1 7 5 3 8",
"output": "6 1 9 3 8 4 7 10 2 5"
},
{
"input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3",
"output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7"
},
{
"input": "10\n2 4 9 3 6 8 10 5 1 7",
"output": "9 1 4 2 8 5 10 6 3 7"
},
{
"input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15",
"output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23"
},
{
"input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1",
"output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27"
},
{
"input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30",
"output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23"
},
{
"input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52",
"output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50"
},
{
"input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18",
"output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98"
},
{
"input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16",
"output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25"
},
{
"input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37",
"output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54"
},
{
"input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71",
"output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71"
},
{
"input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22",
"output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8"
},
{
"input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12",
"output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51"
},
{
"input": "7\n2 1 5 7 3 4 6",
"output": "2 1 5 6 3 7 4"
},
{
"input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35",
"output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31"
},
{
"input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16",
"output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21"
},
{
"input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52",
"output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11"
},
{
"input": "9\n8 5 2 6 1 9 4 7 3",
"output": "5 3 9 7 2 4 8 1 6"
},
{
"input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27",
"output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13"
},
{
"input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34",
"output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6"
},
{
"input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29",
"output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14"
},
{
"input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7",
"output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16"
},
{
"input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34",
"output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24"
},
{
"input": "9\n4 8 6 5 3 9 2 7 1",
"output": "9 7 5 1 4 3 8 2 6"
},
{
"input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29",
"output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32"
},
{
"input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47",
"output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11"
},
{
"input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6",
"output": "10 4 1 8 6 13 12 5 3 11 9 2 7"
},
{
"input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29",
"output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37"
},
{
"input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3",
"output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25"
},
{
"input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20",
"output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24"
},
{
"input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42",
"output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59"
},
{
"input": "6\n4 3 6 5 1 2",
"output": "5 6 2 1 4 3"
},
{
"input": "9\n7 8 5 3 1 4 2 9 6",
"output": "5 7 4 6 3 9 1 2 8"
},
{
"input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37",
"output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11",
"output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13"
},
{
"input": "2\n2 1",
"output": "2 1"
},
{
"input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28",
"output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18"
},
{
"input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13",
"output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1"
},
{
"input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14",
"output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36"
},
{
"input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29",
"output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32"
},
{
"input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5",
"output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40"
},
{
"input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54",
"output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21"
},
{
"input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29",
"output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4"
},
{
"input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23",
"output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50"
},
{
"input": "10\n2 10 7 4 1 5 8 6 3 9",
"output": "5 1 9 4 6 8 3 7 10 2"
},
{
"input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13",
"output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1"
},
{
"input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2",
"output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11"
},
{
"input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53",
"output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37"
},
{
"input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53",
"output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53"
},
{
"input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64",
"output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49"
},
{
"input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86",
"output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38"
},
{
"input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75",
"output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2"
},
{
"input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53",
"output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5"
},
{
"input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39",
"output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12"
},
{
"input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87",
"output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82"
},
{
"input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25",
"output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97"
},
{
"input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61",
"output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96"
},
{
"input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92",
"output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96"
},
{
"input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6",
"output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1"
}
] | 1,697,703,780 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | n = int(input())
a = list(map(int,input().split()))
d = [0] * n
for i in range(n):
ind = a.index(a[i])
l = a[i]-1
d[l] = ind+1
print(d)
| Title: Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Output Specification:
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
Demo Input:
['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['4 1 2 3\n', '1 3 2\n', '1 2\n']
Note:
none | ```python
n = int(input())
a = list(map(int,input().split()))
d = [0] * n
for i in range(n):
ind = a.index(a[i])
l = a[i]-1
d[l] = ind+1
print(d)
``` | 0 |
|
258 | A | Little Elephant and Bits | PROGRAMMING | 1,100 | [
"greedy",
"math"
] | null | null | The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. | The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. | In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. | [
"101\n",
"110010\n"
] | [
"11\n",
"11010\n"
] | In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | 500 | [
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
] | 1,668,854,818 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 37 | 124 | 0 | s=input()
i=s.find('0')
if i==-1:print(s[:len(s)-1])
else:print(s[:i]+s[i+1:]) | Title: Little Elephant and Bits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | ```python
s=input()
i=s.find('0')
if i==-1:print(s[:len(s)-1])
else:print(s[:i]+s[i+1:])
``` | 3 |
|
136 | A | Presents | PROGRAMMING | 800 | [
"implementation"
] | null | null | Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. | The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. | Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. | [
"4\n2 3 4 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] | [
"4 1 2 3\n",
"1 3 2\n",
"1 2\n"
] | none | 500 | [
{
"input": "4\n2 3 4 1",
"output": "4 1 2 3"
},
{
"input": "3\n1 3 2",
"output": "1 3 2"
},
{
"input": "2\n1 2",
"output": "1 2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 3 2 6 4 5 7 9 8 10",
"output": "1 3 2 5 6 4 7 9 8 10"
},
{
"input": "5\n5 4 3 2 1",
"output": "5 4 3 2 1"
},
{
"input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19"
},
{
"input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19",
"output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19"
},
{
"input": "10\n3 4 5 6 7 8 9 10 1 2",
"output": "9 10 1 2 3 4 5 6 7 8"
},
{
"input": "8\n1 5 3 7 2 6 4 8",
"output": "1 5 3 7 2 6 4 8"
},
{
"input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47",
"output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19"
},
{
"input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17",
"output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25"
},
{
"input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85",
"output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30"
},
{
"input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49",
"output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49"
},
{
"input": "12\n3 8 7 4 6 5 2 1 11 9 10 12",
"output": "8 7 1 4 6 5 3 2 10 11 9 12"
},
{
"input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76",
"output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4"
},
{
"input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43",
"output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1"
},
{
"input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27",
"output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3"
},
{
"input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22",
"output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53"
},
{
"input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13",
"output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24"
},
{
"input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21",
"output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61"
},
{
"input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33",
"output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14"
},
{
"input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23",
"output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21"
},
{
"input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12",
"output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9"
},
{
"input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31",
"output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13"
},
{
"input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3",
"output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16"
},
{
"input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8",
"output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6"
},
{
"input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71",
"output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90"
},
{
"input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9",
"output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9"
},
{
"input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44",
"output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20"
},
{
"input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17",
"output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28"
},
{
"input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7",
"output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5"
},
{
"input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16",
"output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43"
},
{
"input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65",
"output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43"
},
{
"input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16",
"output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45"
},
{
"input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51",
"output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64"
},
{
"input": "12\n12 3 1 5 11 6 7 10 2 8 9 4",
"output": "3 9 2 12 4 6 7 10 11 8 5 1"
},
{
"input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17",
"output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44"
},
{
"input": "8\n1 3 5 2 4 8 6 7",
"output": "1 4 2 5 3 7 8 6"
},
{
"input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14",
"output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12"
},
{
"input": "10\n2 9 4 6 10 1 7 5 3 8",
"output": "6 1 9 3 8 4 7 10 2 5"
},
{
"input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3",
"output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7"
},
{
"input": "10\n2 4 9 3 6 8 10 5 1 7",
"output": "9 1 4 2 8 5 10 6 3 7"
},
{
"input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15",
"output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23"
},
{
"input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1",
"output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27"
},
{
"input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30",
"output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23"
},
{
"input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52",
"output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50"
},
{
"input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18",
"output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98"
},
{
"input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16",
"output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25"
},
{
"input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37",
"output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54"
},
{
"input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71",
"output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71"
},
{
"input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22",
"output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8"
},
{
"input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12",
"output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51"
},
{
"input": "7\n2 1 5 7 3 4 6",
"output": "2 1 5 6 3 7 4"
},
{
"input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35",
"output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31"
},
{
"input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16",
"output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21"
},
{
"input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52",
"output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11"
},
{
"input": "9\n8 5 2 6 1 9 4 7 3",
"output": "5 3 9 7 2 4 8 1 6"
},
{
"input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27",
"output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13"
},
{
"input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34",
"output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6"
},
{
"input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29",
"output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14"
},
{
"input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7",
"output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16"
},
{
"input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34",
"output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24"
},
{
"input": "9\n4 8 6 5 3 9 2 7 1",
"output": "9 7 5 1 4 3 8 2 6"
},
{
"input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29",
"output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32"
},
{
"input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47",
"output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11"
},
{
"input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6",
"output": "10 4 1 8 6 13 12 5 3 11 9 2 7"
},
{
"input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29",
"output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37"
},
{
"input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3",
"output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25"
},
{
"input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20",
"output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24"
},
{
"input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42",
"output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59"
},
{
"input": "6\n4 3 6 5 1 2",
"output": "5 6 2 1 4 3"
},
{
"input": "9\n7 8 5 3 1 4 2 9 6",
"output": "5 7 4 6 3 9 1 2 8"
},
{
"input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37",
"output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11",
"output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13"
},
{
"input": "2\n2 1",
"output": "2 1"
},
{
"input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28",
"output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18"
},
{
"input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13",
"output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1"
},
{
"input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14",
"output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36"
},
{
"input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29",
"output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32"
},
{
"input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5",
"output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40"
},
{
"input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54",
"output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21"
},
{
"input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29",
"output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4"
},
{
"input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23",
"output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50"
},
{
"input": "10\n2 10 7 4 1 5 8 6 3 9",
"output": "5 1 9 4 6 8 3 7 10 2"
},
{
"input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13",
"output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1"
},
{
"input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2",
"output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11"
},
{
"input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53",
"output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37"
},
{
"input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53",
"output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53"
},
{
"input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64",
"output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49"
},
{
"input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86",
"output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38"
},
{
"input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75",
"output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2"
},
{
"input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53",
"output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5"
},
{
"input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39",
"output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12"
},
{
"input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87",
"output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82"
},
{
"input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25",
"output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97"
},
{
"input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61",
"output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96"
},
{
"input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92",
"output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96"
},
{
"input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6",
"output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1"
}
] | 1,681,462,772 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | n=int(input())
arr=list(map(int,input().split()))
a=[]
for i in range(n):
# k=arr.index(i)
a.insert(arr[i]-1,i)
for i in a:
print(i,end=' ') | Title: Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Output Specification:
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
Demo Input:
['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['4 1 2 3\n', '1 3 2\n', '1 2\n']
Note:
none | ```python
n=int(input())
arr=list(map(int,input().split()))
a=[]
for i in range(n):
# k=arr.index(i)
a.insert(arr[i]-1,i)
for i in a:
print(i,end=' ')
``` | 0 |
|
637 | C | Promocodes with Mistakes | PROGRAMMING | 1,400 | [
"*special",
"brute force",
"constructive algorithms",
"implementation"
] | null | null | During a New Year special offer the "Sudislavl Bars" offered *n* promo codes. Each promo code consists of exactly six digits and gives right to one free cocktail at the bar "Mosquito Shelter". Of course, all the promocodes differ.
As the "Mosquito Shelter" opens only at 9, and partying in Sudislavl usually begins at as early as 6, many problems may arise as to how to type a promotional code without errors. It is necessary to calculate such maximum *k*, that the promotional code could be uniquely identified if it was typed with no more than *k* errors. At that, *k*<==<=0 means that the promotional codes must be entered exactly.
A mistake in this problem should be considered as entering the wrong numbers. For example, value "123465" contains two errors relative to promocode "123456". Regardless of the number of errors the entered value consists of exactly six digits. | The first line of the output contains number *n* (1<=≤<=*n*<=≤<=1000) — the number of promocodes.
Each of the next *n* lines contains a single promocode, consisting of exactly 6 digits. It is guaranteed that all the promocodes are distinct. Promocodes can start from digit "0". | Print the maximum *k* (naturally, not exceeding the length of the promocode), such that any promocode can be uniquely identified if it is typed with at most *k* mistakes. | [
"2\n000000\n999999\n",
"6\n211111\n212111\n222111\n111111\n112111\n121111\n"
] | [
"2\n",
"0\n"
] | In the first sample *k* < 3, so if a bar customer types in value "090909", then it will be impossible to define which promocode exactly corresponds to it. | 1,500 | [
{
"input": "2\n000000\n999999",
"output": "2"
},
{
"input": "6\n211111\n212111\n222111\n111111\n112111\n121111",
"output": "0"
},
{
"input": "1\n123456",
"output": "6"
},
{
"input": "2\n000000\n099999",
"output": "2"
},
{
"input": "2\n000000\n009999",
"output": "1"
},
{
"input": "2\n000000\n000999",
"output": "1"
},
{
"input": "2\n000000\n000099",
"output": "0"
},
{
"input": "2\n000000\n000009",
"output": "0"
},
{
"input": "1\n000000",
"output": "6"
},
{
"input": "1\n999999",
"output": "6"
},
{
"input": "10\n946965\n781372\n029568\n336430\n456975\n119377\n179098\n925374\n878716\n461563",
"output": "1"
},
{
"input": "10\n878711\n193771\n965021\n617901\n333641\n307811\n989461\n461561\n956811\n253741",
"output": "1"
},
{
"input": "10\n116174\n914694\n615024\n115634\n717464\n910984\n513744\n111934\n915684\n817874",
"output": "0"
},
{
"input": "10\n153474\n155468\n151419\n151479\n158478\n159465\n150498\n157416\n150429\n159446",
"output": "0"
},
{
"input": "10\n141546\n941544\n141547\n041542\n641545\n841547\n941540\n741544\n941548\n641549",
"output": "0"
},
{
"input": "10\n114453\n114456\n114457\n114450\n114459\n114451\n114458\n114452\n114455\n114454",
"output": "0"
},
{
"input": "5\n145410\n686144\n859775\n922809\n470967",
"output": "2"
},
{
"input": "9\n145410\n686144\n859775\n922809\n470967\n234531\n597023\n318298\n701652",
"output": "2"
},
{
"input": "10\n145410\n686144\n859775\n922809\n470967\n234531\n597023\n318298\n701652\n063386",
"output": "2"
},
{
"input": "20\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832",
"output": "2"
},
{
"input": "50\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173",
"output": "2"
},
{
"input": "58\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173\n114788\n742565\n411841\n831650\n868189\n364237\n975584\n023482",
"output": "2"
},
{
"input": "58\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173\n114788\n742565\n411841\n831650\n868189\n364237\n975584\n023482",
"output": "2"
},
{
"input": "10\n234531\n597023\n859775\n063388\n701652\n686144\n470967\n145410\n318298\n922809",
"output": "2"
},
{
"input": "10\n234531\n597023\n859775\n063388\n701652\n686144\n470967\n145410\n318298\n922809",
"output": "2"
},
{
"input": "10\n234531\n597023\n859775\n063388\n701652\n686144\n470967\n145410\n318298\n922809",
"output": "2"
},
{
"input": "10\n234531\n597023\n859775\n063388\n701652\n686144\n470967\n145410\n318298\n922809",
"output": "2"
},
{
"input": "10\n234531\n597023\n859775\n063388\n701652\n686144\n470967\n145410\n318298\n922809",
"output": "2"
},
{
"input": "10\n145410\n686144\n859775\n922809\n470967\n234531\n597023\n318298\n701652\n063386",
"output": "2"
},
{
"input": "10\n145410\n686144\n859775\n922809\n470967\n234531\n597023\n318298\n701652\n063386",
"output": "2"
},
{
"input": "10\n145410\n686144\n859775\n922809\n470967\n234531\n597023\n318298\n701652\n063386",
"output": "2"
},
{
"input": "10\n145410\n686144\n859775\n922809\n470967\n234531\n597023\n318298\n701652\n063386",
"output": "2"
},
{
"input": "10\n145410\n686144\n859775\n922809\n470967\n234531\n597023\n318298\n701652\n063386",
"output": "2"
},
{
"input": "58\n114788\n281502\n080213\n093857\n956352\n501424\n512092\n145410\n673001\n128551\n594100\n396463\n758447\n133173\n411841\n538266\n908733\n318920\n872248\n720334\n055121\n691385\n160045\n232727\n947198\n452683\n443254\n859775\n583935\n470967\n742565\n766870\n799299\n061796\n817406\n377719\n034349\n303546\n254914\n635832\n686144\n806017\n295078\n246631\n569318\n831650\n600679\n207280\n325695\n774622\n922809\n975584\n019664\n667953\n189826\n984471\n868189\n364237",
"output": "1"
},
{
"input": "58\n114788\n281502\n080213\n093857\n956352\n501424\n512092\n145410\n673001\n128551\n594100\n396463\n758447\n133173\n411841\n538266\n908733\n318920\n872248\n720334\n055121\n691385\n160045\n232727\n947198\n452683\n443254\n859775\n583935\n470967\n742565\n766870\n799299\n061796\n817406\n377719\n034349\n303546\n254914\n635832\n686144\n806017\n295078\n246631\n569318\n831650\n600679\n207280\n325695\n774622\n922809\n975584\n019664\n667953\n189826\n984471\n868189\n364237",
"output": "1"
},
{
"input": "58\n114788\n281502\n080213\n093857\n956352\n501424\n512092\n145410\n673001\n128551\n594100\n396463\n758447\n133173\n411841\n538266\n908733\n318920\n872248\n720334\n055121\n691385\n160045\n232727\n947198\n452683\n443254\n859775\n583935\n470967\n742565\n766870\n799299\n061796\n817406\n377719\n034349\n303546\n254914\n635832\n686144\n806017\n295078\n246631\n569318\n831650\n600679\n207280\n325695\n774622\n922809\n975584\n019664\n667953\n189826\n984471\n868189\n364237",
"output": "1"
},
{
"input": "58\n114788\n281502\n080213\n093857\n956352\n501424\n512092\n145410\n673001\n128551\n594100\n396463\n758447\n133173\n411841\n538266\n908733\n318920\n872248\n720334\n055121\n691385\n160045\n232727\n947198\n452683\n443254\n859775\n583935\n470967\n742565\n766870\n799299\n061796\n817406\n377719\n034349\n303546\n254914\n635832\n686144\n806017\n295078\n246631\n569318\n831650\n600679\n207280\n325695\n774622\n922809\n975584\n019664\n667953\n189826\n984471\n868189\n364237",
"output": "1"
},
{
"input": "58\n114788\n281502\n080213\n093857\n956352\n501424\n512092\n145410\n673001\n128551\n594100\n396463\n758447\n133173\n411841\n538266\n908733\n318920\n872248\n720334\n055121\n691385\n160045\n232727\n947198\n452683\n443254\n859775\n583935\n470967\n742565\n766870\n799299\n061796\n817406\n377719\n034349\n303546\n254914\n635832\n686144\n806017\n295078\n246631\n569318\n831650\n600679\n207280\n325695\n774622\n922809\n975584\n019664\n667953\n189826\n984471\n868189\n364237",
"output": "1"
},
{
"input": "58\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173\n114788\n742565\n411841\n831650\n868189\n364237\n975584\n023482",
"output": "2"
},
{
"input": "58\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173\n114788\n742565\n411841\n831650\n868189\n364237\n975584\n023482",
"output": "2"
},
{
"input": "58\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173\n114788\n742565\n411841\n831650\n868189\n364237\n975584\n023482",
"output": "2"
},
{
"input": "58\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173\n114788\n742565\n411841\n831650\n868189\n364237\n975584\n023482",
"output": "2"
},
{
"input": "58\n145410\n686144\n766870\n859775\n922809\n470967\n034349\n318920\n019664\n667953\n295078\n908733\n691385\n774622\n325695\n443254\n817406\n984471\n512092\n635832\n303546\n189826\n128551\n720334\n569318\n377719\n281502\n956352\n758447\n207280\n583935\n246631\n160045\n452683\n594100\n806017\n232727\n673001\n799299\n396463\n061796\n538266\n947198\n055121\n080213\n501424\n600679\n254914\n872248\n133173\n114788\n742565\n411841\n831650\n868189\n364237\n975584\n023482",
"output": "2"
}
] | 1,457,907,266 | 36,866 | Python 3 | WRONG_ANSWER | PRETESTS | 2 | 46 | 0 | # -*- coding: utf-8 -*-
"""
Created on Sun Mar 13 19:40:03 2016
@author: Kostya S.
"""
from math import ceil
def hem(s,t):
r = 0
for u,v in zip(s,t):
r += u != v
return r
n = int(input())
code = set()
for _ in range(n):
c = (input())
code.add(c)
dist = set()
a = set()
k = 0
q = 0
for c1 in code:
for c2 in code:
a.add(hem(c1,c2))
ans = max(a)//2 - 1
print(ans)
| Title: Promocodes with Mistakes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
During a New Year special offer the "Sudislavl Bars" offered *n* promo codes. Each promo code consists of exactly six digits and gives right to one free cocktail at the bar "Mosquito Shelter". Of course, all the promocodes differ.
As the "Mosquito Shelter" opens only at 9, and partying in Sudislavl usually begins at as early as 6, many problems may arise as to how to type a promotional code without errors. It is necessary to calculate such maximum *k*, that the promotional code could be uniquely identified if it was typed with no more than *k* errors. At that, *k*<==<=0 means that the promotional codes must be entered exactly.
A mistake in this problem should be considered as entering the wrong numbers. For example, value "123465" contains two errors relative to promocode "123456". Regardless of the number of errors the entered value consists of exactly six digits.
Input Specification:
The first line of the output contains number *n* (1<=≤<=*n*<=≤<=1000) — the number of promocodes.
Each of the next *n* lines contains a single promocode, consisting of exactly 6 digits. It is guaranteed that all the promocodes are distinct. Promocodes can start from digit "0".
Output Specification:
Print the maximum *k* (naturally, not exceeding the length of the promocode), such that any promocode can be uniquely identified if it is typed with at most *k* mistakes.
Demo Input:
['2\n000000\n999999\n', '6\n211111\n212111\n222111\n111111\n112111\n121111\n']
Demo Output:
['2\n', '0\n']
Note:
In the first sample *k* < 3, so if a bar customer types in value "090909", then it will be impossible to define which promocode exactly corresponds to it. | ```python
# -*- coding: utf-8 -*-
"""
Created on Sun Mar 13 19:40:03 2016
@author: Kostya S.
"""
from math import ceil
def hem(s,t):
r = 0
for u,v in zip(s,t):
r += u != v
return r
n = int(input())
code = set()
for _ in range(n):
c = (input())
code.add(c)
dist = set()
a = set()
k = 0
q = 0
for c1 in code:
for c2 in code:
a.add(hem(c1,c2))
ans = max(a)//2 - 1
print(ans)
``` | 0 |
|
660 | C | Hard Process | PROGRAMMING | 1,600 | [
"binary search",
"dp",
"two pointers"
] | null | null | You are given an array *a* with *n* elements. Each element of *a* is either 0 or 1.
Let's denote the length of the longest subsegment of consecutive elements in *a*, consisting of only numbers one, as *f*(*a*). You can change no more than *k* zeroes to ones to maximize *f*(*a*). | The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=3·105,<=0<=≤<=*k*<=≤<=*n*) — the number of elements in *a* and the parameter *k*.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1) — the elements of *a*. | On the first line print a non-negative integer *z* — the maximal value of *f*(*a*) after no more than *k* changes of zeroes to ones.
On the second line print *n* integers *a**j* — the elements of the array *a* after the changes.
If there are multiple answers, you can print any one of them. | [
"7 1\n1 0 0 1 1 0 1\n",
"10 2\n1 0 0 1 0 1 0 1 0 1\n"
] | [
"4\n1 0 0 1 1 1 1\n",
"5\n1 0 0 1 1 1 1 1 0 1\n"
] | none | 0 | [
{
"input": "7 1\n1 0 0 1 1 0 1",
"output": "4\n1 0 0 1 1 1 1"
},
{
"input": "10 2\n1 0 0 1 0 1 0 1 0 1",
"output": "5\n1 0 0 1 1 1 1 1 0 1"
},
{
"input": "1 0\n0",
"output": "0\n0"
},
{
"input": "1 0\n0",
"output": "0\n0"
},
{
"input": "7 0\n0 1 0 0 0 1 0",
"output": "1\n0 1 0 0 0 1 0"
},
{
"input": "7 2\n1 0 1 1 0 0 0",
"output": "5\n1 1 1 1 1 0 0"
},
{
"input": "7 3\n1 0 0 0 0 1 0",
"output": "4\n1 1 1 1 0 1 0"
},
{
"input": "3 0\n1 1 1",
"output": "3\n1 1 1"
},
{
"input": "1 0\n1",
"output": "1\n1"
},
{
"input": "2 0\n0 1",
"output": "1\n0 1"
},
{
"input": "1 1\n0",
"output": "1\n1"
},
{
"input": "3 1\n0 0 1",
"output": "2\n0 1 1"
},
{
"input": "2 0\n0 0",
"output": "0\n0 0"
},
{
"input": "3 1\n0 0 0",
"output": "1\n1 0 0"
},
{
"input": "7 7\n1 0 1 0 0 0 0",
"output": "7\n1 1 1 1 1 1 1"
},
{
"input": "1 1\n1",
"output": "1\n1"
},
{
"input": "3 0\n0 0 0",
"output": "0\n0 0 0"
},
{
"input": "7 3\n1 1 1 1 1 1 1",
"output": "7\n1 1 1 1 1 1 1"
},
{
"input": "10 3\n0 0 1 0 0 1 0 0 1 1",
"output": "6\n0 0 1 0 1 1 1 1 1 1"
},
{
"input": "2 1\n0 0",
"output": "1\n1 0"
},
{
"input": "2 2\n1 0",
"output": "2\n1 1"
}
] | 1,692,178,249 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 15 | 0 | n, k = map(int, input().split())
elements = list(map(int, input().split()))
left_pointer = 0 # Left pointer of the sliding window
max_length = 0 # Maximum length of the subsegment
zero_count = 0 # Count of zeroes in the current subsegment
for right_pointer in range(n):
if elements[right_pointer] == 0:
zero_count += 1
# If the number of zeroes in the current window exceeds k, move the left pointer
while zero_count > k:
if elements[left_pointer] == 0:
zero_count -= 1
left_pointer += 1
# Update the maximum length
max_length = max(max_length, right_pointer - left_pointer + 1)
print(max_length)
| Title: Hard Process
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array *a* with *n* elements. Each element of *a* is either 0 or 1.
Let's denote the length of the longest subsegment of consecutive elements in *a*, consisting of only numbers one, as *f*(*a*). You can change no more than *k* zeroes to ones to maximize *f*(*a*).
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=3·105,<=0<=≤<=*k*<=≤<=*n*) — the number of elements in *a* and the parameter *k*.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1) — the elements of *a*.
Output Specification:
On the first line print a non-negative integer *z* — the maximal value of *f*(*a*) after no more than *k* changes of zeroes to ones.
On the second line print *n* integers *a**j* — the elements of the array *a* after the changes.
If there are multiple answers, you can print any one of them.
Demo Input:
['7 1\n1 0 0 1 1 0 1\n', '10 2\n1 0 0 1 0 1 0 1 0 1\n']
Demo Output:
['4\n1 0 0 1 1 1 1\n', '5\n1 0 0 1 1 1 1 1 0 1\n']
Note:
none | ```python
n, k = map(int, input().split())
elements = list(map(int, input().split()))
left_pointer = 0 # Left pointer of the sliding window
max_length = 0 # Maximum length of the subsegment
zero_count = 0 # Count of zeroes in the current subsegment
for right_pointer in range(n):
if elements[right_pointer] == 0:
zero_count += 1
# If the number of zeroes in the current window exceeds k, move the left pointer
while zero_count > k:
if elements[left_pointer] == 0:
zero_count -= 1
left_pointer += 1
# Update the maximum length
max_length = max(max_length, right_pointer - left_pointer + 1)
print(max_length)
``` | 0 |
|
309 | A | Morning run | PROGRAMMING | 2,000 | [
"binary search",
"math",
"two pointers"
] | null | null | People like to be fit. That's why many of them are ready to wake up at dawn, go to the stadium and run. In this problem your task is to help a company design a new stadium.
The city of N has a shabby old stadium. Many people like it and every morning thousands of people come out to this stadium to run. The stadium can be represented as a circle, its length is exactly *l* meters with a marked start line. However, there can't be simultaneous start in the morning, so exactly at 7, each runner goes to his favorite spot on the stadium and starts running from there. Note that not everybody runs in the same manner as everybody else. Some people run in the clockwise direction, some of them run in the counter-clockwise direction. It mostly depends on the runner's mood in the morning, so you can assume that each running direction is equiprobable for each runner in any fixed morning.
The stadium is tiny and is in need of major repair, for right now there only is one running track! You can't get too playful on a single track, that's why all runners keep the same running speed — exactly 1 meter per a time unit. Nevertheless, the runners that choose different directions bump into each other as they meet.
The company wants to design a new stadium, but they first need to know how bad the old one is. For that they need the expectation of the number of bumpings by *t* time units after the running has begun. Help the company count the required expectation. Note that each runner chooses a direction equiprobably, independently from the others and then all runners start running simultaneously at 7 a.m. Assume that each runner runs for *t* time units without stopping. Consider the runners to bump at a certain moment if at that moment they found themselves at the same point in the stadium. A pair of runners can bump more than once. | The first line of the input contains three integers *n*, *l*, *t* (1<=≤<=*n*<=≤<=106,<=1<=≤<=*l*<=≤<=109,<=1<=≤<=*t*<=≤<=109). The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=<<=*l*), here *a**i* is the clockwise distance from the start line to the *i*-th runner's starting position. | Print a single real number — the answer to the problem with absolute or relative error of at most 10<=-<=6. | [
"2 5 1\n0 2\n",
"3 7 3\n0 1 6\n"
] | [
"0.2500000000\n",
"1.5000000000\n"
] | There are two runners in the first example. If the first runner run clockwise direction, then in 1 time unit he will be 1m away from the start line. If the second runner run counter-clockwise direction then in 1 time unit he will be also 1m away from the start line. And it is the only possible way to meet. We assume that each running direction is equiprobable, so the answer for the example is equal to 0.5·0.5 = 0.25. | 500 | [] | 1,689,434,564 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | print("_RANDOM_GUESS_1689434564.5995135")# 1689434564.5995345 | Title: Morning run
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
People like to be fit. That's why many of them are ready to wake up at dawn, go to the stadium and run. In this problem your task is to help a company design a new stadium.
The city of N has a shabby old stadium. Many people like it and every morning thousands of people come out to this stadium to run. The stadium can be represented as a circle, its length is exactly *l* meters with a marked start line. However, there can't be simultaneous start in the morning, so exactly at 7, each runner goes to his favorite spot on the stadium and starts running from there. Note that not everybody runs in the same manner as everybody else. Some people run in the clockwise direction, some of them run in the counter-clockwise direction. It mostly depends on the runner's mood in the morning, so you can assume that each running direction is equiprobable for each runner in any fixed morning.
The stadium is tiny and is in need of major repair, for right now there only is one running track! You can't get too playful on a single track, that's why all runners keep the same running speed — exactly 1 meter per a time unit. Nevertheless, the runners that choose different directions bump into each other as they meet.
The company wants to design a new stadium, but they first need to know how bad the old one is. For that they need the expectation of the number of bumpings by *t* time units after the running has begun. Help the company count the required expectation. Note that each runner chooses a direction equiprobably, independently from the others and then all runners start running simultaneously at 7 a.m. Assume that each runner runs for *t* time units without stopping. Consider the runners to bump at a certain moment if at that moment they found themselves at the same point in the stadium. A pair of runners can bump more than once.
Input Specification:
The first line of the input contains three integers *n*, *l*, *t* (1<=≤<=*n*<=≤<=106,<=1<=≤<=*l*<=≤<=109,<=1<=≤<=*t*<=≤<=109). The next line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=<<=*l*), here *a**i* is the clockwise distance from the start line to the *i*-th runner's starting position.
Output Specification:
Print a single real number — the answer to the problem with absolute or relative error of at most 10<=-<=6.
Demo Input:
['2 5 1\n0 2\n', '3 7 3\n0 1 6\n']
Demo Output:
['0.2500000000\n', '1.5000000000\n']
Note:
There are two runners in the first example. If the first runner run clockwise direction, then in 1 time unit he will be 1m away from the start line. If the second runner run counter-clockwise direction then in 1 time unit he will be also 1m away from the start line. And it is the only possible way to meet. We assume that each running direction is equiprobable, so the answer for the example is equal to 0.5·0.5 = 0.25. | ```python
print("_RANDOM_GUESS_1689434564.5995135")# 1689434564.5995345
``` | 0 |
|
729 | B | Spotlights | PROGRAMMING | 1,200 | [
"dp",
"implementation"
] | null | null | Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ. | The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan. | Print one integer — the number of good positions for placing the spotlight. | [
"2 4\n0 1 0 0\n1 0 1 0\n",
"4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n"
] | [
"9\n",
"20\n"
] | In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example. | 1,000 | [
{
"input": "2 4\n0 1 0 0\n1 0 1 0",
"output": "9"
},
{
"input": "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0",
"output": "20"
},
{
"input": "1 5\n1 1 0 0 0",
"output": "3"
},
{
"input": "2 10\n0 0 0 0 0 0 0 1 0 0\n1 0 0 0 0 0 0 0 0 0",
"output": "20"
},
{
"input": "3 1\n1\n0\n0",
"output": "2"
},
{
"input": "5 7\n0 0 0 0 0 0 1\n0 0 0 0 0 0 1\n0 0 0 1 0 0 0\n0 0 0 0 0 0 0\n0 0 0 0 0 0 0",
"output": "25"
},
{
"input": "10 20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "5 7\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1\n0 1 1 1 1 1 1\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1",
"output": "26"
},
{
"input": "10 20\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "121"
},
{
"input": "1 2\n0 1",
"output": "1"
},
{
"input": "1 2\n1 0",
"output": "1"
},
{
"input": "1 2\n1 1",
"output": "0"
},
{
"input": "2 1\n1\n0",
"output": "1"
},
{
"input": "2 1\n0\n1",
"output": "1"
},
{
"input": "2 1\n1\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "4 4\n1 1 1 1\n1 0 0 1\n1 0 0 1\n1 1 1 1",
"output": "16"
}
] | 1,584,870,861 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 6 | 1,000 | 15,667,200 | n,m = map(int,input().split())
stage_matrix = []
dp_row = [[0 for i in range(m+1)] for j in range(n+1)]
dp_col = [[0 for i in range(n+1)] for j in range(m+1)]
for i in range(n):
stage_matrix.append(list(map(int,input().split())))
for i in range(1,n+1):
for j in range(1,m+1):
if stage_matrix[i-1][j-1] == 1:
dp_row[i][j] = dp_row[i][j-1] + 1
else:
dp_row[i][j] = dp_row[i][j-1]
for i in range(1,m+1):
for j in range(1,n+1):
if stage_matrix[j-1][i-1] == 1:
dp_col[i][j] = dp_col[i][j-1] + 1
else:
dp_col[i][j] = dp_col[i][j-1]
c = 0
for i in range(n):
for j in range(m):
if stage_matrix[i][j] == 0:
if dp_col[j+1][i] > 0:
c = c + 1
if dp_col[j+1][n] - dp_col[j+1][i+1] > 0:
c = c + 1
if dp_row[i+1][j] != 0:
c = c + 1
if dp_row[i+1][m] - dp_row[i+1][j+1] != 0:
c = c + 1
print(c) | Title: Spotlights
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
Input Specification:
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
Output Specification:
Print one integer — the number of good positions for placing the spotlight.
Demo Input:
['2 4\n0 1 0 0\n1 0 1 0\n', '4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n']
Demo Output:
['9\n', '20\n']
Note:
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example. | ```python
n,m = map(int,input().split())
stage_matrix = []
dp_row = [[0 for i in range(m+1)] for j in range(n+1)]
dp_col = [[0 for i in range(n+1)] for j in range(m+1)]
for i in range(n):
stage_matrix.append(list(map(int,input().split())))
for i in range(1,n+1):
for j in range(1,m+1):
if stage_matrix[i-1][j-1] == 1:
dp_row[i][j] = dp_row[i][j-1] + 1
else:
dp_row[i][j] = dp_row[i][j-1]
for i in range(1,m+1):
for j in range(1,n+1):
if stage_matrix[j-1][i-1] == 1:
dp_col[i][j] = dp_col[i][j-1] + 1
else:
dp_col[i][j] = dp_col[i][j-1]
c = 0
for i in range(n):
for j in range(m):
if stage_matrix[i][j] == 0:
if dp_col[j+1][i] > 0:
c = c + 1
if dp_col[j+1][n] - dp_col[j+1][i+1] > 0:
c = c + 1
if dp_row[i+1][j] != 0:
c = c + 1
if dp_row[i+1][m] - dp_row[i+1][j+1] != 0:
c = c + 1
print(c)
``` | 0 |
|
160 | A | Twins | PROGRAMMING | 900 | [
"greedy",
"sortings"
] | null | null | Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner. | The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces. | In the single line print the single number — the minimum needed number of coins. | [
"2\n3 3\n",
"3\n2 1 2\n"
] | [
"2\n",
"2\n"
] | In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2. | 500 | [
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "5\n4 2 2 2 2",
"output": "3"
},
{
"input": "7\n1 10 1 2 1 1 1",
"output": "1"
},
{
"input": "5\n3 2 3 3 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "4"
},
{
"input": "7\n10 10 5 5 5 5 1",
"output": "3"
},
{
"input": "20\n2 1 2 2 2 1 1 2 1 2 2 1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "20\n4 2 4 4 3 4 2 2 4 2 3 1 1 2 2 3 3 3 1 4",
"output": "8"
},
{
"input": "20\n35 26 41 40 45 46 22 26 39 23 11 15 47 42 18 15 27 10 45 40",
"output": "8"
},
{
"input": "20\n7 84 100 10 31 35 41 2 63 44 57 4 63 11 23 49 98 71 16 90",
"output": "6"
},
{
"input": "50\n19 2 12 26 17 27 10 26 17 17 5 24 11 15 3 9 16 18 19 1 25 23 18 6 2 7 25 7 21 25 13 29 16 9 25 3 14 30 18 4 10 28 6 10 8 2 2 4 8 28",
"output": "14"
},
{
"input": "70\n2 18 18 47 25 5 14 9 19 46 36 49 33 32 38 23 32 39 8 29 31 17 24 21 10 15 33 37 46 21 22 11 20 35 39 13 11 30 28 40 39 47 1 17 24 24 21 46 12 2 20 43 8 16 44 11 45 10 13 44 31 45 45 46 11 10 33 35 23 42",
"output": "22"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "51"
},
{
"input": "100\n1 2 2 1 2 1 1 2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 1 1 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 1 1 2 1 1 1 1 2 2 2 2",
"output": "37"
},
{
"input": "100\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2",
"output": "36"
},
{
"input": "100\n5 5 4 3 5 1 2 5 1 1 3 5 4 4 1 1 1 1 5 4 4 5 1 5 5 1 2 1 3 1 5 1 3 3 3 2 2 2 1 1 5 1 3 4 1 1 3 2 5 2 2 5 5 4 4 1 3 4 3 3 4 5 3 3 3 1 2 1 4 2 4 4 1 5 1 3 5 5 5 5 3 4 4 3 1 2 5 2 3 5 4 2 4 5 3 2 4 2 4 3",
"output": "33"
},
{
"input": "100\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2",
"output": "30"
},
{
"input": "100\n16 9 11 8 11 4 9 17 4 8 4 10 9 10 6 3 3 15 1 6 1 15 12 18 6 14 13 18 1 7 18 4 10 7 10 12 3 16 14 4 10 8 10 7 19 13 15 1 4 8 16 10 6 4 3 16 11 10 7 3 4 16 1 20 1 11 4 16 10 7 7 12 18 19 3 17 19 3 4 19 2 12 11 3 18 20 2 2 14 4 20 13 13 11 16 20 19 14 7 2",
"output": "29"
},
{
"input": "100\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1",
"output": "30"
},
{
"input": "100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52",
"output": "29"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "30"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n4 1 2 3",
"output": "2"
},
{
"input": "5\n2 2 2 4 4",
"output": "2"
},
{
"input": "4\n100 99 99 100",
"output": "2"
}
] | 1,697,466,376 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | a=int(input())
b=list(map(int,input().split()))
b.sort()
d=sum(b)
c=[]
for n in range(len(b)):
if sum(c)<=d-sum(c):
c.append(b[n])
print(c)
| Title: Twins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
Output Specification:
In the single line print the single number — the minimum needed number of coins.
Demo Input:
['2\n3 3\n', '3\n2 1 2\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2. | ```python
a=int(input())
b=list(map(int,input().split()))
b.sort()
d=sum(b)
c=[]
for n in range(len(b)):
if sum(c)<=d-sum(c):
c.append(b[n])
print(c)
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Levko has an array that consists of integers: *a*1,<=*a*2,<=... ,<=*a**n*. But he doesn’t like this array at all.
Levko thinks that the beauty of the array *a* directly depends on value *c*(*a*), which can be calculated by the formula:
It’s time to change the world and Levko is going to change his array for the better. To be exact, Levko wants to change the values of at most *k* array elements (it is allowed to replace the values by any integers). Of course, the changes should make the array as beautiful as possible.
Help Levko and calculate what minimum number *c*(*a*) he can reach. | The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2000). The second line contains space-separated integers *a*1,<=*a*2,<=... ,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109). | A single number — the minimum value of *c*(*a*) Levko can get. | [
"5 2\n4 7 4 7 4\n",
"3 1\n-100 0 100\n",
"6 3\n1 2 3 7 8 9\n"
] | [
"0\n",
"100\n",
"1\n"
] | In the first sample Levko can change the second and fourth elements and get array: 4, 4, 4, 4, 4.
In the third sample he can get array: 1, 2, 3, 4, 5, 6. | 0 | [
{
"input": "5 2\n4 7 4 7 4",
"output": "0"
},
{
"input": "3 1\n-100 0 100",
"output": "100"
},
{
"input": "6 3\n1 2 3 7 8 9",
"output": "1"
},
{
"input": "4 1\n-1000000000 -1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "10 1\n-6 5 -7 -7 -7 -7 5 -9 4 7",
"output": "12"
},
{
"input": "20 17\n-5 -9 11 -7 -17 -8 0 -14 -20 -15 7 -13 0 -3 -14 0 9 -10 6 -19",
"output": "0"
},
{
"input": "5 1\n-1000000000 1000000000 -1000000000 1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "16 13\n441427217 689669074 -194425155 750543104 6572770 -417122148 483768301 -687067832 703108904 -4865435 -626501708 -222868350 692734658 667640778 259672206 418102760",
"output": "2593562"
},
{
"input": "1 1\n3243243",
"output": "0"
},
{
"input": "1 1\n-1000000000",
"output": "0"
},
{
"input": "2 1\n1234234 -3434",
"output": "0"
},
{
"input": "2 2\n1 5",
"output": "0"
},
{
"input": "4 1\n100 0 7 0",
"output": "7"
}
] | 1,608,157,631 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 10 | 2,000 | 3,276,800 | import sys
import math
MAX = int(1e9)
MIN = int(1e9)
N = 2000
def reset(dp):
for i in range(1, N):
# Can always change all preceding entries
dp[i] = i
def check(n, k, arr, c, dp):
# dp[i]: minimum # of changes to make cost <= c from 0..i and i is unchanged.
reset(dp)
for i in range(1, n):
for j in range(0, i):
# Number of changeable spaces I have
have = i - j - 1
# Nicer check that intervals of length c can cover the range
if abs(arr[i] - arr[j]) <= c * (i - j):
dp[i] = min(dp[i], dp[j] + have)
for i in range(n):
# A solution must have a first unchanged element from the right
# Treat i as such and see if it works
if dp[i] + n - i - 1 <= k:
return True
return False
def main():
# Parse input
lines = sys.stdin.readlines()
l1, l2 = lines[0], lines[1]
n, k = [int(x) for x in l1.strip().split(' ')]
arr = [int(x) for x in l2.strip().split(' ')]
dp = [0 for _ in range(N)]
# Binary search on c
lo = 0
hi = 2 * MAX
while lo < hi:
c = (lo + hi) // 2
valid = check(n, k, arr, c, dp)
if valid:
hi = c
else:
lo = c + 1
print(lo)
if __name__ == '__main__':
main()
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko has an array that consists of integers: *a*1,<=*a*2,<=... ,<=*a**n*. But he doesn’t like this array at all.
Levko thinks that the beauty of the array *a* directly depends on value *c*(*a*), which can be calculated by the formula:
It’s time to change the world and Levko is going to change his array for the better. To be exact, Levko wants to change the values of at most *k* array elements (it is allowed to replace the values by any integers). Of course, the changes should make the array as beautiful as possible.
Help Levko and calculate what minimum number *c*(*a*) he can reach.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2000). The second line contains space-separated integers *a*1,<=*a*2,<=... ,<=*a**n* (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
A single number — the minimum value of *c*(*a*) Levko can get.
Demo Input:
['5 2\n4 7 4 7 4\n', '3 1\n-100 0 100\n', '6 3\n1 2 3 7 8 9\n']
Demo Output:
['0\n', '100\n', '1\n']
Note:
In the first sample Levko can change the second and fourth elements and get array: 4, 4, 4, 4, 4.
In the third sample he can get array: 1, 2, 3, 4, 5, 6. | ```python
import sys
import math
MAX = int(1e9)
MIN = int(1e9)
N = 2000
def reset(dp):
for i in range(1, N):
# Can always change all preceding entries
dp[i] = i
def check(n, k, arr, c, dp):
# dp[i]: minimum # of changes to make cost <= c from 0..i and i is unchanged.
reset(dp)
for i in range(1, n):
for j in range(0, i):
# Number of changeable spaces I have
have = i - j - 1
# Nicer check that intervals of length c can cover the range
if abs(arr[i] - arr[j]) <= c * (i - j):
dp[i] = min(dp[i], dp[j] + have)
for i in range(n):
# A solution must have a first unchanged element from the right
# Treat i as such and see if it works
if dp[i] + n - i - 1 <= k:
return True
return False
def main():
# Parse input
lines = sys.stdin.readlines()
l1, l2 = lines[0], lines[1]
n, k = [int(x) for x in l1.strip().split(' ')]
arr = [int(x) for x in l2.strip().split(' ')]
dp = [0 for _ in range(N)]
# Binary search on c
lo = 0
hi = 2 * MAX
while lo < hi:
c = (lo + hi) // 2
valid = check(n, k, arr, c, dp)
if valid:
hi = c
else:
lo = c + 1
print(lo)
if __name__ == '__main__':
main()
``` | 0 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,617,603,418 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 124 | 0 | M, N = input().split()
M, N = int(M), int(N)
A1= int(M*N/2)
if M <= N: print(A1)
| Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
M, N = input().split()
M, N = int(M), int(N)
A1= int(M*N/2)
if M <= N: print(A1)
``` | 3.969 |
0 | none | none | none | 0 | [
"none"
] | null | null | Little Nastya has a hobby, she likes to remove some letters from word, to obtain another word. But it turns out to be pretty hard for her, because she is too young. Therefore, her brother Sergey always helps her.
Sergey gives Nastya the word *t* and wants to get the word *p* out of it. Nastya removes letters in a certain order (one after another, in this order strictly), which is specified by permutation of letters' indices of the word *t*: *a*1... *a*|*t*|. We denote the length of word *x* as |*x*|. Note that after removing one letter, the indices of other letters don't change. For example, if *t*<==<="nastya" and *a*<==<=[4,<=1,<=5,<=3,<=2,<=6] then removals make the following sequence of words "nastya" "nastya" "nastya" "nastya" "nastya" "nastya" "nastya".
Sergey knows this permutation. His goal is to stop his sister at some point and continue removing by himself to get the word *p*. Since Nastya likes this activity, Sergey wants to stop her as late as possible. Your task is to determine, how many letters Nastya can remove before she will be stopped by Sergey.
It is guaranteed that the word *p* can be obtained by removing the letters from word *t*. | The first and second lines of the input contain the words *t* and *p*, respectively. Words are composed of lowercase letters of the Latin alphabet (1<=≤<=|*p*|<=<<=|*t*|<=≤<=200<=000). It is guaranteed that the word *p* can be obtained by removing the letters from word *t*.
Next line contains a permutation *a*1,<=*a*2,<=...,<=*a*|*t*| of letter indices that specifies the order in which Nastya removes letters of *t* (1<=≤<=*a**i*<=≤<=|*t*|, all *a**i* are distinct). | Print a single integer number, the maximum number of letters that Nastya can remove. | [
"ababcba\nabb\n5 3 4 1 7 6 2\n",
"bbbabb\nbb\n1 6 3 4 2 5\n"
] | [
"3",
"4"
] | In the first sample test sequence of removing made by Nastya looks like this:
"ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba"
Nastya can not continue, because it is impossible to get word "abb" from word "ababcba".
So, Nastya will remove only three letters. | 0 | [
{
"input": "ababcba\nabb\n5 3 4 1 7 6 2",
"output": "3"
},
{
"input": "bbbabb\nbb\n1 6 3 4 2 5",
"output": "4"
},
{
"input": "cacaccccccacccc\ncacc\n10 9 14 5 1 7 15 3 6 12 4 8 11 13 2",
"output": "9"
},
{
"input": "aaaabaaabaabaaaaaaaa\naaaa\n18 5 4 6 13 9 1 3 7 8 16 10 12 19 17 15 14 11 20 2",
"output": "16"
},
{
"input": "aaaaaaaadbaaabbbbbddaaabdadbbbbbdbbabbbabaabdbbdababbbddddbdaabbddbbbbabbbbbabadaadabaaaadbbabbbaddb\naaaaaaaaaaaaaa\n61 52 5 43 53 81 7 96 6 9 34 78 79 12 8 63 22 76 18 46 41 56 3 20 57 21 75 73 100 94 35 69 32 4 70 95 88 44 68 10 71 98 23 89 36 62 28 51 24 30 74 55 27 80 38 48 93 1 19 84 13 11 86 60 87 33 39 29 83 91 67 72 54 2 17 85 82 14 15 90 64 50 99 26 66 65 31 49 40 45 77 37 25 42 97 47 58 92 59 16",
"output": "57"
}
] | 1,488,111,461 | 2,147,483,647 | Python 3 | OK | TESTS | 43 | 1,356 | 19,456,000 | a = input()
b = input()
p = list(map(int, input().split()))
for i in range(len(p)):
p[i] -= 1
def good(m):
pos = 0
a1 = list(a)
for i in range(m):
a1[p[i]] = "#"
for i in range(len(a1)):
if a1[i] == b[pos]:
pos += 1
if pos == len(b):
return True
return False
l = 0
r = len(a)
while r - l > 1:
m = (l + r) // 2
if good(m):
l = m
else:
r = m
print(l) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Nastya has a hobby, she likes to remove some letters from word, to obtain another word. But it turns out to be pretty hard for her, because she is too young. Therefore, her brother Sergey always helps her.
Sergey gives Nastya the word *t* and wants to get the word *p* out of it. Nastya removes letters in a certain order (one after another, in this order strictly), which is specified by permutation of letters' indices of the word *t*: *a*1... *a*|*t*|. We denote the length of word *x* as |*x*|. Note that after removing one letter, the indices of other letters don't change. For example, if *t*<==<="nastya" and *a*<==<=[4,<=1,<=5,<=3,<=2,<=6] then removals make the following sequence of words "nastya" "nastya" "nastya" "nastya" "nastya" "nastya" "nastya".
Sergey knows this permutation. His goal is to stop his sister at some point and continue removing by himself to get the word *p*. Since Nastya likes this activity, Sergey wants to stop her as late as possible. Your task is to determine, how many letters Nastya can remove before she will be stopped by Sergey.
It is guaranteed that the word *p* can be obtained by removing the letters from word *t*.
Input Specification:
The first and second lines of the input contain the words *t* and *p*, respectively. Words are composed of lowercase letters of the Latin alphabet (1<=≤<=|*p*|<=<<=|*t*|<=≤<=200<=000). It is guaranteed that the word *p* can be obtained by removing the letters from word *t*.
Next line contains a permutation *a*1,<=*a*2,<=...,<=*a*|*t*| of letter indices that specifies the order in which Nastya removes letters of *t* (1<=≤<=*a**i*<=≤<=|*t*|, all *a**i* are distinct).
Output Specification:
Print a single integer number, the maximum number of letters that Nastya can remove.
Demo Input:
['ababcba\nabb\n5 3 4 1 7 6 2\n', 'bbbabb\nbb\n1 6 3 4 2 5\n']
Demo Output:
['3', '4']
Note:
In the first sample test sequence of removing made by Nastya looks like this:
"ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba"
Nastya can not continue, because it is impossible to get word "abb" from word "ababcba".
So, Nastya will remove only three letters. | ```python
a = input()
b = input()
p = list(map(int, input().split()))
for i in range(len(p)):
p[i] -= 1
def good(m):
pos = 0
a1 = list(a)
for i in range(m):
a1[p[i]] = "#"
for i in range(len(a1)):
if a1[i] == b[pos]:
pos += 1
if pos == len(b):
return True
return False
l = 0
r = len(a)
while r - l > 1:
m = (l + r) // 2
if good(m):
l = m
else:
r = m
print(l)
``` | 3 |
|
867 | A | Between the Offices | PROGRAMMING | 800 | [
"implementation"
] | null | null | As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. | The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. | Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower). | [
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] | [
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] | In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | 500 | [
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,679,816,337 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | def func(n,str):
c=0
m=0
q=list(str)
for i in range(len(q)-1):
if (q[i]+q[i+1])=="SF":
c=c+1
elif (q[i]+q[i+1])=="FS":
m=m+1
if c>m:
return "yes"
else:
return "no"
n=4
st="FSSF"
P=func(n,st)
| Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | ```python
def func(n,str):
c=0
m=0
q=list(str)
for i in range(len(q)-1):
if (q[i]+q[i+1])=="SF":
c=c+1
elif (q[i]+q[i+1])=="FS":
m=m+1
if c>m:
return "yes"
else:
return "no"
n=4
st="FSSF"
P=func(n,st)
``` | 0 |
|
687 | D | Dividing Kingdom II | PROGRAMMING | 2,500 | [
"brute force",
"data structures",
"dsu",
"graphs",
"sortings"
] | null | null | Long time ago, there was a great kingdom and it was being ruled by The Great Arya and Pari The Great. These two had some problems about the numbers they like, so they decided to divide the great kingdom between themselves.
The great kingdom consisted of *n* cities numbered from 1 to *n* and *m* bidirectional roads between these cities, numbered from 1 to *m*. The *i*-th road had length equal to *w**i*. The Great Arya and Pari The Great were discussing about destructing some prefix (all road with numbers less than some *x*) and suffix (all roads with numbers greater than some *x*) of the roads so there will remain only the roads with numbers *l*,<=*l*<=+<=1,<=...,<=*r*<=-<=1 and *r*.
After that they will divide the great kingdom into two pieces (with each city belonging to exactly one piece) such that the hardness of the division is minimized. The hardness of a division is the maximum length of a road such that its both endpoints are in the same piece of the kingdom. In case there is no such road, the hardness of the division is considered to be equal to <=-<=1.
Historians found the map of the great kingdom, and they have *q* guesses about the *l* and *r* chosen by those great rulers. Given these data, for each guess *l**i* and *r**i* print the minimum possible hardness of the division of the kingdom. | The first line of the input contains three integers *n*, *m* and *q* (1<=≤<=*n*,<=*q*<=≤<=1000, ) — the number of cities and roads in the great kingdom, and the number of guesses, respectively.
The *i*-th line of the following *m* lines contains three integers *u**i*,<=*v**i* and *w**i* (1<=<=≤<=<=*u**i*,<=<=*v**i*<=<=≤<=<=*n*,<=0<=≤<=*w**i*<=≤<=109), denoting the road number *i* connects cities *u**i* and *v**i* and its length is equal *w**i*. It's guaranteed that no road connects the city to itself and no pair of cities is connected by more than one road.
Each of the next *q* lines contains a pair of integers *l**i* and<=*r**i* (1<=<=≤<=*l**i*<=≤<=*r**i*<=≤<=*m*) — a guess from the historians about the remaining roads in the kingdom. | For each guess print the minimum possible hardness of the division in described scenario. | [
"5 6 5\n5 4 86\n5 1 0\n1 3 38\n2 1 33\n2 4 28\n2 3 40\n3 5\n2 6\n1 3\n2 3\n1 6\n"
] | [
"-1\n33\n-1\n-1\n33\n"
] | none | 2,000 | [] | 1,664,984,855 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 12 | 6,000 | 116,838,400 | from collections import deque
class UnionFind():
def __init__(self,size):
self.table = [-1 for _ in range(size)]
self.member_num = [1 for _ in range(size)]
#representative
#O(a(N))
def find(self,x):
Q = deque()
while self.table[x] >= 0:
Q.append(x)
x = self.table[x]
while len(Q)>0:
y = Q.pop()
self.table[y] = x
return x
def union(self,x,y):
s1 = self.find(x)
s2 = self.find(y)
m1=self.member_num[s1]
m2=self.member_num[s2]
if s1 != s2:
if m1 != m2:
if m1 < m2:
self.table[s1] = s2
self.member_num[s2]=m1+m2
return [m1,m2]
else:
self.table[s2] = s1
self.member_num[s1]=m1+m2
return [m1,m2]
else:
self.table[s1] = -1
self.table[s2] = s1
self.member_num[s1] = m1+m2
return [m1,m2]
return [0,0]
n,m,q = list(map(int,input().split()))
edges = []
for i in range(m):
edges.append(list(map(int,input().split())))
for i in range(q):
l,r = list(map(int,input().split()))
edges1 = edges[l-1:r]
edges1.sort(key=lambda x:x[2],reverse=True)
uf = UnionFind(2*n)
ans = -1
for u,v,w in edges1:
par1 = uf.find(u-1)
par2 = uf.find(v-1)
if par1==par2:
ans = w
break
par1 = uf.find(u-1)
par2 = uf.find(v+n-1)
if par1!=par2:
uf.union(u-1,v+n-1)
uf.union(u+n-1,v-1)
print(ans) | Title: Dividing Kingdom II
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Long time ago, there was a great kingdom and it was being ruled by The Great Arya and Pari The Great. These two had some problems about the numbers they like, so they decided to divide the great kingdom between themselves.
The great kingdom consisted of *n* cities numbered from 1 to *n* and *m* bidirectional roads between these cities, numbered from 1 to *m*. The *i*-th road had length equal to *w**i*. The Great Arya and Pari The Great were discussing about destructing some prefix (all road with numbers less than some *x*) and suffix (all roads with numbers greater than some *x*) of the roads so there will remain only the roads with numbers *l*,<=*l*<=+<=1,<=...,<=*r*<=-<=1 and *r*.
After that they will divide the great kingdom into two pieces (with each city belonging to exactly one piece) such that the hardness of the division is minimized. The hardness of a division is the maximum length of a road such that its both endpoints are in the same piece of the kingdom. In case there is no such road, the hardness of the division is considered to be equal to <=-<=1.
Historians found the map of the great kingdom, and they have *q* guesses about the *l* and *r* chosen by those great rulers. Given these data, for each guess *l**i* and *r**i* print the minimum possible hardness of the division of the kingdom.
Input Specification:
The first line of the input contains three integers *n*, *m* and *q* (1<=≤<=*n*,<=*q*<=≤<=1000, ) — the number of cities and roads in the great kingdom, and the number of guesses, respectively.
The *i*-th line of the following *m* lines contains three integers *u**i*,<=*v**i* and *w**i* (1<=<=≤<=<=*u**i*,<=<=*v**i*<=<=≤<=<=*n*,<=0<=≤<=*w**i*<=≤<=109), denoting the road number *i* connects cities *u**i* and *v**i* and its length is equal *w**i*. It's guaranteed that no road connects the city to itself and no pair of cities is connected by more than one road.
Each of the next *q* lines contains a pair of integers *l**i* and<=*r**i* (1<=<=≤<=*l**i*<=≤<=*r**i*<=≤<=*m*) — a guess from the historians about the remaining roads in the kingdom.
Output Specification:
For each guess print the minimum possible hardness of the division in described scenario.
Demo Input:
['5 6 5\n5 4 86\n5 1 0\n1 3 38\n2 1 33\n2 4 28\n2 3 40\n3 5\n2 6\n1 3\n2 3\n1 6\n']
Demo Output:
['-1\n33\n-1\n-1\n33\n']
Note:
none | ```python
from collections import deque
class UnionFind():
def __init__(self,size):
self.table = [-1 for _ in range(size)]
self.member_num = [1 for _ in range(size)]
#representative
#O(a(N))
def find(self,x):
Q = deque()
while self.table[x] >= 0:
Q.append(x)
x = self.table[x]
while len(Q)>0:
y = Q.pop()
self.table[y] = x
return x
def union(self,x,y):
s1 = self.find(x)
s2 = self.find(y)
m1=self.member_num[s1]
m2=self.member_num[s2]
if s1 != s2:
if m1 != m2:
if m1 < m2:
self.table[s1] = s2
self.member_num[s2]=m1+m2
return [m1,m2]
else:
self.table[s2] = s1
self.member_num[s1]=m1+m2
return [m1,m2]
else:
self.table[s1] = -1
self.table[s2] = s1
self.member_num[s1] = m1+m2
return [m1,m2]
return [0,0]
n,m,q = list(map(int,input().split()))
edges = []
for i in range(m):
edges.append(list(map(int,input().split())))
for i in range(q):
l,r = list(map(int,input().split()))
edges1 = edges[l-1:r]
edges1.sort(key=lambda x:x[2],reverse=True)
uf = UnionFind(2*n)
ans = -1
for u,v,w in edges1:
par1 = uf.find(u-1)
par2 = uf.find(v-1)
if par1==par2:
ans = w
break
par1 = uf.find(u-1)
par2 = uf.find(v+n-1)
if par1!=par2:
uf.union(u-1,v+n-1)
uf.union(u+n-1,v-1)
print(ans)
``` | 0 |
|
681 | A | A Good Contest | PROGRAMMING | 800 | [
"implementation"
] | null | null | Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same? | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct. | Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise. | [
"3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n",
"3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n"
] | [
"YES",
"NO"
] | In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest. | 500 | [
{
"input": "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "NO"
},
{
"input": "1\nDb -3373 3591",
"output": "NO"
},
{
"input": "5\nQ2bz 960 2342\nhmX 2710 -1348\ngbAe -1969 -963\nE -160 196\npsi 2665 -3155",
"output": "NO"
},
{
"input": "9\nmwAz9lQ 1786 -1631\nnYgYFXZQfY -1849 -1775\nKU4jF -1773 -3376\nopR 3752 2931\nGl -1481 -1002\nR -1111 3778\n0i9B21DC 3650 289\nQ8L2dS0 358 -3305\ng -2662 3968",
"output": "NO"
},
{
"input": "5\nzMSBcOUf -2883 -2238\nYN -3314 -1480\nfHpuccQn06 -1433 -589\naM1NVEPQi 399 3462\n_L 2516 -3290",
"output": "NO"
},
{
"input": "1\na 2400 2401",
"output": "YES"
},
{
"input": "1\nfucker 4000 4000",
"output": "NO"
},
{
"input": "1\nJora 2400 2401",
"output": "YES"
},
{
"input": "1\nACA 2400 2420",
"output": "YES"
},
{
"input": "1\nAca 2400 2420",
"output": "YES"
},
{
"input": "1\nSub_d 2401 2402",
"output": "YES"
},
{
"input": "2\nHack 2400 2401\nDum 1243 555",
"output": "YES"
},
{
"input": "1\nXXX 2400 2500",
"output": "YES"
},
{
"input": "1\nfucker 2400 2401",
"output": "YES"
},
{
"input": "1\nX 2400 2500",
"output": "YES"
},
{
"input": "1\nvineet 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2500",
"output": "YES"
},
{
"input": "1\naaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nhoge 2400 2401",
"output": "YES"
},
{
"input": "1\nInfinity 2400 2468",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2401",
"output": "YES"
},
{
"input": "1\nFuck 2400 2401",
"output": "YES"
},
{
"input": "1\nfuck 2400 2401",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2401\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "YES"
},
{
"input": "1\nalex 2400 2401",
"output": "YES"
},
{
"input": "1\nA 2400 2401",
"output": "YES"
},
{
"input": "1\na 2400 2455",
"output": "YES"
},
{
"input": "1\nlol 2400 2401",
"output": "YES"
},
{
"input": "2\nBurunduk1 2400 2537\nBudAlNik 2084 2214",
"output": "YES"
},
{
"input": "1\naaaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2500",
"output": "YES"
},
{
"input": "1\nds 2400 2410",
"output": "YES"
},
{
"input": "1\nas 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2401",
"output": "YES"
},
{
"input": "3\nBudAlNik 2084 2214\nsubscriber 2833 2749\nBurunduk1 2526 2537",
"output": "YES"
},
{
"input": "1\ncaonima 2400 2401",
"output": "YES"
},
{
"input": "1\narr 2400 2500",
"output": "YES"
},
{
"input": "1\nx 2400 2401",
"output": "YES"
},
{
"input": "1\narrr 2400 2500",
"output": "YES"
},
{
"input": "1\nabc 2400 2405",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2420\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2537",
"output": "YES"
},
{
"input": "1\nHELLO 2400 2401",
"output": "YES"
},
{
"input": "1\neatmore 2400 2500",
"output": "YES"
},
{
"input": "1\nb 2400 2401",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nApplejack 2400 2410",
"output": "YES"
},
{
"input": "1\nabacaba 2400 2451",
"output": "YES"
},
{
"input": "1\nrekt_n00b 2500 2600",
"output": "YES"
}
] | 1,646,972,552 | 2,147,483,647 | Python 3 | OK | TESTS | 60 | 31 | 0 | con=True
for _ in [0]*int(input()):
a=[*map(int,input().split()[1:])]
if a[0]>=2400 and a[1]>a[0] and con:print('YES');con=False
if con:print('NO') | Title: A Good Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
Output Specification:
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
Demo Input:
['3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n', '3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n']
Demo Output:
['YES', 'NO']
Note:
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest. | ```python
con=True
for _ in [0]*int(input()):
a=[*map(int,input().split()[1:])]
if a[0]>=2400 and a[1]>a[0] and con:print('YES');con=False
if con:print('NO')
``` | 3 |
|
378 | A | Playing with Dice | PROGRAMMING | 800 | [
"brute force"
] | null | null | Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins? | The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly. | Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly. | [
"2 5\n",
"2 4\n"
] | [
"3 0 3\n",
"2 1 3\n"
] | The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|. | 500 | [
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,603,986,543 | 2,147,483,647 | PyPy 3 | OK | TESTS | 38 | 140 | 0 | a,b=map(int,input().split())
c1,c2,c3=0,0,0
l=[]
for i in range(1,7):
l.append((abs(i-a),abs(i-b)))
for i in range(len(l)):
if(l[i][0]>l[i][1]):
c3+=1
elif(l[i][0]<l[i][1]):
c1+=1
else:
c2+=1
print(c1,c2,c3) | Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|. | ```python
a,b=map(int,input().split())
c1,c2,c3=0,0,0
l=[]
for i in range(1,7):
l.append((abs(i-a),abs(i-b)))
for i in range(len(l)):
if(l[i][0]>l[i][1]):
c3+=1
elif(l[i][0]<l[i][1]):
c1+=1
else:
c2+=1
print(c1,c2,c3)
``` | 3 |
|
507 | B | Amr and Pins | PROGRAMMING | 1,400 | [
"geometry",
"math"
] | null | null | Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps. | Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively. | Output a single integer — minimum number of steps required to move the center of the circle to the destination point. | [
"2 0 0 0 4\n",
"1 1 1 4 4\n",
"4 5 6 5 6\n"
] | [
"1\n",
"3\n",
"0\n"
] | In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 1,000 | [
{
"input": "2 0 0 0 4",
"output": "1"
},
{
"input": "1 1 1 4 4",
"output": "3"
},
{
"input": "4 5 6 5 6",
"output": "0"
},
{
"input": "10 20 0 40 0",
"output": "1"
},
{
"input": "9 20 0 40 0",
"output": "2"
},
{
"input": "5 -1 -6 -5 1",
"output": "1"
},
{
"input": "99125 26876 -21414 14176 17443",
"output": "1"
},
{
"input": "8066 7339 19155 -90534 -60666",
"output": "8"
},
{
"input": "100000 -100000 -100000 100000 100000",
"output": "2"
},
{
"input": "10 20 0 41 0",
"output": "2"
},
{
"input": "25 -64 -6 -56 64",
"output": "2"
},
{
"input": "125 455 450 439 721",
"output": "2"
},
{
"input": "5 6 3 7 2",
"output": "1"
},
{
"input": "24 130 14786 3147 2140",
"output": "271"
},
{
"input": "125 -363 176 93 330",
"output": "2"
},
{
"input": "1 14 30 30 14",
"output": "12"
},
{
"input": "25 96 13 7 2",
"output": "2"
},
{
"input": "4 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "1 3 4 2 5",
"output": "1"
},
{
"input": "1 -3 3 2 6",
"output": "3"
},
{
"input": "2 7 20 13 -5",
"output": "7"
},
{
"input": "1 1 1 1 4",
"output": "2"
},
{
"input": "249 -54242 -30537 -45023 -89682",
"output": "121"
},
{
"input": "4 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "97741 23818 78751 97583 26933",
"output": "1"
},
{
"input": "56767 -29030 51625 79823 -56297",
"output": "2"
},
{
"input": "98260 13729 74998 23701 9253",
"output": "1"
},
{
"input": "67377 -80131 -90254 -57320 14102",
"output": "1"
},
{
"input": "1 100000 100000 100000 -100000",
"output": "100000"
},
{
"input": "19312 19470 82059 58064 62231",
"output": "2"
},
{
"input": "67398 -68747 -79056 -34193 29400",
"output": "1"
},
{
"input": "91099 37184 -71137 75650 -3655",
"output": "1"
},
{
"input": "46456 -2621 -23623 -98302 -99305",
"output": "2"
},
{
"input": "100 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "1 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "8 0 0 0 32",
"output": "2"
},
{
"input": "100000 100000 1 -100000 0",
"output": "2"
}
] | 1,638,842,391 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | import math
r,x0,y0,x1,y1=map(int,input().split())
print(x0,y0,x1,y1)
d = math.sqrt((x1-x0)**2+(y1-y0)**2)
s = d/(r<<1)
print(d,s)
print(math.ceil(s))
| Title: Amr and Pins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
Input Specification:
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output Specification:
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
Demo Input:
['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n']
Demo Output:
['1\n', '3\n', '0\n']
Note:
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
import math
r,x0,y0,x1,y1=map(int,input().split())
print(x0,y0,x1,y1)
d = math.sqrt((x1-x0)**2+(y1-y0)**2)
s = d/(r<<1)
print(d,s)
print(math.ceil(s))
``` | 0 |
|
137 | B | Permutation | PROGRAMMING | 1,000 | [
"greedy"
] | null | null | "Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer). | The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*). | Print the only number — the minimum number of changes needed to get the permutation. | [
"3\n3 1 2\n",
"2\n2 2\n",
"5\n5 3 3 3 1\n"
] | [
"0\n",
"1\n",
"2\n"
] | The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2. | 1,000 | [
{
"input": "3\n3 1 2",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "5\n5 3 3 3 1",
"output": "2"
},
{
"input": "5\n6 6 6 6 6",
"output": "5"
},
{
"input": "10\n1 1 2 2 8 8 7 7 9 9",
"output": "5"
},
{
"input": "8\n9 8 7 6 5 4 3 2",
"output": "1"
},
{
"input": "15\n1 2 3 4 5 5 4 3 2 1 1 2 3 4 5",
"output": "10"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n5000",
"output": "1"
},
{
"input": "4\n5000 5000 5000 5000",
"output": "4"
},
{
"input": "5\n3366 3461 4 5 4370",
"output": "3"
},
{
"input": "10\n8 2 10 3 4 6 1 7 9 5",
"output": "0"
},
{
"input": "10\n551 3192 3213 2846 3068 1224 3447 1 10 9",
"output": "7"
},
{
"input": "15\n4 1459 12 4281 3241 2748 10 3590 14 845 3518 1721 2 2880 1974",
"output": "10"
},
{
"input": "15\n15 1 8 2 13 11 12 7 3 14 6 10 9 4 5",
"output": "0"
},
{
"input": "15\n2436 2354 4259 1210 2037 2665 700 3578 2880 973 1317 1024 24 3621 4142",
"output": "15"
},
{
"input": "30\n28 1 3449 9 3242 4735 26 3472 15 21 2698 7 4073 3190 10 3 29 1301 4526 22 345 3876 19 12 4562 2535 2 630 18 27",
"output": "14"
},
{
"input": "100\n50 39 95 30 66 78 2169 4326 81 31 74 34 80 40 19 48 97 63 82 6 88 16 21 57 92 77 10 1213 17 93 32 91 38 4375 29 75 44 22 4 45 14 2395 3254 59 3379 2 85 96 8 83 27 94 1512 2960 100 9 73 79 7 25 55 69 90 99 51 87 98 62 18 35 43 4376 4668 28 72 56 4070 61 65 36 54 4106 11 24 15 86 70 71 4087 23 13 76 20 4694 26 4962 4726 37 14 64",
"output": "18"
},
{
"input": "100\n340 14 3275 2283 2673 1107 817 2243 1226 32 2382 3638 4652 418 68 4962 387 764 4647 159 1846 225 2760 4904 3150 403 3 2439 91 4428 92 4705 75 348 1566 1465 69 6 49 4 62 4643 564 1090 3447 1871 2255 139 24 99 2669 969 86 61 4550 158 4537 3993 1589 872 2907 1888 401 80 1825 1483 63 1 2264 4068 4113 2548 41 885 4806 36 67 167 4447 34 1248 2593 82 202 81 1783 1284 4973 16 43 95 7 865 2091 3008 1793 20 947 4912 3604",
"output": "70"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "2\n5000 5000",
"output": "2"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 3",
"output": "1"
},
{
"input": "2\n3 4",
"output": "2"
},
{
"input": "10\n1 2 3 4 5 6 7 1000 10 10",
"output": "2"
}
] | 1,589,718,399 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 218 | 20,172,800 | n = int(input())
num = list(map(int, input().split(" ")))
aux = map(lambda x: 1 if x > n else 1, num)
print(sum(aux))
| Title: Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
Input Specification:
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*).
Output Specification:
Print the only number — the minimum number of changes needed to get the permutation.
Demo Input:
['3\n3 1 2\n', '2\n2 2\n', '5\n5 3 3 3 1\n']
Demo Output:
['0\n', '1\n', '2\n']
Note:
The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2. | ```python
n = int(input())
num = list(map(int, input().split(" ")))
aux = map(lambda x: 1 if x > n else 1, num)
print(sum(aux))
``` | 0 |
|
460 | A | Vasya and Socks | PROGRAMMING | 900 | [
"brute force",
"implementation",
"math"
] | null | null | Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? | The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space. | Print a single integer — the answer to the problem. | [
"2 2\n",
"9 3\n"
] | [
"3\n",
"13\n"
] | In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day. | 500 | [
{
"input": "2 2",
"output": "3"
},
{
"input": "9 3",
"output": "13"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "1 99",
"output": "1"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "10 2",
"output": "19"
},
{
"input": "10 9",
"output": "11"
},
{
"input": "100 100",
"output": "101"
},
{
"input": "2 27",
"output": "2"
},
{
"input": "99 100",
"output": "99"
},
{
"input": "99 2",
"output": "197"
},
{
"input": "100 3",
"output": "149"
},
{
"input": "98 3",
"output": "146"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "100 2",
"output": "199"
},
{
"input": "62 4",
"output": "82"
},
{
"input": "99 10",
"output": "109"
},
{
"input": "100 5",
"output": "124"
},
{
"input": "80 80",
"output": "81"
},
{
"input": "95 16",
"output": "101"
},
{
"input": "75 16",
"output": "79"
},
{
"input": "99 74",
"output": "100"
},
{
"input": "20 21",
"output": "20"
},
{
"input": "52 96",
"output": "52"
},
{
"input": "24 5",
"output": "29"
}
] | 1,638,623,807 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 6 | 31 | 0 | n, m = map(int, input().split())
day = 0
x = n + n // m
y = x // m + n
#while x > 0:
# x = x - 1
# day = day + 1
print(y) | Title: Vasya and Socks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
Input Specification:
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['2 2\n', '9 3\n']
Demo Output:
['3\n', '13\n']
Note:
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day. | ```python
n, m = map(int, input().split())
day = 0
x = n + n // m
y = x // m + n
#while x > 0:
# x = x - 1
# day = day + 1
print(y)
``` | 0 |
|
322 | A | Ciel and Dancing | PROGRAMMING | 1,000 | [
"greedy"
] | null | null | Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible. | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room. | In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*. | [
"2 1\n",
"2 2\n"
] | [
"2\n1 1\n2 1\n",
"3\n1 1\n1 2\n2 2\n"
] | In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3. | 500 | [
{
"input": "2 1",
"output": "2\n1 1\n2 1"
},
{
"input": "2 2",
"output": "3\n1 1\n1 2\n2 2"
},
{
"input": "1 1",
"output": "1\n1 1"
},
{
"input": "2 3",
"output": "4\n1 1\n1 2\n1 3\n2 3"
},
{
"input": "4 4",
"output": "7\n1 1\n1 2\n1 3\n1 4\n4 4\n3 4\n2 4"
},
{
"input": "1 12",
"output": "12\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12"
},
{
"input": "12 1",
"output": "12\n1 1\n12 1\n11 1\n10 1\n9 1\n8 1\n7 1\n6 1\n5 1\n4 1\n3 1\n2 1"
},
{
"input": "100 100",
"output": "199\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "24 6",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n24 6\n23 6\n22 6\n21 6\n20 6\n19 6\n18 6\n17 6\n16 6\n15 6\n14 6\n13 6\n12 6\n11 6\n10 6\n9 6\n8 6\n7 6\n6 6\n5 6\n4 6\n3 6\n2 6"
},
{
"input": "7 59",
"output": "65\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n7 59\n6 59\n5 59\n4 59\n3 59\n2 59"
},
{
"input": "26 75",
"output": "100\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n26 75\n25 75\n24 75\n23 75\n22 75\n21 75\n20 75\n19 75\n18 75\n17..."
},
{
"input": "32 87",
"output": "118\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 51",
"output": "92\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n42 51\n41 51\n40 51\n39 51\n38 51\n37 51\n36 51\n35 51\n34 51\n33 51\n32 51\n31 51\n30 51\n29 51\n28 51\n27 51\n26 51\n25 51\n24 51\n23 51\n22 51\n21 51\n20 51\n19 51\n18 51\n17 51\n16 51\n15 51\n14 51\n13 51\n..."
},
{
"input": "4 63",
"output": "66\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n4 63\n3 63\n2 63"
},
{
"input": "10 79",
"output": "88\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n10 79\n9 79\n8 79\n7 79\n6 79\n5 79\n4 79\n..."
},
{
"input": "20 95",
"output": "114\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "35 55",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n35 55\n34 55\n33 55\n32 55\n31 55\n30 55\n29 55\n28 55\n27 55\n26 55\n25 55\n24 55\n23 55\n22 55\n21 55\n20 55\n19 55\n18 55\n17 55\n16 55\n15 55\n14 55\n13 55\n12 55\n11 55\n10 55\n9 55..."
},
{
"input": "45 71",
"output": "115\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n45 71\n44 71\n43 71\n42 71\n41 71\n40 71\n39 71\n38 71\n37 71\n36 71\n35 71\n34 71\n33 71..."
},
{
"input": "7 83",
"output": "89\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n7 83\n6 83\n5 83\n..."
},
{
"input": "32 100",
"output": "131\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "42 17",
"output": "58\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n42 17\n41 17\n40 17\n39 17\n38 17\n37 17\n36 17\n35 17\n34 17\n33 17\n32 17\n31 17\n30 17\n29 17\n28 17\n27 17\n26 17\n25 17\n24 17\n23 17\n22 17\n21 17\n20 17\n19 17\n18 17\n17 17\n16 17\n15 17\n14 17\n13 17\n12 17\n11 17\n10 17\n9 17\n8 17\n7 17\n6 17\n5 17\n4 17\n3 17\n2 17"
},
{
"input": "1 77",
"output": "77\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77"
},
{
"input": "19 93",
"output": "111\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "25 5",
"output": "29\n1 1\n1 2\n1 3\n1 4\n1 5\n25 5\n24 5\n23 5\n22 5\n21 5\n20 5\n19 5\n18 5\n17 5\n16 5\n15 5\n14 5\n13 5\n12 5\n11 5\n10 5\n9 5\n8 5\n7 5\n6 5\n5 5\n4 5\n3 5\n2 5"
},
{
"input": "35 21",
"output": "55\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n35 21\n34 21\n33 21\n32 21\n31 21\n30 21\n29 21\n28 21\n27 21\n26 21\n25 21\n24 21\n23 21\n22 21\n21 21\n20 21\n19 21\n18 21\n17 21\n16 21\n15 21\n14 21\n13 21\n12 21\n11 21\n10 21\n9 21\n8 21\n7 21\n6 21\n5 21\n4 21\n3 21\n2 21"
},
{
"input": "99 99",
"output": "197\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "99 100",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
},
{
"input": "100 99",
"output": "198\n1 1\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n..."
}
] | 1,580,230,876 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 248 | 512,000 | def solution(n,m):
print(m+n-1)
if n>=m:
t=1
for i in range(1,n+1):
while t<=m:
print(i,t)
t+=1
t=2
for i in range(1,m+1):
while t<=n:
print(t,i)
t+=1
else:
t=1
for i in range(1,m+1):
while t<=n:
print(i,t)
t+=1
t=2
for i in range(1,n+1):
while t<=m:
print(t,i)
t+=1
a=list(map(int,input('').split()))
solution(a[0],a[1]) | Title: Ciel and Dancing
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel and her friends are in a dancing room. There are *n* boys and *m* girls here, and they never danced before. There will be some songs, during each song, there must be exactly one boy and one girl are dancing. Besides, there is a special rule:
- either the boy in the dancing pair must dance for the first time (so, he didn't dance with anyone before); - or the girl in the dancing pair must dance for the first time.
Help Fox Ciel to make a schedule that they can dance as many songs as possible.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of boys and girls in the dancing room.
Output Specification:
In the first line print *k* — the number of songs during which they can dance. Then in the following *k* lines, print the indexes of boys and girls dancing during songs chronologically. You can assume that the boys are indexed from 1 to *n*, and the girls are indexed from 1 to *m*.
Demo Input:
['2 1\n', '2 2\n']
Demo Output:
['2\n1 1\n2 1\n', '3\n1 1\n1 2\n2 2\n']
Note:
In test case 1, there are 2 boys and 1 girl. We can have 2 dances: the 1st boy and 1st girl (during the first song), the 2nd boy and 1st girl (during the second song).
And in test case 2, we have 2 boys with 2 girls, the answer is 3. | ```python
def solution(n,m):
print(m+n-1)
if n>=m:
t=1
for i in range(1,n+1):
while t<=m:
print(i,t)
t+=1
t=2
for i in range(1,m+1):
while t<=n:
print(t,i)
t+=1
else:
t=1
for i in range(1,m+1):
while t<=n:
print(i,t)
t+=1
t=2
for i in range(1,n+1):
while t<=m:
print(t,i)
t+=1
a=list(map(int,input('').split()))
solution(a[0],a[1])
``` | 0 |
|
195 | A | Let's Watch Football | PROGRAMMING | 1,000 | [
"binary search",
"brute force",
"math"
] | null | null | Valeric and Valerko missed the last Euro football game, so they decided to watch the game's key moments on the Net. They want to start watching as soon as possible but the connection speed is too low. If they turn on the video right now, it will "hang up" as the size of data to watch per second will be more than the size of downloaded data per second.
The guys want to watch the whole video without any pauses, so they have to wait some integer number of seconds for a part of the video to download. After this number of seconds passes, they can start watching. Waiting for the whole video to download isn't necessary as the video can download after the guys started to watch.
Let's suppose that video's length is *c* seconds and Valeric and Valerko wait *t* seconds before the watching. Then for any moment of time *t*0, *t*<=≤<=*t*0<=≤<=*c*<=+<=*t*, the following condition must fulfill: the size of data received in *t*0 seconds is not less than the size of data needed to watch *t*0<=-<=*t* seconds of the video.
Of course, the guys want to wait as little as possible, so your task is to find the minimum integer number of seconds to wait before turning the video on. The guys must watch the video without pauses. | The first line contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=1000,<=*a*<=><=*b*). The first number (*a*) denotes the size of data needed to watch one second of the video. The second number (*b*) denotes the size of data Valeric and Valerko can download from the Net per second. The third number (*c*) denotes the video's length in seconds. | Print a single number — the minimum integer number of seconds that Valeric and Valerko must wait to watch football without pauses. | [
"4 1 1\n",
"10 3 2\n",
"13 12 1\n"
] | [
"3\n",
"5\n",
"1\n"
] | In the first sample video's length is 1 second and it is necessary 4 units of data for watching 1 second of video, so guys should download 4 · 1 = 4 units of data to watch the whole video. The most optimal way is to wait 3 seconds till 3 units of data will be downloaded and then start watching. While guys will be watching video 1 second, one unit of data will be downloaded and Valerik and Valerko will have 4 units of data by the end of watching. Also every moment till the end of video guys will have more data then necessary for watching.
In the second sample guys need 2 · 10 = 20 units of data, so they have to wait 5 seconds and after that they will have 20 units before the second second ends. However, if guys wait 4 seconds, they will be able to watch first second of video without pauses, but they will download 18 units of data by the end of second second and it is less then necessary. | 500 | [
{
"input": "4 1 1",
"output": "3"
},
{
"input": "10 3 2",
"output": "5"
},
{
"input": "13 12 1",
"output": "1"
},
{
"input": "2 1 3",
"output": "3"
},
{
"input": "6 2 4",
"output": "8"
},
{
"input": "5 2 1",
"output": "2"
},
{
"input": "2 1 1",
"output": "1"
},
{
"input": "2 1 4",
"output": "4"
},
{
"input": "5 1 5",
"output": "20"
},
{
"input": "2 1 2",
"output": "2"
},
{
"input": "60 16 1",
"output": "3"
},
{
"input": "64 12 8",
"output": "35"
},
{
"input": "66 38 4",
"output": "3"
},
{
"input": "70 32 1",
"output": "2"
},
{
"input": "24 12 12",
"output": "12"
},
{
"input": "24 19 9",
"output": "3"
},
{
"input": "244 87 4",
"output": "8"
},
{
"input": "305 203 421",
"output": "212"
},
{
"input": "888 777 1",
"output": "1"
},
{
"input": "888 777 1000",
"output": "143"
},
{
"input": "888 777 888",
"output": "127"
},
{
"input": "5 4 10",
"output": "3"
},
{
"input": "1000 1 1",
"output": "999"
},
{
"input": "1000 1 1000",
"output": "999000"
},
{
"input": "1000 999 1",
"output": "1"
},
{
"input": "1000 999 1000",
"output": "2"
},
{
"input": "945 812 917",
"output": "151"
},
{
"input": "993 992 991",
"output": "1"
},
{
"input": "17 7 10",
"output": "15"
},
{
"input": "17 10 7",
"output": "5"
},
{
"input": "500 300 300",
"output": "200"
},
{
"input": "196 169 144",
"output": "24"
},
{
"input": "7 3 200",
"output": "267"
},
{
"input": "9 3 300",
"output": "600"
},
{
"input": "561 31 917",
"output": "15678"
},
{
"input": "100 10 1",
"output": "9"
},
{
"input": "1000 100 10",
"output": "90"
},
{
"input": "18 14 10",
"output": "3"
},
{
"input": "93 74 831",
"output": "214"
},
{
"input": "960 935 994",
"output": "27"
},
{
"input": "894 1 999",
"output": "892107"
},
{
"input": "767 2 514",
"output": "196605"
},
{
"input": "765 123 45",
"output": "235"
},
{
"input": "1000 1 1000",
"output": "999000"
},
{
"input": "765 123 899",
"output": "4693"
},
{
"input": "759 10 258",
"output": "19325"
},
{
"input": "100 1 10",
"output": "990"
},
{
"input": "99 8 99",
"output": "1127"
},
{
"input": "27 26 1",
"output": "1"
}
] | 1,650,508,043 | 2,147,483,647 | Python 3 | OK | TESTS | 49 | 92 | 0 | def round_up(x):
if x % 1 == 0:
return int(x)
else:
return int(x // 1 + 1)
a, b, c = [int(x) for x in input().split()]
latency = a * c / b - c
print(round_up(latency))
| Title: Let's Watch Football
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valeric and Valerko missed the last Euro football game, so they decided to watch the game's key moments on the Net. They want to start watching as soon as possible but the connection speed is too low. If they turn on the video right now, it will "hang up" as the size of data to watch per second will be more than the size of downloaded data per second.
The guys want to watch the whole video without any pauses, so they have to wait some integer number of seconds for a part of the video to download. After this number of seconds passes, they can start watching. Waiting for the whole video to download isn't necessary as the video can download after the guys started to watch.
Let's suppose that video's length is *c* seconds and Valeric and Valerko wait *t* seconds before the watching. Then for any moment of time *t*0, *t*<=≤<=*t*0<=≤<=*c*<=+<=*t*, the following condition must fulfill: the size of data received in *t*0 seconds is not less than the size of data needed to watch *t*0<=-<=*t* seconds of the video.
Of course, the guys want to wait as little as possible, so your task is to find the minimum integer number of seconds to wait before turning the video on. The guys must watch the video without pauses.
Input Specification:
The first line contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=1000,<=*a*<=><=*b*). The first number (*a*) denotes the size of data needed to watch one second of the video. The second number (*b*) denotes the size of data Valeric and Valerko can download from the Net per second. The third number (*c*) denotes the video's length in seconds.
Output Specification:
Print a single number — the minimum integer number of seconds that Valeric and Valerko must wait to watch football without pauses.
Demo Input:
['4 1 1\n', '10 3 2\n', '13 12 1\n']
Demo Output:
['3\n', '5\n', '1\n']
Note:
In the first sample video's length is 1 second and it is necessary 4 units of data for watching 1 second of video, so guys should download 4 · 1 = 4 units of data to watch the whole video. The most optimal way is to wait 3 seconds till 3 units of data will be downloaded and then start watching. While guys will be watching video 1 second, one unit of data will be downloaded and Valerik and Valerko will have 4 units of data by the end of watching. Also every moment till the end of video guys will have more data then necessary for watching.
In the second sample guys need 2 · 10 = 20 units of data, so they have to wait 5 seconds and after that they will have 20 units before the second second ends. However, if guys wait 4 seconds, they will be able to watch first second of video without pauses, but they will download 18 units of data by the end of second second and it is less then necessary. | ```python
def round_up(x):
if x % 1 == 0:
return int(x)
else:
return int(x // 1 + 1)
a, b, c = [int(x) for x in input().split()]
latency = a * c / b - c
print(round_up(latency))
``` | 3 |
|
859 | B | Lazy Security Guard | PROGRAMMING | 1,000 | [
"brute force",
"geometry",
"math"
] | null | null | Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite. | Input will consist of a single integer *N* (1<=≤<=*N*<=≤<=106), the number of city blocks that must be enclosed by the route. | Print the minimum perimeter that can be achieved. | [
"4\n",
"11\n",
"22\n"
] | [
"8\n",
"14\n",
"20\n"
] | Here are some possible shapes for the examples:
<img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 750 | [
{
"input": "4",
"output": "8"
},
{
"input": "11",
"output": "14"
},
{
"input": "22",
"output": "20"
},
{
"input": "3",
"output": "8"
},
{
"input": "1024",
"output": "128"
},
{
"input": "101",
"output": "42"
},
{
"input": "30",
"output": "22"
},
{
"input": "1000000",
"output": "4000"
},
{
"input": "1",
"output": "4"
},
{
"input": "2",
"output": "6"
},
{
"input": "5",
"output": "10"
},
{
"input": "6",
"output": "10"
},
{
"input": "7",
"output": "12"
},
{
"input": "8",
"output": "12"
},
{
"input": "9",
"output": "12"
},
{
"input": "10",
"output": "14"
},
{
"input": "999000",
"output": "3998"
},
{
"input": "999001",
"output": "4000"
},
{
"input": "999999",
"output": "4000"
},
{
"input": "933206",
"output": "3866"
},
{
"input": "718351",
"output": "3392"
},
{
"input": "607443",
"output": "3118"
},
{
"input": "347887",
"output": "2360"
},
{
"input": "246206",
"output": "1986"
},
{
"input": "151375",
"output": "1558"
},
{
"input": "12639",
"output": "450"
},
{
"input": "3751",
"output": "246"
},
{
"input": "3607",
"output": "242"
},
{
"input": "124",
"output": "46"
},
{
"input": "64",
"output": "32"
},
{
"input": "31",
"output": "24"
},
{
"input": "23",
"output": "20"
},
{
"input": "15",
"output": "16"
},
{
"input": "19",
"output": "18"
},
{
"input": "59637",
"output": "978"
}
] | 1,505,584,912 | 1,612 | Python 3 | OK | TESTS | 35 | 62 | 0 | n = int(input())
temp = int(n**0.5)
n -= temp ** 2
if n // temp != n / temp:
print(temp * 4 + (n//temp+1) * 2)
else:
print(temp * 4 + (n//temp) * 2)
| Title: Lazy Security Guard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your security guard friend recently got a new job at a new security company. The company requires him to patrol an area of the city encompassing exactly *N* city blocks, but they let him choose which blocks. That is, your friend must walk the perimeter of a region whose area is exactly *N* blocks. Your friend is quite lazy and would like your help to find the shortest possible route that meets the requirements. The city is laid out in a square grid pattern, and is large enough that for the sake of the problem it can be considered infinite.
Input Specification:
Input will consist of a single integer *N* (1<=≤<=*N*<=≤<=106), the number of city blocks that must be enclosed by the route.
Output Specification:
Print the minimum perimeter that can be achieved.
Demo Input:
['4\n', '11\n', '22\n']
Demo Output:
['8\n', '14\n', '20\n']
Note:
Here are some possible shapes for the examples:
<img class="tex-graphics" src="https://espresso.codeforces.com/e11bef2cf82b55dd583cfc97d12b5aee5e483a65.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
n = int(input())
temp = int(n**0.5)
n -= temp ** 2
if n // temp != n / temp:
print(temp * 4 + (n//temp+1) * 2)
else:
print(temp * 4 + (n//temp) * 2)
``` | 3 |
|
208 | A | Dubstep | PROGRAMMING | 900 | [
"strings"
] | null | null | Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. | The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. | Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. | [
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] | [
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] | In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | 500 | [
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,681,139,692 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 60 | 0 | string = input()
string = string.strip("WUB")
string = string.replace("WUB", " ")
print(string) | Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | ```python
string = input()
string = string.strip("WUB")
string = string.replace("WUB", " ")
print(string)
``` | 0 |
|
318 | A | Even Odds | PROGRAMMING | 900 | [
"math"
] | null | null | Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*. | The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. | Print the number that will stand at the position number *k* after Volodya's manipulations. | [
"10 3\n",
"7 7\n"
] | [
"5",
"6"
] | In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5. | 500 | [
{
"input": "10 3",
"output": "5"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "7 1",
"output": "1"
},
{
"input": "7 2",
"output": "3"
},
{
"input": "8 5",
"output": "2"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "7"
},
{
"input": "1000000000000 500000000001",
"output": "2"
},
{
"input": "999999999997 499999999999",
"output": "999999999997"
},
{
"input": "999999999999 999999999999",
"output": "999999999998"
},
{
"input": "1000000000000 1",
"output": "1"
},
{
"input": "999999999999 1",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000000 1000000000000",
"output": "1000000000000"
},
{
"input": "1000000000000 500000000000",
"output": "999999999999"
},
{
"input": "1000000000000 499999999999",
"output": "999999999997"
},
{
"input": "999999999997 499999999998",
"output": "999999999995"
},
{
"input": "619234238 556154835",
"output": "493075432"
},
{
"input": "38151981 36650624",
"output": "35149266"
},
{
"input": "680402465 442571217",
"output": "204739968"
},
{
"input": "109135284 9408714",
"output": "18817427"
},
{
"input": "603701841 56038951",
"output": "112077901"
},
{
"input": "356764822 321510177",
"output": "286255532"
},
{
"input": "284911189 142190783",
"output": "284381565"
},
{
"input": "91028405 61435545",
"output": "31842684"
}
] | 1,697,084,782 | 2,147,483,647 | Python 3 | OK | TESTS | 25 | 62 | 0 | def main():
n, k = tuple(map(int, input().split()))
odd_count = (n+1)//2
if k <= odd_count:
print(2*k-1)
else:
k -= odd_count
print(2*k)
if __name__ == '__main__':
main() | Title: Even Odds
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Being a nonconformist, Volodya is displeased with the current state of things, particularly with the order of natural numbers (natural number is positive integer number). He is determined to rearrange them. But there are too many natural numbers, so Volodya decided to start with the first *n*. He writes down the following sequence of numbers: firstly all odd integers from 1 to *n* (in ascending order), then all even integers from 1 to *n* (also in ascending order). Help our hero to find out which number will stand at the position number *k*.
Input Specification:
The only line of input contains integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print the number that will stand at the position number *k* after Volodya's manipulations.
Demo Input:
['10 3\n', '7 7\n']
Demo Output:
['5', '6']
Note:
In the first sample Volodya's sequence will look like this: {1, 3, 5, 7, 9, 2, 4, 6, 8, 10}. The third place in the sequence is therefore occupied by the number 5. | ```python
def main():
n, k = tuple(map(int, input().split()))
odd_count = (n+1)//2
if k <= odd_count:
print(2*k-1)
else:
k -= odd_count
print(2*k)
if __name__ == '__main__':
main()
``` | 3 |
|
404 | A | Valera and X | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him. | The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper. | Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes. | [
"5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n",
"3\nwsw\nsws\nwsw\n",
"3\nxpx\npxp\nxpe\n"
] | [
"NO\n",
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nwsw\nsws\nwsw",
"output": "YES"
},
{
"input": "3\nxpx\npxp\nxpe",
"output": "NO"
},
{
"input": "5\nliiil\nilili\niilii\nilili\nliiil",
"output": "YES"
},
{
"input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt",
"output": "NO"
},
{
"input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos",
"output": "YES"
},
{
"input": "3\naaa\naaa\naaa",
"output": "NO"
},
{
"input": "3\naca\noec\nzba",
"output": "NO"
},
{
"input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "3\nxxx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxx\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxxx",
"output": "NO"
},
{
"input": "3\nxax\nxxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naaa\nxax",
"output": "NO"
},
{
"input": "3\naax\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxaa\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\naax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaa",
"output": "NO"
},
{
"input": "3\nxfx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\nafa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaf",
"output": "NO"
},
{
"input": "3\nxox\nxxx\nxxx",
"output": "NO"
},
{
"input": "3\naxa\naax\nxxa",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxox",
"output": "NO"
},
{
"input": "3\nxox\nooo\nxox",
"output": "NO"
},
{
"input": "3\naaa\naab\nbbb",
"output": "NO"
},
{
"input": "3\nxxx\nsxs\nxsx",
"output": "NO"
},
{
"input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba",
"output": "NO"
},
{
"input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba",
"output": "NO"
},
{
"input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxxx",
"output": "NO"
},
{
"input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox",
"output": "NO"
},
{
"input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox",
"output": "NO"
},
{
"input": "3\naaa\nbab\naba",
"output": "NO"
}
] | 1,601,460,059 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 6 | 139 | 0 | def main():
n = int(input())
lines = []
for _ in range(n):
lines.append(input())
y = lines[0][1]
for i in range(n):
for j in range(n):
if i == j or i == n - j - 1:
continue
if lines[i][j] != y:
print("NO")
return
x = lines[0][0]
for i in range(n):
if lines[i][i] != x or lines[i][n - i - 1] != x:
print("NO")
return
print("YES")
if __name__ == "__main__":
main() | Title: Valera and X
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
Output Specification:
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
Demo Input:
['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none | ```python
def main():
n = int(input())
lines = []
for _ in range(n):
lines.append(input())
y = lines[0][1]
for i in range(n):
for j in range(n):
if i == j or i == n - j - 1:
continue
if lines[i][j] != y:
print("NO")
return
x = lines[0][0]
for i in range(n):
if lines[i][i] != x or lines[i][n - i - 1] != x:
print("NO")
return
print("YES")
if __name__ == "__main__":
main()
``` | 0 |
|
558 | B | Amr and The Large Array | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | Amr has got a large array of size *n*. Amr doesn't like large arrays so he intends to make it smaller.
Amr doesn't care about anything in the array except the beauty of it. The beauty of the array is defined to be the maximum number of times that some number occurs in this array. He wants to choose the smallest subsegment of this array such that the beauty of it will be the same as the original array.
Help Amr by choosing the smallest subsegment possible. | The first line contains one number *n* (1<=≤<=*n*<=≤<=105), the size of the array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106), representing elements of the array. | Output two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), the beginning and the end of the subsegment chosen respectively.
If there are several possible answers you may output any of them. | [
"5\n1 1 2 2 1\n",
"5\n1 2 2 3 1\n",
"6\n1 2 2 1 1 2\n"
] | [
"1 5",
"2 3",
"1 5"
] | A subsegment *B* of an array *A* from *l* to *r* is an array of size *r* - *l* + 1 where *B*<sub class="lower-index">*i*</sub> = *A*<sub class="lower-index">*l* + *i* - 1</sub> for all 1 ≤ *i* ≤ *r* - *l* + 1 | 1,000 | [
{
"input": "5\n1 1 2 2 1",
"output": "1 5"
},
{
"input": "5\n1 2 2 3 1",
"output": "2 3"
},
{
"input": "6\n1 2 2 1 1 2",
"output": "1 5"
},
{
"input": "10\n1 1000000 2 1000000 3 2 1000000 1 2 1",
"output": "2 7"
},
{
"input": "10\n1 2 3 4 5 5 1 2 3 4",
"output": "5 6"
},
{
"input": "10\n1 1 2 1 1 2 2 1 2 3",
"output": "1 8"
},
{
"input": "10\n5 4 3 2 1 1 2 3 4 5",
"output": "5 6"
},
{
"input": "10\n1 10 100 1000 10000 1 10 100 1000 10000",
"output": "1 6"
},
{
"input": "10\n9 9 9 9 8 9 8 8 8 8",
"output": "1 6"
},
{
"input": "10\n1 11 111 1111 1 11 11 1 1111 1111",
"output": "2 7"
}
] | 1,436,888,452 | 1,852 | Python 3 | OK | TESTS | 49 | 327 | 15,257,600 | n=int(input())
mas=list(map(int,input().split(" ")))
dic={i:[0,-1,-1] for i in set(mas)}
ma=0
for i in range(n):
if dic[mas[i]][1]==-1:
dic[mas[i]][1]=i
dic[mas[i]][0]+=1
dic[mas[i]][2]=i
if dic[mas[i]][0]>ma:ma=dic[mas[i]][0]
mi=9999999999
a=0
b=0
for i in range(n):
if(dic[mas[i]][0]==ma and dic[mas[i]][2]-dic[mas[i]][1]<mi):
a=dic[mas[i]][1]
b=dic[mas[i]][2]
mi=b-a
print(a+1,b+1)
| Title: Amr and The Large Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr has got a large array of size *n*. Amr doesn't like large arrays so he intends to make it smaller.
Amr doesn't care about anything in the array except the beauty of it. The beauty of the array is defined to be the maximum number of times that some number occurs in this array. He wants to choose the smallest subsegment of this array such that the beauty of it will be the same as the original array.
Help Amr by choosing the smallest subsegment possible.
Input Specification:
The first line contains one number *n* (1<=≤<=*n*<=≤<=105), the size of the array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106), representing elements of the array.
Output Specification:
Output two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), the beginning and the end of the subsegment chosen respectively.
If there are several possible answers you may output any of them.
Demo Input:
['5\n1 1 2 2 1\n', '5\n1 2 2 3 1\n', '6\n1 2 2 1 1 2\n']
Demo Output:
['1 5', '2 3', '1 5']
Note:
A subsegment *B* of an array *A* from *l* to *r* is an array of size *r* - *l* + 1 where *B*<sub class="lower-index">*i*</sub> = *A*<sub class="lower-index">*l* + *i* - 1</sub> for all 1 ≤ *i* ≤ *r* - *l* + 1 | ```python
n=int(input())
mas=list(map(int,input().split(" ")))
dic={i:[0,-1,-1] for i in set(mas)}
ma=0
for i in range(n):
if dic[mas[i]][1]==-1:
dic[mas[i]][1]=i
dic[mas[i]][0]+=1
dic[mas[i]][2]=i
if dic[mas[i]][0]>ma:ma=dic[mas[i]][0]
mi=9999999999
a=0
b=0
for i in range(n):
if(dic[mas[i]][0]==ma and dic[mas[i]][2]-dic[mas[i]][1]<mi):
a=dic[mas[i]][1]
b=dic[mas[i]][2]
mi=b-a
print(a+1,b+1)
``` | 3 |
|
270 | A | Fancy Fence | PROGRAMMING | 1,100 | [
"geometry",
"implementation",
"math"
] | null | null | Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? | The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees. | For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. | [
"3\n30\n60\n90\n"
] | [
"NO\nYES\nYES\n"
] | In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | 500 | [
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,697,011,278 | 2,147,483,647 | Python 3 | OK | TESTS | 3 | 62 | 0 | '''
2300015897
吴杰稀
光华管理学院
'''
cases = int(input())
for i in range(cases):
angle = int(input())
t = 180 - angle
if 360 % t == 0 and 360 // t >= 3:
print("YES")
else:
print("NO") | Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | ```python
'''
2300015897
吴杰稀
光华管理学院
'''
cases = int(input())
for i in range(cases):
angle = int(input())
t = 180 - angle
if 360 % t == 0 and 360 // t >= 3:
print("YES")
else:
print("NO")
``` | 3 |
|
873 | B | Balanced Substring | PROGRAMMING | 1,500 | [
"dp",
"implementation"
] | null | null | You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*. | The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*. | If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring. | [
"8\n11010111\n",
"3\n111\n"
] | [
"4\n",
"0\n"
] | In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring. | 0 | [
{
"input": "8\n11010111",
"output": "4"
},
{
"input": "3\n111",
"output": "0"
},
{
"input": "11\n00001000100",
"output": "2"
},
{
"input": "10\n0100000000",
"output": "2"
},
{
"input": "13\n0001000011010",
"output": "6"
},
{
"input": "14\n00000100101011",
"output": "10"
},
{
"input": "14\n01111101111111",
"output": "2"
},
{
"input": "18\n110010101101111111",
"output": "10"
},
{
"input": "11\n00010000011",
"output": "4"
},
{
"input": "10\n1000010110",
"output": "6"
},
{
"input": "15\n100000100000011",
"output": "4"
},
{
"input": "18\n011010101110111101",
"output": "8"
},
{
"input": "10\n0011011111",
"output": "6"
},
{
"input": "3\n011",
"output": "2"
},
{
"input": "14\n11111111111111",
"output": "0"
},
{
"input": "65\n11001000110001001011011110111100000000101001001010101111000100010",
"output": "48"
},
{
"input": "10\n0011111000",
"output": "10"
},
{
"input": "13\n1110000001110",
"output": "12"
},
{
"input": "3\n110",
"output": "2"
},
{
"input": "4\n1110",
"output": "2"
},
{
"input": "9\n001011001",
"output": "8"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n01",
"output": "2"
},
{
"input": "12\n110000110000",
"output": "8"
},
{
"input": "3\n001",
"output": "2"
},
{
"input": "14\n11000011000000",
"output": "8"
},
{
"input": "19\n0000011111111100000",
"output": "18"
},
{
"input": "45\n011010001100001111110001011100000001101100111",
"output": "44"
},
{
"input": "18\n000001111111100000",
"output": "16"
},
{
"input": "4\n0101",
"output": "4"
},
{
"input": "12\n000101011001",
"output": "10"
}
] | 1,625,485,696 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 46 | 0 | n=int(input())
p=input()
c_0=p.count('0')
c_1=p.count('1')
s=2*min(c_0,c_1)
print(s)
| Title: Balanced Substring
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
Input Specification:
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
Output Specification:
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
Demo Input:
['8\n11010111\n', '3\n111\n']
Demo Output:
['4\n', '0\n']
Note:
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring. | ```python
n=int(input())
p=input()
c_0=p.count('0')
c_1=p.count('1')
s=2*min(c_0,c_1)
print(s)
``` | 0 |
|
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
] | A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
] | [
"4\n"
] | none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,694,259,243 | 2,147,483,647 | PyPy 3 | OK | TESTS | 20 | 77 | 0 | import math
def main():
dms=[]
ins = input()
dms = ins.split()
d1 = int(dms[0])/int(dms[2]);
d2 = int(dms[1])/int(dms[2]);
print(math.ceil(d1)*math.ceil(d2))
main() | Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
import math
def main():
dms=[]
ins = input()
dms = ins.split()
d1 = int(dms[0])/int(dms[2]);
d2 = int(dms[1])/int(dms[2]);
print(math.ceil(d1)*math.ceil(d2))
main()
``` | 3.9615 |
22 | A | Second Order Statistics | PROGRAMMING | 800 | [
"brute force"
] | A. Second Order Statistics | 2 | 256 | Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem. | The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value. | If the given sequence has the second order statistics, output this order statistics, otherwise output NO. | [
"4\n1 2 2 -4\n",
"5\n1 2 3 1 1\n"
] | [
"1\n",
"2\n"
] | none | 0 | [
{
"input": "4\n1 2 2 -4",
"output": "1"
},
{
"input": "5\n1 2 3 1 1",
"output": "2"
},
{
"input": "1\n28",
"output": "NO"
},
{
"input": "2\n-28 12",
"output": "12"
},
{
"input": "3\n-83 40 -80",
"output": "-80"
},
{
"input": "8\n93 77 -92 26 21 -48 53 91",
"output": "-48"
},
{
"input": "20\n-72 -9 -86 80 7 -10 40 -27 -94 92 96 56 28 -19 79 36 -3 -73 -63 -49",
"output": "-86"
},
{
"input": "49\n-74 -100 -80 23 -8 -83 -41 -20 48 17 46 -73 -55 67 85 4 40 -60 -69 -75 56 -74 -42 93 74 -95 64 -46 97 -47 55 0 -78 -34 -31 40 -63 -49 -76 48 21 -1 -49 -29 -98 -11 76 26 94",
"output": "-98"
},
{
"input": "88\n63 48 1 -53 -89 -49 64 -70 -49 71 -17 -16 76 81 -26 -50 67 -59 -56 97 2 100 14 18 -91 -80 42 92 -25 -88 59 8 -56 38 48 -71 -78 24 -14 48 -1 69 73 -76 54 16 -92 44 47 33 -34 -17 -81 21 -59 -61 53 26 10 -76 67 35 -29 70 65 -13 -29 81 80 32 74 -6 34 46 57 1 -45 -55 69 79 -58 11 -2 22 -18 -16 -89 -46",
"output": "-91"
},
{
"input": "100\n34 32 88 20 76 53 -71 -39 -98 -10 57 37 63 -3 -54 -64 -78 -82 73 20 -30 -4 22 75 51 -64 -91 29 -52 -48 83 19 18 -47 46 57 -44 95 89 89 -30 84 -83 67 58 -99 -90 -53 92 -60 -5 -56 -61 27 68 -48 52 -95 64 -48 -30 -67 66 89 14 -33 -31 -91 39 7 -94 -54 92 -96 -99 -83 -16 91 -28 -66 81 44 14 -85 -21 18 40 16 -13 -82 -33 47 -10 -40 -19 10 25 60 -34 -89",
"output": "-98"
},
{
"input": "2\n-1 -1",
"output": "NO"
},
{
"input": "3\n-2 -2 -2",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "10\n40 71 -85 -85 40 -85 -85 64 -85 47",
"output": "40"
},
{
"input": "23\n-90 -90 -41 -64 -64 -90 -15 10 -43 -90 -64 -64 89 -64 36 47 38 -90 -64 -90 -90 68 -90",
"output": "-64"
},
{
"input": "39\n-97 -93 -42 -93 -97 -93 56 -97 -97 -97 76 -33 -60 91 7 82 17 47 -97 -97 -93 73 -97 12 -97 -97 -97 -97 56 -92 -83 -93 -93 49 -93 -97 -97 -17 -93",
"output": "-93"
},
{
"input": "51\n-21 6 -35 -98 -86 -98 -86 -43 -65 32 -98 -40 96 -98 -98 -98 -98 -86 -86 -98 56 -86 -98 -98 -30 -98 -86 -31 -98 -86 -86 -86 -86 -30 96 -86 -86 -86 -60 25 88 -86 -86 58 31 -47 57 -86 37 44 -83",
"output": "-86"
},
{
"input": "66\n-14 -95 65 -95 -95 -97 -90 -71 -97 -97 70 -95 -95 -97 -95 -27 35 -87 -95 -5 -97 -97 87 34 -49 -95 -97 -95 -97 -95 -30 -95 -97 47 -95 -17 -97 -95 -97 -69 51 -97 -97 -95 -75 87 59 21 63 56 76 -91 98 -97 6 -97 -95 -95 -97 -73 11 -97 -35 -95 -95 -43",
"output": "-95"
},
{
"input": "77\n-67 -93 -93 -92 97 29 93 -93 -93 -5 -93 -7 60 -92 -93 44 -84 68 -92 -93 69 -92 -37 56 43 -93 35 -92 -93 19 -79 18 -92 -93 -93 -37 -93 -47 -93 -92 -92 74 67 19 40 -92 -92 -92 -92 -93 -93 -41 -93 -92 -93 -93 -92 -93 51 -80 6 -42 -92 -92 -66 -12 -92 -92 -3 93 -92 -49 -93 40 62 -92 -92",
"output": "-92"
},
{
"input": "89\n-98 40 16 -87 -98 63 -100 55 -96 -98 -21 -100 -93 26 -98 -98 -100 -89 -98 -5 -65 -28 -100 -6 -66 67 -100 -98 -98 10 -98 -98 -70 7 -98 2 -100 -100 -98 25 -100 -100 -98 23 -68 -100 -98 3 98 -100 -98 -98 -98 -98 -24 -100 -100 -9 -98 35 -100 99 -5 -98 -100 -100 37 -100 -84 57 -98 40 -47 -100 -1 -92 -76 -98 -98 -100 -100 -100 -63 30 21 -100 -100 -100 -12",
"output": "-98"
},
{
"input": "99\n10 -84 -100 -100 73 -64 -100 -94 33 -100 -100 -100 -100 71 64 24 7 -100 -32 -100 -100 77 -100 62 -12 55 45 -100 -100 -80 -100 -100 -100 -100 -100 -100 -100 -100 -100 -39 -48 -100 -34 47 -100 -100 -100 -100 -100 -77 -100 -100 -100 -100 -100 -100 -52 40 -55 -100 -44 -100 72 33 70 -100 -100 -78 -100 -3 100 -77 22 -100 95 -30 -100 10 -69 -100 -100 -100 -100 52 -39 -100 -100 -100 7 -100 -98 -66 95 -17 -100 52 -100 68 -100",
"output": "-98"
},
{
"input": "100\n-99 -98 -64 89 53 57 -99 29 -78 18 -3 -54 76 -98 -99 -98 37 -98 19 -47 89 73 -98 -91 -99 -99 -98 -48 -99 22 -99 -98 -99 -99 -98 -60 84 67 -99 -98 20 -98 88 -98 46 -98 -99 -98 -99 -71 -99 -98 -98 -39 83 95 -98 63 -98 -99 32 -98 -99 -64 57 -30 -53 -83 -4 -99 58 20 -98 -10 -99 -44 -99 -99 -99 -99 75 34 -98 -52 -98 -30 -98 -99 -98 -98 51 -99 -99 -99 -98 -99 -99 -82 -90 92",
"output": "-98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "9\n99 99 99 99 100 100 100 100 100",
"output": "100"
},
{
"input": "5\n-100 -100 -100 -100 -100",
"output": "NO"
}
] | 1,667,822,601 | 2,147,483,647 | Python 3 | OK | TESTS | 31 | 92 | 102,400 | import os,sys,io,math
from array import array
from math import *
from bisect import *
from heapq import *
from functools import *
from itertools import *
from collections import Counter,defaultdict
I=lambda:[*map(int,sys.stdin.readline().split())]
IS=lambda:input()
IN=lambda:int(input())
IF=lambda:float(input())
n,l=IN(),I()
s=sorted(list(set(l)))
print(s[1] if len(s)>1 else "NO") | Title: Second Order Statistics
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
Output Specification:
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
Demo Input:
['4\n1 2 2 -4\n', '5\n1 2 3 1 1\n']
Demo Output:
['1\n', '2\n']
Note:
none | ```python
import os,sys,io,math
from array import array
from math import *
from bisect import *
from heapq import *
from functools import *
from itertools import *
from collections import Counter,defaultdict
I=lambda:[*map(int,sys.stdin.readline().split())]
IS=lambda:input()
IN=lambda:int(input())
IF=lambda:float(input())
n,l=IN(),I()
s=sorted(list(set(l)))
print(s[1] if len(s)>1 else "NO")
``` | 3.976809 |
312 | B | Archer | PROGRAMMING | 1,300 | [
"math",
"probabilities"
] | null | null | SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner.
Output the probability that SmallR will win the match. | A single line contains four integers . | Print a single real number, the probability that SmallR will win the match.
The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6. | [
"1 2 1 2\n"
] | [
"0.666666666667"
] | none | 1,000 | [
{
"input": "1 2 1 2",
"output": "0.666666666667"
},
{
"input": "1 3 1 3",
"output": "0.600000000000"
},
{
"input": "1 3 2 3",
"output": "0.428571428571"
},
{
"input": "3 4 3 4",
"output": "0.800000000000"
},
{
"input": "1 2 10 11",
"output": "0.523809523810"
},
{
"input": "4 5 4 5",
"output": "0.833333333333"
},
{
"input": "466 701 95 721",
"output": "0.937693791148"
},
{
"input": "268 470 444 885",
"output": "0.725614009325"
},
{
"input": "632 916 713 821",
"output": "0.719292895126"
},
{
"input": "269 656 918 992",
"output": "0.428937461623"
},
{
"input": "71 657 187 695",
"output": "0.310488463257"
},
{
"input": "435 852 973 978",
"output": "0.511844133157"
},
{
"input": "518 816 243 359",
"output": "0.719734031025"
},
{
"input": "882 962 311 811",
"output": "0.966386645447"
},
{
"input": "684 774 580 736",
"output": "0.906051574446"
},
{
"input": "486 868 929 999",
"output": "0.577723252958"
},
{
"input": "132 359 996 998",
"output": "0.368154532345"
},
{
"input": "933 977 266 450",
"output": "0.972879407907"
},
{
"input": "298 833 615 872",
"output": "0.441270817024"
},
{
"input": "34 554 14 958",
"output": "0.817324099167"
},
{
"input": "836 934 800 905",
"output": "0.906105535462"
},
{
"input": "482 815 69 509",
"output": "0.914365577772"
},
{
"input": "284 423 137 521",
"output": "0.885974839378"
},
{
"input": "648 881 486 703",
"output": "0.800911421248"
},
{
"input": "450 885 755 836",
"output": "0.533901011176"
},
{
"input": "533 773 823 998",
"output": "0.729222130525"
},
{
"input": "897 957 92 898",
"output": "0.993193806364"
},
{
"input": "699 925 441 928",
"output": "0.866816866175"
},
{
"input": "64 704 148 603",
"output": "0.289486317811"
},
{
"input": "719 735 626 990",
"output": "0.986124079764"
},
{
"input": "1 1000 1 1000",
"output": "0.500250125063"
}
] | 1,656,851,163 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 31 | 0 | import math
a,b,c,d=list(map(int,input().split()))
print((b/(math.factorial(b+d)/(math.factorial(b)*math.factorial(d))))*(b+d-(a+c))) | Title: Archer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner.
Output the probability that SmallR will win the match.
Input Specification:
A single line contains four integers .
Output Specification:
Print a single real number, the probability that SmallR will win the match.
The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
Demo Input:
['1 2 1 2\n']
Demo Output:
['0.666666666667']
Note:
none | ```python
import math
a,b,c,d=list(map(int,input().split()))
print((b/(math.factorial(b+d)/(math.factorial(b)*math.factorial(d))))*(b+d-(a+c)))
``` | 0 |
|
58 | A | Chat room | PROGRAMMING | 1,000 | [
"greedy",
"strings"
] | A. Chat room | 1 | 256 | Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. | The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. | If Vasya managed to say hello, print "YES", otherwise print "NO". | [
"ahhellllloou\n",
"hlelo\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,648,488,336 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 77 | 2,048,000 | import re
s = input()
if re.match(r'.*h.*e.*l,*l.*o.*', s):
print(True)
else:
print(False)
| Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
import re
s = input()
if re.match(r'.*h.*e.*l,*l.*o.*', s):
print(True)
else:
print(False)
``` | 0 |
710 | B | Optimal Point on a Line | PROGRAMMING | 1,400 | [
"brute force",
"sortings"
] | null | null | You are given *n* points on a line with their coordinates *x**i*. Find the point *x* so the sum of distances to the given points is minimal. | The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of points on the line.
The second line contains *n* integers *x**i* (<=-<=109<=≤<=*x**i*<=≤<=109) — the coordinates of the given *n* points. | Print the only integer *x* — the position of the optimal point on the line. If there are several optimal points print the position of the leftmost one. It is guaranteed that the answer is always the integer. | [
"4\n1 2 3 4\n"
] | [
"2\n"
] | none | 0 | [
{
"input": "4\n1 2 3 4",
"output": "2"
},
{
"input": "5\n-1 -10 2 6 7",
"output": "2"
},
{
"input": "10\n-68 10 87 22 30 89 82 -97 -52 25",
"output": "22"
},
{
"input": "100\n457 827 807 17 871 935 907 -415 536 170 551 -988 865 758 -457 -892 -875 -488 684 19 0 555 -807 -624 -239 826 318 811 20 -732 -91 460 551 -610 555 -493 -154 442 -141 946 -913 -104 704 -380 699 32 106 -455 -518 214 -464 -861 243 -798 -472 559 529 -844 -32 871 -459 236 387 626 -318 -580 -611 -842 790 486 64 951 81 78 -693 403 -731 309 678 696 891 846 -106 918 212 -44 994 606 -829 -454 243 -477 -402 -818 -819 -310 -837 -209 736 424",
"output": "64"
},
{
"input": "2\n-1 0",
"output": "-1"
},
{
"input": "48\n-777 -767 -764 -713 -688 -682 -606 -586 -585 -483 -465 -440 -433 -397 -390 -377 -299 -252 -159 -147 -96 -29 -15 15 52 109 124 129 142 218 231 314 320 339 442 496 505 548 575 576 594 624 694 827 891 979 981 981",
"output": "15"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 1 1 1 1 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "4\n-1 -1 0 1",
"output": "-1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 1000000000",
"output": "0"
},
{
"input": "2\n1 -1",
"output": "-1"
},
{
"input": "2\n100 50",
"output": "50"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "3\n606194955 -856471310 117647402",
"output": "117647402"
},
{
"input": "2\n615002717 -843553590",
"output": "-843553590"
},
{
"input": "2\n-1 2",
"output": "-1"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "5\n-638512131 348325781 -550537933 -618161835 -567935532",
"output": "-567935532"
},
{
"input": "1\n120",
"output": "120"
},
{
"input": "2\n-1000000000 1000000000",
"output": "-1000000000"
},
{
"input": "1\n618309368",
"output": "618309368"
}
] | 1,614,596,176 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 93 | 0 | n = int(input())
coo = [int(i) for i in input().split(" ")]
print(coo[(n - 1) // 2])
| Title: Optimal Point on a Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* points on a line with their coordinates *x**i*. Find the point *x* so the sum of distances to the given points is minimal.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of points on the line.
The second line contains *n* integers *x**i* (<=-<=109<=≤<=*x**i*<=≤<=109) — the coordinates of the given *n* points.
Output Specification:
Print the only integer *x* — the position of the optimal point on the line. If there are several optimal points print the position of the leftmost one. It is guaranteed that the answer is always the integer.
Demo Input:
['4\n1 2 3 4\n']
Demo Output:
['2\n']
Note:
none | ```python
n = int(input())
coo = [int(i) for i in input().split(" ")]
print(coo[(n - 1) // 2])
``` | 0 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,642,423,558 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 124 | 0 | mn=[int(i) for i in input().split()]
print(int(mn[0]*mn[1]/2)) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
mn=[int(i) for i in input().split()]
print(int(mn[0]*mn[1]/2))
``` | 3.969 |
518 | B | Tanya and Postcard | PROGRAMMING | 1,400 | [
"greedy",
"implementation",
"strings"
] | null | null | Little Tanya decided to present her dad a postcard on his Birthday. She has already created a message — string *s* of length *n*, consisting of uppercase and lowercase English letters. Tanya can't write yet, so she found a newspaper and decided to cut out the letters and glue them into the postcard to achieve string *s*. The newspaper contains string *t*, consisting of uppercase and lowercase English letters. We know that the length of string *t* greater or equal to the length of the string *s*.
The newspaper may possibly have too few of some letters needed to make the text and too many of some other letters. That's why Tanya wants to cut some *n* letters out of the newspaper and make a message of length exactly *n*, so that it looked as much as possible like *s*. If the letter in some position has correct value and correct letter case (in the string *s* and in the string that Tanya will make), then she shouts joyfully "YAY!", and if the letter in the given position has only the correct value but it is in the wrong case, then the girl says "WHOOPS".
Tanya wants to make such message that lets her shout "YAY!" as much as possible. If there are multiple ways to do this, then her second priority is to maximize the number of times she says "WHOOPS". Your task is to help Tanya make the message. | The first line contains line *s* (1<=≤<=|*s*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text of Tanya's message.
The second line contains line *t* (|*s*|<=≤<=|*t*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text written in the newspaper.
Here |*a*| means the length of the string *a*. | Print two integers separated by a space:
- the first number is the number of times Tanya shouts "YAY!" while making the message, - the second number is the number of times Tanya says "WHOOPS" while making the message. | [
"AbC\nDCbA\n",
"ABC\nabc\n",
"abacaba\nAbaCaBA\n"
] | [
"3 0\n",
"0 3\n",
"3 4\n"
] | none | 1,000 | [
{
"input": "AbC\nDCbA",
"output": "3 0"
},
{
"input": "ABC\nabc",
"output": "0 3"
},
{
"input": "abacaba\nAbaCaBA",
"output": "3 4"
},
{
"input": "zzzzz\nZZZZZ",
"output": "0 5"
},
{
"input": "zzzZZZ\nZZZzzZ",
"output": "5 1"
},
{
"input": "abcdefghijklmnopqrstuvwxyz\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "0 26"
},
{
"input": "abcdefghijklmnopqrstuvwxyz\nqrsimtabuvzhnwcdefgjklxyop",
"output": "26 0"
},
{
"input": "l\nFPbAVjsMpPDTLkfwNYFmBDHPTDSWSOUlrBHYJHPM",
"output": "1 0"
},
{
"input": "ncMeXssLHS\nuwyeMcaFatpInZVdEYpwJQSnVxLK",
"output": "6 1"
},
{
"input": "DpiNBmCRFWxpdbfGOzvvOcemjructoAdEwegTvbVbfWWRPGyEAxGdDRWVlqNyGWMWHMrHAIZpyxvgaflrsVZhhZRouvpxrKXFZam\nwwPLFtNfPtJXvMLuHjKfYyaRhreNSWSzOvDpqHCGcqllACNPGHxReeFUCmAqIKXYytsSQwIxJzNiiUtgebVuwRmWpRALLyKAzyDPvgIGxALSaeeTIqm",
"output": "66 12"
},
{
"input": "CCAE\ndcecc",
"output": "0 3"
},
{
"input": "Dccb\nbeeeb",
"output": "1 0"
},
{
"input": "Adc\neadeabcad",
"output": "2 1"
},
{
"input": "DBAdeb\ndeeabcddadaa",
"output": "3 2"
},
{
"input": "EDCED\neebeacdba",
"output": "0 4"
},
{
"input": "CdAbD\ndecbde",
"output": "2 2"
},
{
"input": "a\nB",
"output": "0 0"
},
{
"input": "r\nqA",
"output": "0 0"
}
] | 1,612,135,004 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 7 | 202 | 4,505,600 | s=input()
t=input()
swaps=s.swapcase()
swapt=t.swapcase()
alp=[]
countalp=[]
salp=[]
scountalp=[]
yay=0
woops=0
for i,x in enumerate(s):
if x not in alp:
alp.append(x)
n=s.count(x)
countalp.append(n)
for i,x in enumerate(t):
if x not in salp:
salp.append(x)
n=t.count(x)
scountalp.append(n)
for b,y in enumerate(alp):
tcount=t.count(y)
if tcount>0:
if abs(countalp[b]-tcount)==0:
yay+=tcount
scountalp[salp.index(y)]-=tcount
countalp[b]-=tcount
else:
yay+=min(countalp[b],tcount)
if (countalp[b]-tcount)<0:
countalp[b]=0
scountalp[salp.index(y)]-=countalp[b]
else:
countalp[b]-=tcount
scountalp[salp.index(y)]=0
for k,z in enumerate(alp):
if countalp[alp.index(z)]>0 and scountalp[salp.index(z.swapcase())]>0:
woops+=countalp[k]
# print(alp,countalp)
# print(salp,scountalp)
print(yay,woops)
| Title: Tanya and Postcard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Tanya decided to present her dad a postcard on his Birthday. She has already created a message — string *s* of length *n*, consisting of uppercase and lowercase English letters. Tanya can't write yet, so she found a newspaper and decided to cut out the letters and glue them into the postcard to achieve string *s*. The newspaper contains string *t*, consisting of uppercase and lowercase English letters. We know that the length of string *t* greater or equal to the length of the string *s*.
The newspaper may possibly have too few of some letters needed to make the text and too many of some other letters. That's why Tanya wants to cut some *n* letters out of the newspaper and make a message of length exactly *n*, so that it looked as much as possible like *s*. If the letter in some position has correct value and correct letter case (in the string *s* and in the string that Tanya will make), then she shouts joyfully "YAY!", and if the letter in the given position has only the correct value but it is in the wrong case, then the girl says "WHOOPS".
Tanya wants to make such message that lets her shout "YAY!" as much as possible. If there are multiple ways to do this, then her second priority is to maximize the number of times she says "WHOOPS". Your task is to help Tanya make the message.
Input Specification:
The first line contains line *s* (1<=≤<=|*s*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text of Tanya's message.
The second line contains line *t* (|*s*|<=≤<=|*t*|<=≤<=2·105), consisting of uppercase and lowercase English letters — the text written in the newspaper.
Here |*a*| means the length of the string *a*.
Output Specification:
Print two integers separated by a space:
- the first number is the number of times Tanya shouts "YAY!" while making the message, - the second number is the number of times Tanya says "WHOOPS" while making the message.
Demo Input:
['AbC\nDCbA\n', 'ABC\nabc\n', 'abacaba\nAbaCaBA\n']
Demo Output:
['3 0\n', '0 3\n', '3 4\n']
Note:
none | ```python
s=input()
t=input()
swaps=s.swapcase()
swapt=t.swapcase()
alp=[]
countalp=[]
salp=[]
scountalp=[]
yay=0
woops=0
for i,x in enumerate(s):
if x not in alp:
alp.append(x)
n=s.count(x)
countalp.append(n)
for i,x in enumerate(t):
if x not in salp:
salp.append(x)
n=t.count(x)
scountalp.append(n)
for b,y in enumerate(alp):
tcount=t.count(y)
if tcount>0:
if abs(countalp[b]-tcount)==0:
yay+=tcount
scountalp[salp.index(y)]-=tcount
countalp[b]-=tcount
else:
yay+=min(countalp[b],tcount)
if (countalp[b]-tcount)<0:
countalp[b]=0
scountalp[salp.index(y)]-=countalp[b]
else:
countalp[b]-=tcount
scountalp[salp.index(y)]=0
for k,z in enumerate(alp):
if countalp[alp.index(z)]>0 and scountalp[salp.index(z.swapcase())]>0:
woops+=countalp[k]
# print(alp,countalp)
# print(salp,scountalp)
print(yay,woops)
``` | 0 |
|
724 | D | Dense Subsequence | PROGRAMMING | 1,900 | [
"data structures",
"greedy",
"strings"
] | null | null | You are given a string *s*, consisting of lowercase English letters, and the integer *m*.
One should choose some symbols from the given string so that any contiguous subsegment of length *m* has at least one selected symbol. Note that here we choose positions of symbols, not the symbols themselves.
Then one uses the chosen symbols to form a new string. All symbols from the chosen position should be used, but we are allowed to rearrange them in any order.
Formally, we choose a subsequence of indices 1<=≤<=*i*1<=<<=*i*2<=<<=...<=<<=*i**t*<=≤<=|*s*|. The selected sequence must meet the following condition: for every *j* such that 1<=≤<=*j*<=≤<=|*s*|<=-<=*m*<=+<=1, there must be at least one selected index that belongs to the segment [*j*,<= *j*<=+<=*m*<=-<=1], i.e. there should exist a *k* from 1 to *t*, such that *j*<=≤<=*i**k*<=≤<=*j*<=+<=*m*<=-<=1.
Then we take any permutation *p* of the selected indices and form a new string *s**i**p*1*s**i**p*2... *s**i**p**t*.
Find the lexicographically smallest string, that can be obtained using this procedure. | The first line of the input contains a single integer *m* (1<=≤<=*m*<=≤<=100<=000).
The second line contains the string *s* consisting of lowercase English letters. It is guaranteed that this string is non-empty and its length doesn't exceed 100<=000. It is also guaranteed that the number *m* doesn't exceed the length of the string *s*. | Print the single line containing the lexicographically smallest string, that can be obtained using the procedure described above. | [
"3\ncbabc\n",
"2\nabcab\n",
"3\nbcabcbaccba\n"
] | [
"a\n",
"aab\n",
"aaabb\n"
] | In the first sample, one can choose the subsequence {3} and form a string "a".
In the second sample, one can choose the subsequence {1, 2, 4} (symbols on this positions are 'a', 'b' and 'a') and rearrange the chosen symbols to form a string "aab". | 1,500 | [
{
"input": "3\ncbabc",
"output": "a"
},
{
"input": "2\nabcab",
"output": "aab"
},
{
"input": "3\nbcabcbaccba",
"output": "aaabb"
},
{
"input": "5\nimmaydobun",
"output": "ab"
},
{
"input": "5\nwjjdqawypvtgrncmqvcsergermprauyevcegjtcrrblkwiugrcjfpjyxngyryxntauxlouvwgjzpsuxyxvhavgezwtuzknetdibv",
"output": "aaaabbcccccddeeeeeefggggggghiijjjjjjkkllmmnnnnoppppqqrrrrrrrrsstttttu"
},
{
"input": "10\nefispvmzuutsrpxzfrykhabznxiyquwvhwhrksrgzodtuepfvamilfdynapzhzyhncorhzuewrrkcduvuhwsrprjrmgctnvrdtpj",
"output": "aaabcccddddeeeffffgghhhhhhhiiijjkkklm"
},
{
"input": "20\nhlicqhxayiodyephxlfoetfketnaabpfegqcrjzlshkxfzjssvpvzhzylgowwovgxznzowvpklbwbzhwtkkaomjkenhpedmbmjic",
"output": "aaaabbbbcccddeeeeeeffffg"
},
{
"input": "50\ntyhjolxuexoffdkdwimsjujorgeksyiyvvqecvhpjsuayqnibijtipuqhkulxpysotlmtrsgygpkdhkrtntwqzrpfckiscaphyhv",
"output": "aab"
},
{
"input": "1\nbaaa",
"output": "aaab"
},
{
"input": "5\nbbbbba",
"output": "ab"
},
{
"input": "10\nbbabcbbaabcbcbcbaabbccaacccbbbcaaacabbbbaaaccbcccacbbccaccbbaacaccbabcaaaacaccacbaaccaaccbaacabbbaac",
"output": "aaaaaaaaaaa"
}
] | 1,698,883,444 | 2,147,483,647 | Python 3 | OK | TESTS | 71 | 155 | 4,096,000 | m = int(input())
s = input()
n = len(s)
t = []
u = [1] * n
d = 'a'
i = 0
while i <= n - m:
k = i
for j in range(m):
if s[i + j] <= s[k]: k = i + j
t += [s[k]]
d = max(d, s[k])
u[k] = 0
i = k + 1
t += [q for q, v in zip(s, u) if q < d and v]
print(''.join(sorted(t))) | Title: Dense Subsequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s*, consisting of lowercase English letters, and the integer *m*.
One should choose some symbols from the given string so that any contiguous subsegment of length *m* has at least one selected symbol. Note that here we choose positions of symbols, not the symbols themselves.
Then one uses the chosen symbols to form a new string. All symbols from the chosen position should be used, but we are allowed to rearrange them in any order.
Formally, we choose a subsequence of indices 1<=≤<=*i*1<=<<=*i*2<=<<=...<=<<=*i**t*<=≤<=|*s*|. The selected sequence must meet the following condition: for every *j* such that 1<=≤<=*j*<=≤<=|*s*|<=-<=*m*<=+<=1, there must be at least one selected index that belongs to the segment [*j*,<= *j*<=+<=*m*<=-<=1], i.e. there should exist a *k* from 1 to *t*, such that *j*<=≤<=*i**k*<=≤<=*j*<=+<=*m*<=-<=1.
Then we take any permutation *p* of the selected indices and form a new string *s**i**p*1*s**i**p*2... *s**i**p**t*.
Find the lexicographically smallest string, that can be obtained using this procedure.
Input Specification:
The first line of the input contains a single integer *m* (1<=≤<=*m*<=≤<=100<=000).
The second line contains the string *s* consisting of lowercase English letters. It is guaranteed that this string is non-empty and its length doesn't exceed 100<=000. It is also guaranteed that the number *m* doesn't exceed the length of the string *s*.
Output Specification:
Print the single line containing the lexicographically smallest string, that can be obtained using the procedure described above.
Demo Input:
['3\ncbabc\n', '2\nabcab\n', '3\nbcabcbaccba\n']
Demo Output:
['a\n', 'aab\n', 'aaabb\n']
Note:
In the first sample, one can choose the subsequence {3} and form a string "a".
In the second sample, one can choose the subsequence {1, 2, 4} (symbols on this positions are 'a', 'b' and 'a') and rearrange the chosen symbols to form a string "aab". | ```python
m = int(input())
s = input()
n = len(s)
t = []
u = [1] * n
d = 'a'
i = 0
while i <= n - m:
k = i
for j in range(m):
if s[i + j] <= s[k]: k = i + j
t += [s[k]]
d = max(d, s[k])
u[k] = 0
i = k + 1
t += [q for q, v in zip(s, u) if q < d and v]
print(''.join(sorted(t)))
``` | 3 |
|
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,587,559,502 | 2,147,483,647 | Python 3 | OK | TESTS | 81 | 248 | 0 | s = [0, 0, 0]
for _ in range(int(input())):
x, y, z = map(int, input().split())
s[0] += x
s[1] += y
s[2] += z
if all(i == 0 for i in s):
print('YES')
else:
print('NO')
| Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
s = [0, 0, 0]
for _ in range(int(input())):
x, y, z = map(int, input().split())
s[0] += x
s[1] += y
s[2] += z
if all(i == 0 for i in s):
print('YES')
else:
print('NO')
``` | 3.938 |
1,003 | A | Polycarp's Pockets | PROGRAMMING | 800 | [
"implementation"
] | null | null | Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that. | The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins. | Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket. | [
"6\n1 2 4 3 3 2\n",
"1\n100\n"
] | [
"2\n",
"1\n"
] | none | 0 | [
{
"input": "6\n1 2 4 3 3 2",
"output": "2"
},
{
"input": "1\n100",
"output": "1"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71",
"output": "51"
},
{
"input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29",
"output": "1"
},
{
"input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24",
"output": "2"
},
{
"input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6",
"output": "10"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "99"
},
{
"input": "7\n1 2 3 3 3 1 2",
"output": "3"
},
{
"input": "5\n1 2 3 4 5",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 1 1",
"output": "3"
},
{
"input": "12\n1 2 1 1 1 1 1 1 1 1 1 1",
"output": "11"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "14"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "16"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "10\n1 1 1 1 2 2 1 1 9 10",
"output": "6"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "56"
},
{
"input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92",
"output": "6"
},
{
"input": "10\n1 2 2 3 3 3 4 4 4 4",
"output": "4"
},
{
"input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21",
"output": "3"
},
{
"input": "5\n5 5 5 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 5 2 6",
"output": "3"
},
{
"input": "3\n58 59 58",
"output": "2"
},
{
"input": "9\n1 2 3 4 5 6 7 8 8",
"output": "2"
},
{
"input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "97"
},
{
"input": "3\n95 95 4",
"output": "2"
},
{
"input": "3\n2 2 5",
"output": "2"
}
] | 1,667,238,624 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 31 | 0 | n_ = int(input())
n = input().split()
total = 1
s = []
for i in range(n_):
n[i] = int(n[i])
if n[i] in s:
if total == s.count(n[i]):
total += 1
s.append(s)
else:
s.append(n[i])
print(total)
| Title: Polycarp's Pockets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
Output Specification:
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
Demo Input:
['6\n1 2 4 3 3 2\n', '1\n100\n']
Demo Output:
['2\n', '1\n']
Note:
none | ```python
n_ = int(input())
n = input().split()
total = 1
s = []
for i in range(n_):
n[i] = int(n[i])
if n[i] in s:
if total == s.count(n[i]):
total += 1
s.append(s)
else:
s.append(n[i])
print(total)
``` | 0 |
|
215 | A | Bicycle Chain | PROGRAMMING | 900 | [
"brute force",
"implementation"
] | null | null | Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed. | The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces. | Print the number of "integer" gears with the maximum ratio among all "integer" gears. | [
"2\n4 5\n3\n12 13 15\n",
"4\n1 2 3 4\n5\n10 11 12 13 14\n"
] | [
"2\n",
"1\n"
] | In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15. | 500 | [
{
"input": "2\n4 5\n3\n12 13 15",
"output": "2"
},
{
"input": "4\n1 2 3 4\n5\n10 11 12 13 14",
"output": "1"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 2\n1\n1",
"output": "1"
},
{
"input": "1\n1\n2\n1 2",
"output": "1"
},
{
"input": "4\n3 7 11 13\n4\n51 119 187 221",
"output": "4"
},
{
"input": "4\n2 3 4 5\n3\n1 2 3",
"output": "2"
},
{
"input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97",
"output": "1"
},
{
"input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28",
"output": "1"
},
{
"input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958",
"output": "1"
},
{
"input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20",
"output": "1"
},
{
"input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50",
"output": "1"
},
{
"input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38",
"output": "4"
},
{
"input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100",
"output": "1"
},
{
"input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149",
"output": "1"
},
{
"input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193",
"output": "1"
},
{
"input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245",
"output": "1"
},
{
"input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298",
"output": "1"
},
{
"input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350",
"output": "1"
},
{
"input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388",
"output": "1"
},
{
"input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999",
"output": "8"
},
{
"input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813",
"output": "3"
},
{
"input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217",
"output": "3"
},
{
"input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555",
"output": "8"
},
{
"input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345",
"output": "20"
},
{
"input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735",
"output": "23"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968",
"output": "12"
},
{
"input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706",
"output": "1"
},
{
"input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394",
"output": "1"
},
{
"input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284",
"output": "1"
},
{
"input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790",
"output": "4"
},
{
"input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902",
"output": "17"
},
{
"input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991",
"output": "28"
},
{
"input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862",
"output": "15"
},
{
"input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691",
"output": "8"
},
{
"input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673",
"output": "38"
},
{
"input": "3\n3 4 5\n3\n6 20 25",
"output": "2"
},
{
"input": "4\n2 3 5 8\n4\n2 6 8 10",
"output": "1"
},
{
"input": "4\n3 5 7 11\n4\n3 5 7 22",
"output": "1"
},
{
"input": "2\n2 3\n3\n20 30 50",
"output": "1"
},
{
"input": "3\n1 2 3\n4\n2 4 6 49",
"output": "1"
},
{
"input": "2\n4 5\n3\n12 15 20",
"output": "1"
},
{
"input": "3\n2 5 7\n3\n4 5 7",
"output": "1"
},
{
"input": "3\n3 5 8\n3\n6 8 10",
"output": "2"
},
{
"input": "2\n2 3\n4\n4 6 9 33",
"output": "1"
},
{
"input": "2\n2 3\n4\n4 6 21 40",
"output": "1"
},
{
"input": "3\n4 9 10\n3\n8 9 10",
"output": "1"
},
{
"input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000",
"output": "1"
},
{
"input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14",
"output": "1"
}
] | 1,589,101,860 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 3 | 372 | 22,220,800 | t=int(input(""))
d=list(map(int,input("").split(" ")))
f=int(input(""))
a=list(map(int,input("").split(" ")))
v=[]
for i in d:
list=[]
for j in a:
if j%i==0:
list.append(j/i)
v.append(max(list))
g=max(v)
s=0
for o in range(len(v)):
if g==v[o]:
s+=1
print(s) | Title: Bicycle Chain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Output Specification:
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
Demo Input:
['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15. | ```python
t=int(input(""))
d=list(map(int,input("").split(" ")))
f=int(input(""))
a=list(map(int,input("").split(" ")))
v=[]
for i in d:
list=[]
for j in a:
if j%i==0:
list.append(j/i)
v.append(max(list))
g=max(v)
s=0
for o in range(len(v)):
if g==v[o]:
s+=1
print(s)
``` | -1 |
|
732 | A | Buy a Shovel | PROGRAMMING | 800 | [
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null | Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel. | The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels. | Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change. | [
"117 3\n",
"237 7\n",
"15 2\n"
] | [
"9\n",
"1\n",
"2\n"
] | In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change. | 500 | [
{
"input": "117 3",
"output": "9"
},
{
"input": "237 7",
"output": "1"
},
{
"input": "15 2",
"output": "2"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "1000 3",
"output": "1"
},
{
"input": "1000 1",
"output": "1"
},
{
"input": "1000 9",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "999 9",
"output": "1"
},
{
"input": "999 8",
"output": "2"
},
{
"input": "105 6",
"output": "2"
},
{
"input": "403 9",
"output": "3"
},
{
"input": "546 4",
"output": "4"
},
{
"input": "228 9",
"output": "5"
},
{
"input": "57 2",
"output": "6"
},
{
"input": "437 9",
"output": "7"
},
{
"input": "997 6",
"output": "8"
},
{
"input": "109 1",
"output": "9"
},
{
"input": "998 9",
"output": "5"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "9 3",
"output": "7"
},
{
"input": "8 2",
"output": "4"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "7"
},
{
"input": "1 8",
"output": "8"
},
{
"input": "100 3",
"output": "1"
},
{
"input": "1000 2",
"output": "1"
},
{
"input": "1000 4",
"output": "1"
},
{
"input": "1000 5",
"output": "1"
},
{
"input": "1000 6",
"output": "1"
},
{
"input": "1000 7",
"output": "1"
},
{
"input": "1000 8",
"output": "1"
},
{
"input": "23 4",
"output": "8"
},
{
"input": "33 1",
"output": "7"
},
{
"input": "33 2",
"output": "4"
},
{
"input": "666 5",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "12 4",
"output": "2"
},
{
"input": "15 5",
"output": "1"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "25 5",
"output": "1"
},
{
"input": "2 9",
"output": "5"
},
{
"input": "6 7",
"output": "5"
},
{
"input": "8 9",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "4 7",
"output": "5"
},
{
"input": "2 1",
"output": "5"
},
{
"input": "261 1",
"output": "1"
}
] | 1,700,285,868 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 0 | 1,000 | 9,932,800 | Pri, coin = map(int, input().split())
R = 1
X = int(str(Pri)[-1])
while True:
if str(X)[-1] == str(coin) or str(X)[-1] == '0':
break
R += 1
X += X
print(R)
| Title: Buy a Shovel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
Input Specification:
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Output Specification:
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
Demo Input:
['117 3\n', '237 7\n', '15 2\n']
Demo Output:
['9\n', '1\n', '2\n']
Note:
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change. | ```python
Pri, coin = map(int, input().split())
R = 1
X = int(str(Pri)[-1])
while True:
if str(X)[-1] == str(coin) or str(X)[-1] == '0':
break
R += 1
X += X
print(R)
``` | 0 |
|
479 | A | Expression | PROGRAMMING | 1,000 | [
"brute force",
"math"
] | null | null | Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get. | The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10). | Print the maximum value of the expression that you can obtain. | [
"1\n2\n3\n",
"2\n10\n3\n"
] | [
"9\n",
"60\n"
] | none | 500 | [
{
"input": "1\n2\n3",
"output": "9"
},
{
"input": "2\n10\n3",
"output": "60"
},
{
"input": "1\n1\n1",
"output": "3"
},
{
"input": "1\n2\n1",
"output": "4"
},
{
"input": "10\n10\n10",
"output": "1000"
},
{
"input": "5\n1\n3",
"output": "20"
},
{
"input": "3\n1\n5",
"output": "20"
},
{
"input": "6\n7\n1",
"output": "48"
},
{
"input": "1\n8\n3",
"output": "27"
},
{
"input": "9\n7\n2",
"output": "126"
},
{
"input": "1\n1\n10",
"output": "20"
},
{
"input": "9\n1\n1",
"output": "18"
},
{
"input": "10\n5\n6",
"output": "300"
},
{
"input": "8\n9\n7",
"output": "504"
},
{
"input": "4\n2\n10",
"output": "80"
},
{
"input": "2\n8\n3",
"output": "48"
},
{
"input": "3\n5\n7",
"output": "105"
},
{
"input": "1\n10\n1",
"output": "12"
},
{
"input": "2\n2\n2",
"output": "8"
},
{
"input": "5\n6\n1",
"output": "35"
},
{
"input": "10\n1\n1",
"output": "20"
},
{
"input": "1\n6\n1",
"output": "8"
},
{
"input": "1\n9\n1",
"output": "11"
},
{
"input": "2\n1\n2",
"output": "6"
},
{
"input": "2\n6\n1",
"output": "14"
},
{
"input": "9\n2\n1",
"output": "27"
},
{
"input": "1\n9\n2",
"output": "20"
},
{
"input": "1\n3\n1",
"output": "5"
},
{
"input": "2\n1\n1",
"output": "4"
}
] | 1,698,288,992 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 29 | 62 | 0 | a = int(input())
b = int(input())
c = int(input())
m = a+b+c
def ifm(res):
global m
if res > m: m = res
ifm(a*b*c)
ifm(a*b+c)
ifm(a*(b+c))
ifm(a+b*c)
ifm((a+b)*c)
print(m) | Title: Expression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
Input Specification:
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
Output Specification:
Print the maximum value of the expression that you can obtain.
Demo Input:
['1\n2\n3\n', '2\n10\n3\n']
Demo Output:
['9\n', '60\n']
Note:
none | ```python
a = int(input())
b = int(input())
c = int(input())
m = a+b+c
def ifm(res):
global m
if res > m: m = res
ifm(a*b*c)
ifm(a*b+c)
ifm(a*(b+c))
ifm(a+b*c)
ifm((a+b)*c)
print(m)
``` | 3 |
|
114 | A | Cifera | PROGRAMMING | 1,000 | [
"math"
] | null | null | When Petya went to school, he got interested in large numbers and what they were called in ancient times. For instance, he learned that the Russian word "tma" (which now means "too much to be counted") used to stand for a thousand and "tma tmyschaya" (which literally means "the tma of tmas") used to stand for a million.
Petya wanted to modernize the words we use for numbers and invented a word petricium that represents number *k*. Moreover, petricium la petricium stands for number *k*2, petricium la petricium la petricium stands for *k*3 and so on. All numbers of this form are called petriciumus cifera, and the number's importance is the number of articles la in its title.
Petya's invention brought on a challenge that needed to be solved quickly: does some number *l* belong to the set petriciumus cifera? As Petya is a very busy schoolboy he needs to automate the process, he asked you to solve it. | The first input line contains integer number *k*, the second line contains integer number *l* (2<=≤<=*k*,<=*l*<=≤<=231<=-<=1). | You should print in the first line of the output "YES", if the number belongs to the set petriciumus cifera and otherwise print "NO". If the number belongs to the set, then print on the seconds line the only number — the importance of number *l*. | [
"5\n25\n",
"3\n8\n"
] | [
"YES\n1\n",
"NO\n"
] | none | 500 | [
{
"input": "5\n25",
"output": "YES\n1"
},
{
"input": "3\n8",
"output": "NO"
},
{
"input": "123\n123",
"output": "YES\n0"
},
{
"input": "99\n970300",
"output": "NO"
},
{
"input": "1000\n6666666",
"output": "NO"
},
{
"input": "59\n3571",
"output": "NO"
},
{
"input": "256\n16777217",
"output": "NO"
},
{
"input": "4638\n21511044",
"output": "YES\n1"
},
{
"input": "24\n191102976",
"output": "YES\n5"
},
{
"input": "52010\n557556453",
"output": "NO"
},
{
"input": "61703211\n1750753082",
"output": "NO"
},
{
"input": "137\n2571353",
"output": "YES\n2"
},
{
"input": "8758\n1746157336",
"output": "NO"
},
{
"input": "2\n64",
"output": "YES\n5"
},
{
"input": "96\n884736",
"output": "YES\n2"
},
{
"input": "1094841453\n1656354409",
"output": "NO"
},
{
"input": "1154413\n1229512809",
"output": "NO"
},
{
"input": "2442144\n505226241",
"output": "NO"
},
{
"input": "11548057\n1033418098",
"output": "NO"
},
{
"input": "581\n196122941",
"output": "YES\n2"
},
{
"input": "146\n1913781536",
"output": "NO"
},
{
"input": "945916\n1403881488",
"output": "NO"
},
{
"input": "68269\n365689065",
"output": "NO"
},
{
"input": "30\n900",
"output": "YES\n1"
},
{
"input": "6\n1296",
"output": "YES\n3"
},
{
"input": "1470193122\n1420950405",
"output": "NO"
},
{
"input": "90750\n1793111557",
"output": "NO"
},
{
"input": "1950054\n1664545956",
"output": "NO"
},
{
"input": "6767692\n123762320",
"output": "NO"
},
{
"input": "1437134\n1622348229",
"output": "NO"
},
{
"input": "444103\n1806462642",
"output": "NO"
},
{
"input": "2592\n6718464",
"output": "YES\n1"
},
{
"input": "50141\n366636234",
"output": "NO"
},
{
"input": "835\n582182875",
"output": "YES\n2"
},
{
"input": "156604\n902492689",
"output": "NO"
},
{
"input": "27385965\n1742270058",
"output": "NO"
},
{
"input": "3\n9",
"output": "YES\n1"
},
{
"input": "35\n1838265625",
"output": "YES\n5"
},
{
"input": "8\n4096",
"output": "YES\n3"
},
{
"input": "85955\n945811082",
"output": "NO"
},
{
"input": "54958832\n956670209",
"output": "NO"
},
{
"input": "1475381\n1348159738",
"output": "NO"
},
{
"input": "7313241\n413670642",
"output": "NO"
},
{
"input": "582470\n2116368165",
"output": "NO"
},
{
"input": "26859739\n595086170",
"output": "NO"
},
{
"input": "249766393\n1582130",
"output": "NO"
},
{
"input": "11734\n137686756",
"output": "YES\n1"
},
{
"input": "925093\n1098566745",
"output": "NO"
},
{
"input": "40\n1600",
"output": "YES\n1"
},
{
"input": "2147483647\n2147483647",
"output": "YES\n0"
},
{
"input": "2147483646\n2147483647",
"output": "NO"
},
{
"input": "2147483647\n2147483646",
"output": "NO"
},
{
"input": "2\n2147483647",
"output": "NO"
},
{
"input": "2\n1073741825",
"output": "NO"
},
{
"input": "2\n1073741824",
"output": "YES\n29"
},
{
"input": "10000\n10",
"output": "NO"
},
{
"input": "10\n10000",
"output": "YES\n3"
},
{
"input": "10\n2000000000",
"output": "NO"
},
{
"input": "10\n1000000000",
"output": "YES\n8"
},
{
"input": "5\n1808548329",
"output": "NO"
},
{
"input": "2\n2147483646",
"output": "NO"
},
{
"input": "25\n125",
"output": "NO"
},
{
"input": "6\n18",
"output": "NO"
},
{
"input": "5\n30",
"output": "NO"
}
] | 1,580,298,045 | 2,147,483,647 | PyPy 3 | OK | TESTS | 64 | 310 | 0 | k = int(input())
l = int(input())
for x in range(32):
if l == k * pow(k,x):
print('YES')
print(x)
break
if l < k * pow(k,x):
print('NO')
break
| Title: Cifera
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Petya went to school, he got interested in large numbers and what they were called in ancient times. For instance, he learned that the Russian word "tma" (which now means "too much to be counted") used to stand for a thousand and "tma tmyschaya" (which literally means "the tma of tmas") used to stand for a million.
Petya wanted to modernize the words we use for numbers and invented a word petricium that represents number *k*. Moreover, petricium la petricium stands for number *k*2, petricium la petricium la petricium stands for *k*3 and so on. All numbers of this form are called petriciumus cifera, and the number's importance is the number of articles la in its title.
Petya's invention brought on a challenge that needed to be solved quickly: does some number *l* belong to the set petriciumus cifera? As Petya is a very busy schoolboy he needs to automate the process, he asked you to solve it.
Input Specification:
The first input line contains integer number *k*, the second line contains integer number *l* (2<=≤<=*k*,<=*l*<=≤<=231<=-<=1).
Output Specification:
You should print in the first line of the output "YES", if the number belongs to the set petriciumus cifera and otherwise print "NO". If the number belongs to the set, then print on the seconds line the only number — the importance of number *l*.
Demo Input:
['5\n25\n', '3\n8\n']
Demo Output:
['YES\n1\n', 'NO\n']
Note:
none | ```python
k = int(input())
l = int(input())
for x in range(32):
if l == k * pow(k,x):
print('YES')
print(x)
break
if l < k * pow(k,x):
print('NO')
break
``` | 3 |
|
715 | A | Plus and Square Root | PROGRAMMING | 1,600 | [
"constructive algorithms",
"math"
] | null | null | ZS the Coder is playing a game. There is a number displayed on the screen and there are two buttons, '<=+<=' (plus) and '' (square root). Initially, the number 2 is displayed on the screen. There are *n*<=+<=1 levels in the game and ZS the Coder start at the level 1.
When ZS the Coder is at level *k*, he can :
1. Press the '<=+<=' button. This increases the number on the screen by exactly *k*. So, if the number on the screen was *x*, it becomes *x*<=+<=*k*.1. Press the '' button. Let the number on the screen be *x*. After pressing this button, the number becomes . After that, ZS the Coder levels up, so his current level becomes *k*<=+<=1. This button can only be pressed when *x* is a perfect square, i.e. *x*<==<=*m*2 for some positive integer *m*.
Additionally, after each move, if ZS the Coder is at level *k*, and the number on the screen is *m*, then *m* must be a multiple of *k*. Note that this condition is only checked after performing the press. For example, if ZS the Coder is at level 4 and current number is 100, he presses the '' button and the number turns into 10. Note that at this moment, 10 is not divisible by 4, but this press is still valid, because after it, ZS the Coder is at level 5, and 10 is divisible by 5.
ZS the Coder needs your help in beating the game — he wants to reach level *n*<=+<=1. In other words, he needs to press the '' button *n* times. Help him determine the number of times he should press the '<=+<=' button before pressing the '' button at each level.
Please note that ZS the Coder wants to find just any sequence of presses allowing him to reach level *n*<=+<=1, but not necessarily a sequence minimizing the number of presses. | The first and only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000), denoting that ZS the Coder wants to reach level *n*<=+<=1. | Print *n* non-negative integers, one per line. *i*-th of them should be equal to the number of times that ZS the Coder needs to press the '<=+<=' button before pressing the '' button at level *i*.
Each number in the output should not exceed 1018. However, the number on the screen can be greater than 1018.
It is guaranteed that at least one solution exists. If there are multiple solutions, print any of them. | [
"3\n",
"2\n",
"4\n"
] | [
"14\n16\n46\n",
"999999999999999998\n44500000000\n",
"2\n17\n46\n97\n"
] | In the first sample case:
On the first level, ZS the Coder pressed the ' + ' button 14 times (and the number on screen is initially 2), so the number became 2 + 14·1 = 16. Then, ZS the Coder pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, and the number became <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c3d2663f5f74e9220fd5cbccbfaf4ca76ef7284f.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
After that, on the second level, ZS pressed the ' + ' button 16 times, so the number becomes 4 + 16·2 = 36. Then, ZS pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, levelling up and changing the number into <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/49ab1d31f1435b7c7b96550d63a35be671d3d85a.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
After that, on the third level, ZS pressed the ' + ' button 46 times, so the number becomes 6 + 46·3 = 144. Then, ZS pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, levelling up and changing the number into <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/499b57d4b7ba5e1e0957767cc182808ca48ef722.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Note that 12 is indeed divisible by 4, so ZS the Coder can reach level 4.
Also, note that pressing the ' + ' button 10 times on the third level before levelling up does not work, because the number becomes 6 + 10·3 = 36, and when the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button is pressed, the number becomes <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/49ab1d31f1435b7c7b96550d63a35be671d3d85a.png" style="max-width: 100.0%;max-height: 100.0%;"/> and ZS the Coder is at Level 4. However, 6 is not divisible by 4 now, so this is not a valid solution.
In the second sample case:
On the first level, ZS the Coder pressed the ' + ' button 999999999999999998 times (and the number on screen is initially 2), so the number became 2 + 999999999999999998·1 = 10<sup class="upper-index">18</sup>. Then, ZS the Coder pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, and the number became <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f07f2a60ab6cecbd2507861a0df57a16a015fd86.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
After that, on the second level, ZS pressed the ' + ' button 44500000000 times, so the number becomes 10<sup class="upper-index">9</sup> + 44500000000·2 = 9·10<sup class="upper-index">10</sup>. Then, ZS pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, levelling up and changing the number into <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4c4d8829d987a7bcfd597cd1aa101327a66c0eca.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Note that 300000 is a multiple of 3, so ZS the Coder can reach level 3. | 500 | [
{
"input": "3",
"output": "2\n17\n46"
},
{
"input": "2",
"output": "2\n17"
},
{
"input": "4",
"output": "2\n17\n46\n97"
},
{
"input": "1",
"output": "2"
},
{
"input": "100000",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "2016",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "12345",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "99997",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "99998",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "9999",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "99999",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "17823",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "22222",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "29137",
"output": "2\n17\n46\n97\n176\n289\n442\n641\n892\n1201\n1574\n2017\n2536\n3137\n3826\n4609\n5492\n6481\n7582\n8801\n10144\n11617\n13226\n14977\n16876\n18929\n21142\n23521\n26072\n28801\n31714\n34817\n38116\n41617\n45326\n49249\n53392\n57761\n62362\n67201\n72284\n77617\n83206\n89057\n95176\n101569\n108242\n115201\n122452\n130001\n137854\n146017\n154496\n163297\n172426\n181889\n191692\n201841\n212342\n223201\n234424\n246017\n257986\n270337\n283076\n296209\n309742\n323681\n338032\n352801\n367994\n383617\n399676\n416177..."
},
{
"input": "7",
"output": "2\n17\n46\n97\n176\n289\n442"
}
] | 1,535,281,802 | 2,147,483,647 | Python 3 | OK | TESTS | 15 | 514 | 102,400 | x=2
for i in range(1, int(input())+1):
print(i*(i+1)**2-x)
x=i
# Made By Mostafa_Khaled | Title: Plus and Square Root
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder is playing a game. There is a number displayed on the screen and there are two buttons, '<=+<=' (plus) and '' (square root). Initially, the number 2 is displayed on the screen. There are *n*<=+<=1 levels in the game and ZS the Coder start at the level 1.
When ZS the Coder is at level *k*, he can :
1. Press the '<=+<=' button. This increases the number on the screen by exactly *k*. So, if the number on the screen was *x*, it becomes *x*<=+<=*k*.1. Press the '' button. Let the number on the screen be *x*. After pressing this button, the number becomes . After that, ZS the Coder levels up, so his current level becomes *k*<=+<=1. This button can only be pressed when *x* is a perfect square, i.e. *x*<==<=*m*2 for some positive integer *m*.
Additionally, after each move, if ZS the Coder is at level *k*, and the number on the screen is *m*, then *m* must be a multiple of *k*. Note that this condition is only checked after performing the press. For example, if ZS the Coder is at level 4 and current number is 100, he presses the '' button and the number turns into 10. Note that at this moment, 10 is not divisible by 4, but this press is still valid, because after it, ZS the Coder is at level 5, and 10 is divisible by 5.
ZS the Coder needs your help in beating the game — he wants to reach level *n*<=+<=1. In other words, he needs to press the '' button *n* times. Help him determine the number of times he should press the '<=+<=' button before pressing the '' button at each level.
Please note that ZS the Coder wants to find just any sequence of presses allowing him to reach level *n*<=+<=1, but not necessarily a sequence minimizing the number of presses.
Input Specification:
The first and only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000), denoting that ZS the Coder wants to reach level *n*<=+<=1.
Output Specification:
Print *n* non-negative integers, one per line. *i*-th of them should be equal to the number of times that ZS the Coder needs to press the '<=+<=' button before pressing the '' button at level *i*.
Each number in the output should not exceed 1018. However, the number on the screen can be greater than 1018.
It is guaranteed that at least one solution exists. If there are multiple solutions, print any of them.
Demo Input:
['3\n', '2\n', '4\n']
Demo Output:
['14\n16\n46\n', '999999999999999998\n44500000000\n', '2\n17\n46\n97\n']
Note:
In the first sample case:
On the first level, ZS the Coder pressed the ' + ' button 14 times (and the number on screen is initially 2), so the number became 2 + 14·1 = 16. Then, ZS the Coder pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, and the number became <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c3d2663f5f74e9220fd5cbccbfaf4ca76ef7284f.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
After that, on the second level, ZS pressed the ' + ' button 16 times, so the number becomes 4 + 16·2 = 36. Then, ZS pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, levelling up and changing the number into <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/49ab1d31f1435b7c7b96550d63a35be671d3d85a.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
After that, on the third level, ZS pressed the ' + ' button 46 times, so the number becomes 6 + 46·3 = 144. Then, ZS pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, levelling up and changing the number into <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/499b57d4b7ba5e1e0957767cc182808ca48ef722.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Note that 12 is indeed divisible by 4, so ZS the Coder can reach level 4.
Also, note that pressing the ' + ' button 10 times on the third level before levelling up does not work, because the number becomes 6 + 10·3 = 36, and when the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button is pressed, the number becomes <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/49ab1d31f1435b7c7b96550d63a35be671d3d85a.png" style="max-width: 100.0%;max-height: 100.0%;"/> and ZS the Coder is at Level 4. However, 6 is not divisible by 4 now, so this is not a valid solution.
In the second sample case:
On the first level, ZS the Coder pressed the ' + ' button 999999999999999998 times (and the number on screen is initially 2), so the number became 2 + 999999999999999998·1 = 10<sup class="upper-index">18</sup>. Then, ZS the Coder pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, and the number became <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f07f2a60ab6cecbd2507861a0df57a16a015fd86.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
After that, on the second level, ZS pressed the ' + ' button 44500000000 times, so the number becomes 10<sup class="upper-index">9</sup> + 44500000000·2 = 9·10<sup class="upper-index">10</sup>. Then, ZS pressed the '<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c77ded9b8209a8cb488cc2ec7b7fe1dae32a5309.png" style="max-width: 100.0%;max-height: 100.0%;"/>' button, levelling up and changing the number into <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4c4d8829d987a7bcfd597cd1aa101327a66c0eca.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
Note that 300000 is a multiple of 3, so ZS the Coder can reach level 3. | ```python
x=2
for i in range(1, int(input())+1):
print(i*(i+1)**2-x)
x=i
# Made By Mostafa_Khaled
``` | 3 |
|
721 | A | One-dimensional Japanese Crossword | PROGRAMMING | 800 | [
"implementation"
] | null | null | Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew). | The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right. | [
"3\nBBW\n",
"5\nBWBWB\n",
"4\nWWWW\n",
"4\nBBBB\n",
"13\nWBBBBWWBWBBBW\n"
] | [
"1\n2 ",
"3\n1 1 1 ",
"0\n",
"1\n4 ",
"3\n4 1 3 "
] | The last sample case correspond to the picture in the statement. | 500 | [
{
"input": "3\nBBW",
"output": "1\n2 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "4\nWWWW",
"output": "0"
},
{
"input": "4\nBBBB",
"output": "1\n4 "
},
{
"input": "13\nWBBBBWWBWBBBW",
"output": "3\n4 1 3 "
},
{
"input": "1\nB",
"output": "1\n1 "
},
{
"input": "2\nBB",
"output": "1\n2 "
},
{
"input": "100\nWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWBWB",
"output": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "1\nW",
"output": "0"
},
{
"input": "2\nWW",
"output": "0"
},
{
"input": "2\nWB",
"output": "1\n1 "
},
{
"input": "2\nBW",
"output": "1\n1 "
},
{
"input": "3\nBBB",
"output": "1\n3 "
},
{
"input": "3\nBWB",
"output": "2\n1 1 "
},
{
"input": "3\nWBB",
"output": "1\n2 "
},
{
"input": "3\nWWB",
"output": "1\n1 "
},
{
"input": "3\nWBW",
"output": "1\n1 "
},
{
"input": "3\nBWW",
"output": "1\n1 "
},
{
"input": "3\nWWW",
"output": "0"
},
{
"input": "100\nBBBWWWWWWBBWWBBWWWBBWBBBBBBBBBBBWBBBWBBWWWBBWWBBBWBWWBBBWWBBBWBBBBBWWWBWWBBWWWWWWBWBBWWBWWWBWBWWWWWB",
"output": "21\n3 2 2 2 11 3 2 2 3 1 3 3 5 1 2 1 2 1 1 1 1 "
},
{
"input": "5\nBBBWB",
"output": "2\n3 1 "
},
{
"input": "5\nBWWWB",
"output": "2\n1 1 "
},
{
"input": "5\nWWWWB",
"output": "1\n1 "
},
{
"input": "5\nBWWWW",
"output": "1\n1 "
},
{
"input": "5\nBBBWW",
"output": "1\n3 "
},
{
"input": "5\nWWBBB",
"output": "1\n3 "
},
{
"input": "10\nBBBBBWWBBB",
"output": "2\n5 3 "
},
{
"input": "10\nBBBBWBBWBB",
"output": "3\n4 2 2 "
},
{
"input": "20\nBBBBBWWBWBBWBWWBWBBB",
"output": "6\n5 1 2 1 1 3 "
},
{
"input": "20\nBBBWWWWBBWWWBWBWWBBB",
"output": "5\n3 2 1 1 3 "
},
{
"input": "20\nBBBBBBBBWBBBWBWBWBBB",
"output": "5\n8 3 1 1 3 "
},
{
"input": "20\nBBBWBWBWWWBBWWWWBWBB",
"output": "6\n3 1 1 2 1 2 "
},
{
"input": "40\nBBBBBBWWWWBWBWWWBWWWWWWWWWWWBBBBBBBBBBBB",
"output": "5\n6 1 1 1 12 "
},
{
"input": "40\nBBBBBWBWWWBBWWWBWBWWBBBBWWWWBWBWBBBBBBBB",
"output": "9\n5 1 2 1 1 4 1 1 8 "
},
{
"input": "50\nBBBBBBBBBBBWWWWBWBWWWWBBBBBBBBWWWWWWWBWWWWBWBBBBBB",
"output": "7\n11 1 1 8 1 1 6 "
},
{
"input": "50\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "50\nBBBBBWWWWWBWWWBWWWWWBWWWBWWWWWWBBWBBWWWWBWWWWWWWBW",
"output": "9\n5 1 1 1 1 2 2 1 1 "
},
{
"input": "50\nWWWWBWWBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWBWWWWWWWBBBBB",
"output": "6\n1 1 1 1 1 5 "
},
{
"input": "50\nBBBBBWBWBWWBWBWWWWWWBWBWBWWWWWWWWWWWWWBWBWWWWBWWWB",
"output": "12\n5 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "100\nBBBBBBBBBBBWBWWWWBWWBBWBBWWWWWWWWWWBWBWWBWWWWWWWWWWWBBBWWBBWWWWWBWBWWWWBWWWWWWWWWWWBWWWWWBBBBBBBBBBB",
"output": "15\n11 1 1 2 2 1 1 1 3 2 1 1 1 1 11 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n100 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBWBWBWWWWWBWWWWWWWWWWWWWWBBWWWBWWWWBWWBWWWWWWBWWWWWWWWWWWWWBWBBBBBBBBBBBBBBBBBBBB",
"output": "11\n20 1 1 1 2 1 1 1 1 1 20 "
},
{
"input": "100\nBBBBWWWWWWWWWWWWWWWWWWWWWWWWWBWBWWWWWBWBWWWWWWBBWWWWWWWWWWWWBWWWWBWWWWWWWWWWWWBWWWWWWWBWWWWWWWBBBBBB",
"output": "11\n4 1 1 1 1 2 1 1 1 1 6 "
},
{
"input": "5\nBWBWB",
"output": "3\n1 1 1 "
},
{
"input": "10\nWWBWWWBWBB",
"output": "3\n1 1 2 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1\n50 "
},
{
"input": "50\nBBBBBBBBBBBBBBBBBWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n17 31 "
},
{
"input": "100\nBBBBBBBBBBBBBBBBBBBBBBBBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "2\n24 42 "
},
{
"input": "90\nWWBWWBWBBWBBWWBWBWBBBWBWBBBWBWBWBWBWBWBWBWBBBBBWBBWWWWBWBBWBWWBBBWBWBWWBWBWBWBWWWWWWBWBBBB",
"output": "30\n1 1 2 2 1 1 3 1 3 1 1 1 1 1 1 1 5 2 1 2 1 3 1 1 1 1 1 1 1 4 "
},
{
"input": "100\nBWWWBWBWBBBBBWBWWBWBWWWBWBWBWWBBWWBBBWBBBWWBWBWWBBBBWBWBBBWBWBBWWWWWWBWWBBBBWBWBWWBWBWWWBWBWWBWBWWWB",
"output": "31\n1 1 1 5 1 1 1 1 1 1 2 3 3 1 1 4 1 3 1 2 1 4 1 1 1 1 1 1 1 1 1 "
},
{
"input": "90\nWBWBBBBBBWWWBBWWBWWWBBWWBWWWBWBBWBWBBWWWWBWBWBBWBBWBWWWBBWBBWWWWBWBBWWWBBBWBBWBWBBBBWWBWWB",
"output": "25\n1 6 2 1 2 1 1 2 1 2 1 1 2 2 1 2 2 1 2 3 2 1 4 1 1 "
},
{
"input": "80\nBBWWBBBWBBWWWWBBWBWBBWWWWWBWBBWWBWBWBWBWBWWBWWBWWWBWBBWBBWBBWBBBWWBBBBBBBWBBBWBB",
"output": "23\n2 3 2 2 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 3 7 3 2 "
},
{
"input": "65\nWWWWBWWWBBBBBWWWWWWBBBWWBBBBWWWWWWWWBBBWWWWBWBWWBBWWWWBWWWBBWBBBB",
"output": "11\n1 5 3 4 3 1 1 2 1 2 4 "
}
] | 1,661,130,260 | 2,147,483,647 | Python 3 | OK | TESTS | 54 | 46 | 0 | a = int(input())
chars = input()
newSeq = False
seqCount = 0
seqs = 0
toPrint = []
for i in range(len(chars)):
if (chars[i] == "B"):
seqCount += 1
if (newSeq == False):
newSeq = True
if(i == len(chars) - 1): # last loop
toPrint.append(seqCount )
seqs += 1
elif chars[i] == "W":
if (newSeq == True):
newSeq = False
toPrint.append(seqCount )
seqCount = 0
seqs += 1
# else:
# if(chars[i] == "B"):
# toPrint.append(seqCount + 1)
# seqs += 1
print(seqs)
if (len(toPrint) > 0):
print(*toPrint)
| Title: One-dimensional Japanese Crossword
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Adaltik discovered japanese crosswords. Japanese crossword is a picture, represented as a table sized *a*<=×<=*b* squares, and each square is colored white or black. There are integers to the left of the rows and to the top of the columns, encrypting the corresponding row or column. The number of integers represents how many groups of black squares there are in corresponding row or column, and the integers themselves represents the number of consecutive black squares in corresponding group (you can find more detailed explanation in Wikipedia [https://en.wikipedia.org/wiki/Japanese_crossword](https://en.wikipedia.org/wiki/Japanese_crossword)).
Adaltik decided that the general case of japanese crossword is too complicated and drew a row consisting of *n* squares (e.g. japanese crossword sized 1<=×<=*n*), which he wants to encrypt in the same way as in japanese crossword.
Help Adaltik find the numbers encrypting the row he drew.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the row. The second line of the input contains a single string consisting of *n* characters 'B' or 'W', ('B' corresponds to black square, 'W' — to white square in the row that Adaltik drew).
Output Specification:
The first line should contain a single integer *k* — the number of integers encrypting the row, e.g. the number of groups of black squares in the row.
The second line should contain *k* integers, encrypting the row, e.g. corresponding to sizes of groups of consecutive black squares in the order from left to right.
Demo Input:
['3\nBBW\n', '5\nBWBWB\n', '4\nWWWW\n', '4\nBBBB\n', '13\nWBBBBWWBWBBBW\n']
Demo Output:
['1\n2 ', '3\n1 1 1 ', '0\n', '1\n4 ', '3\n4 1 3 ']
Note:
The last sample case correspond to the picture in the statement. | ```python
a = int(input())
chars = input()
newSeq = False
seqCount = 0
seqs = 0
toPrint = []
for i in range(len(chars)):
if (chars[i] == "B"):
seqCount += 1
if (newSeq == False):
newSeq = True
if(i == len(chars) - 1): # last loop
toPrint.append(seqCount )
seqs += 1
elif chars[i] == "W":
if (newSeq == True):
newSeq = False
toPrint.append(seqCount )
seqCount = 0
seqs += 1
# else:
# if(chars[i] == "B"):
# toPrint.append(seqCount + 1)
# seqs += 1
print(seqs)
if (len(toPrint) > 0):
print(*toPrint)
``` | 3 |
|
381 | A | Sereja and Dima | PROGRAMMING | 800 | [
"greedy",
"implementation",
"two pointers"
] | null | null | Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her. | The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000. | On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game. | [
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] | [
"12 5\n",
"16 12\n"
] | In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5. | 500 | [
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,689,691,219 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 46 | 0 | n = int(input())
cards = list(map(int , input().split()))
sereja = 0
dima = 0
while len(cards) != 0:
sereja += max(cards[0], cards[len(cards)-1])
cards.remove(max(cards[0], cards[len(cards)-1]))
if len(cards) == 0:
break
dima += max(cards[0], cards[len(cards)-1])
cards.remove(max(cards[0], cards[len(cards)-1]))
print(sereja , dima) | Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5. | ```python
n = int(input())
cards = list(map(int , input().split()))
sereja = 0
dima = 0
while len(cards) != 0:
sereja += max(cards[0], cards[len(cards)-1])
cards.remove(max(cards[0], cards[len(cards)-1]))
if len(cards) == 0:
break
dima += max(cards[0], cards[len(cards)-1])
cards.remove(max(cards[0], cards[len(cards)-1]))
print(sereja , dima)
``` | 3 |
|
337 | B | Routine Problem | PROGRAMMING | 1,400 | [
"greedy",
"math",
"number theory"
] | null | null | Manao has a monitor. The screen of the monitor has horizontal to vertical length ratio *a*:*b*. Now he is going to watch a movie. The movie's frame has horizontal to vertical length ratio *c*:*d*. Manao adjusts the view in such a way that the movie preserves the original frame ratio, but also occupies as much space on the screen as possible and fits within it completely. Thus, he may have to zoom the movie in or out, but Manao will always change the frame proportionally in both dimensions.
Calculate the ratio of empty screen (the part of the screen not occupied by the movie) to the total screen size. Print the answer as an irreducible fraction *p*<=/<=*q*. | A single line contains four space-separated integers *a*, *b*, *c*, *d* (1<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000). | Print the answer to the problem as "p/q", where *p* is a non-negative integer, *q* is a positive integer and numbers *p* and *q* don't have a common divisor larger than 1. | [
"1 1 3 2\n",
"4 3 2 2\n"
] | [
"1/3\n",
"1/4\n"
] | Sample 1. Manao's monitor has a square screen. The movie has 3:2 horizontal to vertical length ratio. Obviously, the movie occupies most of the screen if the width of the picture coincides with the width of the screen. In this case, only 2/3 of the monitor will project the movie in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/ce823413ad27813e27496a0d8bd4231e94b47662.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Sample 2. This time the monitor's width is 4/3 times larger than its height and the movie's frame is square. In this case, the picture must take up the whole monitor in the vertical dimension and only 3/4 in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/c2bcb3b1f64810812eee368ff180e3e148d24c67.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 1,000 | [
{
"input": "1 1 3 2",
"output": "1/3"
},
{
"input": "4 3 2 2",
"output": "1/4"
},
{
"input": "3 4 2 3",
"output": "1/9"
},
{
"input": "4 4 5 5",
"output": "0/1"
},
{
"input": "1 1 1 1",
"output": "0/1"
},
{
"input": "1000 1000 1000 1000",
"output": "0/1"
},
{
"input": "125 992 14 25",
"output": "10763/13888"
},
{
"input": "999 998 997 996",
"output": "1/497503"
},
{
"input": "984 286 976 284",
"output": "10/8733"
},
{
"input": "999 1000 1000 999",
"output": "1999/1000000"
},
{
"input": "999 1000 998 999",
"output": "1/998001"
},
{
"input": "1 1000 1000 1",
"output": "999999/1000000"
},
{
"input": "1 999 1000 1",
"output": "998999/999000"
},
{
"input": "50 80 6 3",
"output": "11/16"
},
{
"input": "114 891 20 3",
"output": "971/990"
},
{
"input": "10 13 75 57",
"output": "27/65"
},
{
"input": "21 35 34 51",
"output": "1/10"
},
{
"input": "41 95 82 30",
"output": "16/19"
},
{
"input": "123 150 82 60",
"output": "2/5"
},
{
"input": "100 175 164 82",
"output": "5/7"
},
{
"input": "101 202 37 72",
"output": "1/37"
},
{
"input": "103 305 34 61",
"output": "67/170"
},
{
"input": "100 131 70 77",
"output": "21/131"
},
{
"input": "193 246 82 95",
"output": "1837/20172"
},
{
"input": "188 199 121 123",
"output": "955/24079"
},
{
"input": "289 361 162 198",
"output": "70/3249"
},
{
"input": "294 356 178 185",
"output": "4489/31684"
},
{
"input": "201 335 268 402",
"output": "1/10"
},
{
"input": "202 404 404 505",
"output": "3/8"
},
{
"input": "206 412 309 515",
"output": "1/6"
},
{
"input": "803 949 657 730",
"output": "7/117"
},
{
"input": "804 938 871 938",
"output": "1/13"
},
{
"input": "826 944 826 885",
"output": "1/16"
},
{
"input": "603 938 804 871",
"output": "17/56"
}
] | 1,687,978,220 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 60 | 0 | from math import gcd
a, b, c, d = map(int, input().split())
if a*d > b * c: a, b, c, d = b, a, d, c
p, q = b * c - a * d, b * c
print(p // gcd(p, q), q // gcd(p, q)) | Title: Routine Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao has a monitor. The screen of the monitor has horizontal to vertical length ratio *a*:*b*. Now he is going to watch a movie. The movie's frame has horizontal to vertical length ratio *c*:*d*. Manao adjusts the view in such a way that the movie preserves the original frame ratio, but also occupies as much space on the screen as possible and fits within it completely. Thus, he may have to zoom the movie in or out, but Manao will always change the frame proportionally in both dimensions.
Calculate the ratio of empty screen (the part of the screen not occupied by the movie) to the total screen size. Print the answer as an irreducible fraction *p*<=/<=*q*.
Input Specification:
A single line contains four space-separated integers *a*, *b*, *c*, *d* (1<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000).
Output Specification:
Print the answer to the problem as "p/q", where *p* is a non-negative integer, *q* is a positive integer and numbers *p* and *q* don't have a common divisor larger than 1.
Demo Input:
['1 1 3 2\n', '4 3 2 2\n']
Demo Output:
['1/3\n', '1/4\n']
Note:
Sample 1. Manao's monitor has a square screen. The movie has 3:2 horizontal to vertical length ratio. Obviously, the movie occupies most of the screen if the width of the picture coincides with the width of the screen. In this case, only 2/3 of the monitor will project the movie in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/ce823413ad27813e27496a0d8bd4231e94b47662.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Sample 2. This time the monitor's width is 4/3 times larger than its height and the movie's frame is square. In this case, the picture must take up the whole monitor in the vertical dimension and only 3/4 in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/c2bcb3b1f64810812eee368ff180e3e148d24c67.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
from math import gcd
a, b, c, d = map(int, input().split())
if a*d > b * c: a, b, c, d = b, a, d, c
p, q = b * c - a * d, b * c
print(p // gcd(p, q), q // gcd(p, q))
``` | 0 |
|
903 | A | Hungry Student Problem | PROGRAMMING | 900 | [
"greedy",
"implementation"
] | null | null | Ivan's classes at the university have just finished, and now he wants to go to the local CFK cafe and eat some fried chicken.
CFK sells chicken chunks in small and large portions. A small portion contains 3 chunks; a large one — 7 chunks. Ivan wants to eat exactly *x* chunks. Now he wonders whether he can buy exactly this amount of chicken.
Formally, Ivan wants to know if he can choose two non-negative integers *a* and *b* in such a way that *a* small portions and *b* large ones contain exactly *x* chunks.
Help Ivan to answer this question for several values of *x*! | The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of testcases.
The *i*-th of the following *n* lines contains one integer *x**i* (1<=≤<=*x**i*<=≤<=100) — the number of chicken chunks Ivan wants to eat. | Print *n* lines, in *i*-th line output YES if Ivan can buy exactly *x**i* chunks. Otherwise, print NO. | [
"2\n6\n5\n"
] | [
"YES\nNO\n"
] | In the first example Ivan can buy two small portions.
In the second example Ivan cannot buy exactly 5 chunks, since one small portion is not enough, but two small portions or one large is too much. | 0 | [
{
"input": "2\n6\n5",
"output": "YES\nNO"
},
{
"input": "100\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n11\n12\n13\n14\n15\n16\n17\n18\n19\n20\n21\n22\n23\n24\n25\n26\n27\n28\n29\n30\n31\n32\n33\n34\n35\n36\n37\n38\n39\n40\n41\n42\n43\n44\n45\n46\n47\n48\n49\n50\n51\n52\n53\n54\n55\n56\n57\n58\n59\n60\n61\n62\n63\n64\n65\n66\n67\n68\n69\n70\n71\n72\n73\n74\n75\n76\n77\n78\n79\n80\n81\n82\n83\n84\n85\n86\n87\n88\n89\n90\n91\n92\n93\n94\n95\n96\n97\n98\n99\n100",
"output": "NO\nNO\nYES\nNO\nNO\nYES\nYES\nNO\nYES\nYES\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
},
{
"input": "3\n6\n6\n6",
"output": "YES\nYES\nYES"
},
{
"input": "47\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "3\n1\n52\n76",
"output": "NO\nYES\nYES"
},
{
"input": "87\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
},
{
"input": "3\n3\n2\n1",
"output": "YES\nNO\nNO"
},
{
"input": "100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100\n100",
"output": "YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,646,050,745 | 2,147,483,647 | PyPy 3-64 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | n=int(input())
for i in range(n):
a=int(input())
if a%7==0 or a%3==0 or a%10==0 or a%13==0 or a%17==0 or a%23==0 or a%37==0 or a %44==0 or (a-10)%3==0 or (a-13)%3==0 or (a-10)%7==0 or (a-13)%7==0
print('YES')
else:
print('NO')
| Title: Hungry Student Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan's classes at the university have just finished, and now he wants to go to the local CFK cafe and eat some fried chicken.
CFK sells chicken chunks in small and large portions. A small portion contains 3 chunks; a large one — 7 chunks. Ivan wants to eat exactly *x* chunks. Now he wonders whether he can buy exactly this amount of chicken.
Formally, Ivan wants to know if he can choose two non-negative integers *a* and *b* in such a way that *a* small portions and *b* large ones contain exactly *x* chunks.
Help Ivan to answer this question for several values of *x*!
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of testcases.
The *i*-th of the following *n* lines contains one integer *x**i* (1<=≤<=*x**i*<=≤<=100) — the number of chicken chunks Ivan wants to eat.
Output Specification:
Print *n* lines, in *i*-th line output YES if Ivan can buy exactly *x**i* chunks. Otherwise, print NO.
Demo Input:
['2\n6\n5\n']
Demo Output:
['YES\nNO\n']
Note:
In the first example Ivan can buy two small portions.
In the second example Ivan cannot buy exactly 5 chunks, since one small portion is not enough, but two small portions or one large is too much. | ```python
n=int(input())
for i in range(n):
a=int(input())
if a%7==0 or a%3==0 or a%10==0 or a%13==0 or a%17==0 or a%23==0 or a%37==0 or a %44==0 or (a-10)%3==0 or (a-13)%3==0 or (a-10)%7==0 or (a-13)%7==0
print('YES')
else:
print('NO')
``` | -1 |
|
812 | A | Sagheer and Crossroads | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | Sagheer is walking in the street when he comes to an intersection of two roads. Each road can be represented as two parts where each part has 3 lanes getting into the intersection (one for each direction) and 3 lanes getting out of the intersection, so we have 4 parts in total. Each part has 4 lights, one for each lane getting into the intersection (*l* — left, *s* — straight, *r* — right) and a light *p* for a pedestrian crossing.
An accident is possible if a car can hit a pedestrian. This can happen if the light of a pedestrian crossing of some part and the light of a lane that can get to or from that same part are green at the same time.
Now, Sagheer is monitoring the configuration of the traffic lights. Your task is to help him detect whether an accident is possible. | The input consists of four lines with each line describing a road part given in a counter-clockwise order.
Each line contains four integers *l*, *s*, *r*, *p* — for the left, straight, right and pedestrian lights, respectively. The possible values are 0 for red light and 1 for green light. | On a single line, print "YES" if an accident is possible, and "NO" otherwise. | [
"1 0 0 1\n0 1 0 0\n0 0 1 0\n0 0 0 1\n",
"0 1 1 0\n1 0 1 0\n1 1 0 0\n0 0 0 1\n",
"1 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 1 0\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | In the first example, some accidents are possible because cars of part 1 can hit pedestrians of parts 1 and 4. Also, cars of parts 2 and 3 can hit pedestrians of part 4.
In the second example, no car can pass the pedestrian crossing of part 4 which is the only green pedestrian light. So, no accident can occur. | 500 | [
{
"input": "1 0 0 1\n0 1 0 0\n0 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 1 1 0\n1 0 1 0\n1 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "1 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 1 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "1 1 1 0\n0 1 0 1\n1 1 1 0\n1 1 1 1",
"output": "YES"
},
{
"input": "0 1 1 0\n0 1 0 0\n1 0 0 1\n1 0 0 0",
"output": "YES"
},
{
"input": "1 0 0 0\n0 1 0 0\n1 1 0 0\n0 1 1 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 1\n1 0 1 1\n1 1 1 0",
"output": "YES"
},
{
"input": "1 1 0 0\n0 1 0 1\n1 1 1 0\n0 0 1 1",
"output": "YES"
},
{
"input": "0 1 0 0\n0 0 0 0\n1 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 1 0\n0 0 0 0\n1 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 1 0\n0 1 0 1\n1 0 1 0\n0 0 1 0",
"output": "YES"
},
{
"input": "1 1 1 0\n0 1 0 1\n1 1 1 1\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 1 0\n0 0 0 0\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 1\n1 0 1 1\n0 0 0 1",
"output": "YES"
},
{
"input": "1 1 0 0\n0 1 0 0\n1 1 1 0\n1 0 1 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "1 0 1 0\n1 1 0 0\n1 1 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 1 0\n1 1 0 0\n1 0 1 0\n1 0 0 0",
"output": "NO"
},
{
"input": "0 0 1 0\n1 0 0 0\n0 0 0 1\n0 0 0 1",
"output": "NO"
},
{
"input": "0 1 1 0\n1 1 0 1\n1 0 0 1\n1 1 1 0",
"output": "YES"
},
{
"input": "1 0 0 0\n1 1 0 0\n1 1 0 1\n0 0 1 0",
"output": "YES"
},
{
"input": "0 0 0 0\n1 1 0 0\n0 0 0 1\n0 0 1 0",
"output": "NO"
},
{
"input": "0 1 0 0\n0 0 0 1\n0 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 1 0 0\n1 1 0 1\n1 0 0 1\n1 1 0 1",
"output": "YES"
},
{
"input": "1 0 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 1 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n1 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 1 0 0\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 1 0\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n1 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 1 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 1 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 0 0\n1 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 0 0\n0 1 0 0",
"output": "NO"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 0 0 0\n0 0 1 0",
"output": "YES"
},
{
"input": "1 0 0 0\n0 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 1 0 0\n0 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 1 0\n0 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n1 0 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 1 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 1 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 1\n1 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 1 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 1 0\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 0\n0 1 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 1\n0 0 0 0\n0 0 1 0",
"output": "NO"
},
{
"input": "1 0 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 1 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 1 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n1 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 0\n0 0 0 1\n0 0 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 1 0\n0 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n1 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 1 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 1 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n1 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n0 1 0 0",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 1\n0 0 1 0",
"output": "NO"
},
{
"input": "1 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 1 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 1 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n1 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 1 0 0\n0 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 1 0\n0 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n1 0 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 1 0 0\n0 0 0 1",
"output": "NO"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n1 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n0 1 0 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "0 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "NO"
},
{
"input": "1 1 1 1\n1 1 1 1\n1 1 1 1\n1 1 1 1",
"output": "YES"
},
{
"input": "1 0 0 0\n0 1 0 0\n0 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "1 1 1 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "1 0 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 1 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n1 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 0 0\n0 0 0 0\n0 0 0 1\n0 0 0 0",
"output": "YES"
},
{
"input": "0 1 1 0\n1 0 1 0\n1 1 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "1 1 0 1\n0 0 0 0\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "1 1 1 0\n1 1 1 0\n1 1 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "1 0 0 0\n0 0 0 0\n0 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 0\n0 1 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 1 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 1 1 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 1 0 1\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 1\n0 0 0 0\n0 1 0 0",
"output": "YES"
},
{
"input": "0 0 0 1\n0 0 0 1\n1 0 0 0\n0 0 0 0",
"output": "YES"
}
] | 1,496,326,891 | 391 | Python 3 | CHALLENGED | CHALLENGES | 7 | 46 | 0 | ans = 'NO'
for i in range(4):
l, s, r, p = map(int, input().split())
if (p == 1) and ((l + s + r) >= 1):
ans = 'YES'
print(ans) | Title: Sagheer and Crossroads
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sagheer is walking in the street when he comes to an intersection of two roads. Each road can be represented as two parts where each part has 3 lanes getting into the intersection (one for each direction) and 3 lanes getting out of the intersection, so we have 4 parts in total. Each part has 4 lights, one for each lane getting into the intersection (*l* — left, *s* — straight, *r* — right) and a light *p* for a pedestrian crossing.
An accident is possible if a car can hit a pedestrian. This can happen if the light of a pedestrian crossing of some part and the light of a lane that can get to or from that same part are green at the same time.
Now, Sagheer is monitoring the configuration of the traffic lights. Your task is to help him detect whether an accident is possible.
Input Specification:
The input consists of four lines with each line describing a road part given in a counter-clockwise order.
Each line contains four integers *l*, *s*, *r*, *p* — for the left, straight, right and pedestrian lights, respectively. The possible values are 0 for red light and 1 for green light.
Output Specification:
On a single line, print "YES" if an accident is possible, and "NO" otherwise.
Demo Input:
['1 0 0 1\n0 1 0 0\n0 0 1 0\n0 0 0 1\n', '0 1 1 0\n1 0 1 0\n1 1 0 0\n0 0 0 1\n', '1 0 0 0\n0 0 0 1\n0 0 0 0\n1 0 1 0\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
In the first example, some accidents are possible because cars of part 1 can hit pedestrians of parts 1 and 4. Also, cars of parts 2 and 3 can hit pedestrians of part 4.
In the second example, no car can pass the pedestrian crossing of part 4 which is the only green pedestrian light. So, no accident can occur. | ```python
ans = 'NO'
for i in range(4):
l, s, r, p = map(int, input().split())
if (p == 1) and ((l + s + r) >= 1):
ans = 'YES'
print(ans)
``` | -1 |
|
297 | B | Fish Weight | PROGRAMMING | 1,600 | [
"constructive algorithms",
"greedy"
] | null | null | It is known that there are *k* fish species in the polar ocean, numbered from 1 to *k*. They are sorted by non-decreasing order of their weight, which is a positive number. Let the weight of the *i*-th type of fish be *w**i*, then 0<=<<=*w*1<=≤<=*w*2<=≤<=...<=≤<=*w**k* holds.
Polar bears Alice and Bob each have caught some fish, and they are guessing who has the larger sum of weight of the fish he/she's caught. Given the type of the fish they've caught, determine whether it is possible that the fish caught by Alice has a strictly larger total weight than Bob's. In other words, does there exist a sequence of weights *w**i* (not necessary integers), such that the fish caught by Alice has a strictly larger total weight? | The first line contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=105,<=1<=≤<=*k*<=≤<=109) — the number of fish caught by Alice and Bob respectively, and the number of fish species.
The second line contains *n* integers each from 1 to *k*, the list of fish type caught by Alice. The third line contains *m* integers each from 1 to *k*, the list of fish type caught by Bob.
Note that one may have caught more than one fish for a same species. | Output "YES" (without quotes) if it is possible, and "NO" (without quotes) otherwise. | [
"3 3 3\n2 2 2\n1 1 3\n",
"4 7 9\n5 2 7 3\n3 5 2 7 3 8 7\n"
] | [
"YES\n",
"NO\n"
] | In the first sample, if *w*<sub class="lower-index">1</sub> = 1, *w*<sub class="lower-index">2</sub> = 2, *w*<sub class="lower-index">3</sub> = 2.5, then Alice has a total of 2 + 2 + 2 = 6 weight units, while Bob only has 1 + 1 + 2.5 = 4.5.
In the second sample, the fish that Alice caught is a subset of Bob's. Therefore, the total weight of Bob’s fish is always not less than the total weight of Alice’s fish. | 500 | [
{
"input": "3 3 3\n2 2 2\n1 1 3",
"output": "YES"
},
{
"input": "4 7 9\n5 2 7 3\n3 5 2 7 3 8 7",
"output": "NO"
},
{
"input": "5 5 10\n8 2 8 5 9\n9 1 7 5 1",
"output": "YES"
},
{
"input": "7 7 10\n8 2 8 10 6 9 10\n2 4 9 5 6 2 5",
"output": "YES"
},
{
"input": "15 15 10\n4 5 9 1 4 6 4 1 4 3 7 9 9 2 6\n6 6 7 7 2 9 1 6 10 9 7 10 7 10 9",
"output": "NO"
},
{
"input": "25 25 10\n10 6 2 1 9 7 2 5 6 9 2 3 2 8 5 8 2 9 10 8 9 7 7 4 8\n6 2 10 4 7 9 3 2 4 5 1 8 6 9 8 6 9 8 4 8 7 9 10 2 8",
"output": "NO"
},
{
"input": "50 100 10\n10 9 10 5 5 2 2 6 4 8 9 1 6 3 9 7 8 3 8 5 6 6 5 7 2 10 3 6 8 1 8 8 9 5 10 1 5 10 9 4 7 8 10 3 3 4 7 8 6 3\n5 3 2 6 4 10 2 3 1 8 8 10 1 1 4 3 9 2 9 9 8 8 7 9 4 1 1 10 5 6 3 7 2 10 2 3 3 3 7 4 1 3 1 6 7 6 1 9 1 7 6 8 6 1 3 3 3 4 3 6 7 8 2 5 4 1 4 8 3 9 7 4 10 5 3 6 3 1 4 10 3 6 1 8 4 6 10 9 6 2 8 3 7 5 3 4 10 9 1 4",
"output": "NO"
},
{
"input": "100 50 10\n7 8 7 1 6 7 9 2 4 6 7 7 3 9 4 5 1 7 8 10 4 1 3 6 8 10 4 6 6 1 6 6 7 4 10 3 10 1 3 2 10 6 9 9 5 2 9 2 9 8 10 2 10 3 3 2 3 8 6 2 7 10 7 2 7 2 8 9 6 2 5 4 4 5 3 3 9 10 9 4 9 3 9 5 3 6 6 1 3 6 10 3 10 2 6 10 10 10 4 8\n3 3 2 9 4 4 10 2 7 3 3 2 6 3 3 4 7 4 1 2 3 8 1 6 7 7 2 10 1 1 1 5 7 7 5 1 6 8 7 5 3 7 4 6 10 5 5 5 1 9",
"output": "YES"
},
{
"input": "2 2 1000000000\n398981840 446967516\n477651114 577011341",
"output": "NO"
},
{
"input": "1 1 1\n1\n1",
"output": "NO"
},
{
"input": "1 1 1000000000\n502700350\n502700349",
"output": "YES"
},
{
"input": "1 1 1000000000\n406009709\n406009709",
"output": "NO"
},
{
"input": "2 1 1000000000\n699573624 308238132\n308238132",
"output": "YES"
},
{
"input": "10 10 10\n2 10 8 1 10 4 6 1 3 7\n8 1 1 5 7 1 9 10 2 3",
"output": "YES"
},
{
"input": "5 4 5\n1 2 2 3 4\n1 3 4 5",
"output": "YES"
}
] | 1,658,737,556 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 122 | 0 | def f(a,b):
if len(a)>len(b):return 'YES'
a.sort()
b.sort()
print(a,b)
if any(a[-i]-b[-i]>0 for i in range(1,len(a)+1)):
return 'YES'
return 'NO'
if __name__=='__main__':
n,m,k=(int(i) for i in input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
print(f(a,b)) | Title: Fish Weight
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is known that there are *k* fish species in the polar ocean, numbered from 1 to *k*. They are sorted by non-decreasing order of their weight, which is a positive number. Let the weight of the *i*-th type of fish be *w**i*, then 0<=<<=*w*1<=≤<=*w*2<=≤<=...<=≤<=*w**k* holds.
Polar bears Alice and Bob each have caught some fish, and they are guessing who has the larger sum of weight of the fish he/she's caught. Given the type of the fish they've caught, determine whether it is possible that the fish caught by Alice has a strictly larger total weight than Bob's. In other words, does there exist a sequence of weights *w**i* (not necessary integers), such that the fish caught by Alice has a strictly larger total weight?
Input Specification:
The first line contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=105,<=1<=≤<=*k*<=≤<=109) — the number of fish caught by Alice and Bob respectively, and the number of fish species.
The second line contains *n* integers each from 1 to *k*, the list of fish type caught by Alice. The third line contains *m* integers each from 1 to *k*, the list of fish type caught by Bob.
Note that one may have caught more than one fish for a same species.
Output Specification:
Output "YES" (without quotes) if it is possible, and "NO" (without quotes) otherwise.
Demo Input:
['3 3 3\n2 2 2\n1 1 3\n', '4 7 9\n5 2 7 3\n3 5 2 7 3 8 7\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, if *w*<sub class="lower-index">1</sub> = 1, *w*<sub class="lower-index">2</sub> = 2, *w*<sub class="lower-index">3</sub> = 2.5, then Alice has a total of 2 + 2 + 2 = 6 weight units, while Bob only has 1 + 1 + 2.5 = 4.5.
In the second sample, the fish that Alice caught is a subset of Bob's. Therefore, the total weight of Bob’s fish is always not less than the total weight of Alice’s fish. | ```python
def f(a,b):
if len(a)>len(b):return 'YES'
a.sort()
b.sort()
print(a,b)
if any(a[-i]-b[-i]>0 for i in range(1,len(a)+1)):
return 'YES'
return 'NO'
if __name__=='__main__':
n,m,k=(int(i) for i in input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
print(f(a,b))
``` | 0 |
|
802 | G | Fake News (easy) | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it... | The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z). | Output YES if the string *s* contains heidi as a subsequence and NO otherwise. | [
"abcheaibcdi\n",
"hiedi\n"
] | [
"YES",
"NO"
] | A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*. | 0 | [
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,589,834,582 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 2 | 218 | 2,150,400 | s = input()
s2 = ['h', 'e', 'i', 'd', 'i']
n = [-1 for i in range(5)]
id = 0
for i in range(len(s)):
if s[i] == s2[id] and n[id] == -1:
# print(s[i], s2[id])
n[id] = i
id+=1
for i in n:
if i == -1:
print("NO")
break
else:
print("YES")
# print(n)
| Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*. | ```python
s = input()
s2 = ['h', 'e', 'i', 'd', 'i']
n = [-1 for i in range(5)]
id = 0
for i in range(len(s)):
if s[i] == s2[id] and n[id] == -1:
# print(s[i], s2[id])
n[id] = i
id+=1
for i in n:
if i == -1:
print("NO")
break
else:
print("YES")
# print(n)
``` | -1 |
|
867 | A | Between the Offices | PROGRAMMING | 800 | [
"implementation"
] | null | null | As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. | The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. | Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower). | [
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] | [
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] | In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | 500 | [
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,586,706,690 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 124 | 0 | from sys import stdin
inp = stdin.readline
n = int(inp().strip())
s = inp().strip()
stf = 0
fts = 0
prev = s[0]
for city in s:
if prev == 'S' and city == 'F':
stf += 1
elif prev == 'F' and city == 'S':
fts += 1
prev = city
print("YES" if stf > fts else "NO") | Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | ```python
from sys import stdin
inp = stdin.readline
n = int(inp().strip())
s = inp().strip()
stf = 0
fts = 0
prev = s[0]
for city in s:
if prev == 'S' and city == 'F':
stf += 1
elif prev == 'F' and city == 'S':
fts += 1
prev = city
print("YES" if stf > fts else "NO")
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Rick and his co-workers have made a new radioactive formula and a lot of bad guys are after them. So Rick wants to give his legacy to Morty before bad guys catch them.
There are *n* planets in their universe numbered from 1 to *n*. Rick is in planet number *s* (the earth) and he doesn't know where Morty is. As we all know, Rick owns a portal gun. With this gun he can open one-way portal from a planet he is in to any other planet (including that planet). But there are limits on this gun because he's still using its free trial.
By default he can not open any portal by this gun. There are *q* plans in the website that sells these guns. Every time you purchase a plan you can only use it once but you can purchase it again if you want to use it more.
Plans on the website have three types:
1. With a plan of this type you can open a portal from planet *v* to planet *u*. 1. With a plan of this type you can open a portal from planet *v* to any planet with index in range [*l*,<=*r*]. 1. With a plan of this type you can open a portal from any planet with index in range [*l*,<=*r*] to planet *v*.
Rick doesn't known where Morty is, but Unity is going to inform him and he wants to be prepared for when he finds and start his journey immediately. So for each planet (including earth itself) he wants to know the minimum amount of money he needs to get from earth to that planet. | The first line of input contains three integers *n*, *q* and *s* (1<=≤<=*n*,<=*q*<=≤<=105, 1<=≤<=*s*<=≤<=*n*) — number of planets, number of plans and index of earth respectively.
The next *q* lines contain the plans. Each line starts with a number *t*, type of that plan (1<=≤<=*t*<=≤<=3). If *t*<==<=1 then it is followed by three integers *v*, *u* and *w* where *w* is the cost of that plan (1<=≤<=*v*,<=*u*<=≤<=*n*, 1<=≤<=*w*<=≤<=109). Otherwise it is followed by four integers *v*, *l*, *r* and *w* where *w* is the cost of that plan (1<=≤<=*v*<=≤<=*n*, 1<=≤<=*l*<=≤<=*r*<=≤<=*n*, 1<=≤<=*w*<=≤<=109). | In the first and only line of output print *n* integers separated by spaces. *i*-th of them should be minimum money to get from earth to *i*-th planet, or <=-<=1 if it's impossible to get to that planet. | [
"3 5 1\n2 3 2 3 17\n2 3 2 2 16\n2 2 2 3 3\n3 3 1 1 12\n1 3 3 17\n",
"4 3 1\n3 4 1 3 12\n2 2 3 4 10\n1 2 4 16\n"
] | [
"0 28 12 \n",
"0 -1 -1 12 \n"
] | In the first sample testcase, Rick can purchase 4th plan once and then 2nd plan in order to get to get to planet number 2. | 0 | [] | 1,691,073,719 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 46 | 0 | print("_RANDOM_GUESS_1691073718.949566")# 1691073718.9495845 | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Rick and his co-workers have made a new radioactive formula and a lot of bad guys are after them. So Rick wants to give his legacy to Morty before bad guys catch them.
There are *n* planets in their universe numbered from 1 to *n*. Rick is in planet number *s* (the earth) and he doesn't know where Morty is. As we all know, Rick owns a portal gun. With this gun he can open one-way portal from a planet he is in to any other planet (including that planet). But there are limits on this gun because he's still using its free trial.
By default he can not open any portal by this gun. There are *q* plans in the website that sells these guns. Every time you purchase a plan you can only use it once but you can purchase it again if you want to use it more.
Plans on the website have three types:
1. With a plan of this type you can open a portal from planet *v* to planet *u*. 1. With a plan of this type you can open a portal from planet *v* to any planet with index in range [*l*,<=*r*]. 1. With a plan of this type you can open a portal from any planet with index in range [*l*,<=*r*] to planet *v*.
Rick doesn't known where Morty is, but Unity is going to inform him and he wants to be prepared for when he finds and start his journey immediately. So for each planet (including earth itself) he wants to know the minimum amount of money he needs to get from earth to that planet.
Input Specification:
The first line of input contains three integers *n*, *q* and *s* (1<=≤<=*n*,<=*q*<=≤<=105, 1<=≤<=*s*<=≤<=*n*) — number of planets, number of plans and index of earth respectively.
The next *q* lines contain the plans. Each line starts with a number *t*, type of that plan (1<=≤<=*t*<=≤<=3). If *t*<==<=1 then it is followed by three integers *v*, *u* and *w* where *w* is the cost of that plan (1<=≤<=*v*,<=*u*<=≤<=*n*, 1<=≤<=*w*<=≤<=109). Otherwise it is followed by four integers *v*, *l*, *r* and *w* where *w* is the cost of that plan (1<=≤<=*v*<=≤<=*n*, 1<=≤<=*l*<=≤<=*r*<=≤<=*n*, 1<=≤<=*w*<=≤<=109).
Output Specification:
In the first and only line of output print *n* integers separated by spaces. *i*-th of them should be minimum money to get from earth to *i*-th planet, or <=-<=1 if it's impossible to get to that planet.
Demo Input:
['3 5 1\n2 3 2 3 17\n2 3 2 2 16\n2 2 2 3 3\n3 3 1 1 12\n1 3 3 17\n', '4 3 1\n3 4 1 3 12\n2 2 3 4 10\n1 2 4 16\n']
Demo Output:
['0 28 12 \n', '0 -1 -1 12 \n']
Note:
In the first sample testcase, Rick can purchase 4th plan once and then 2nd plan in order to get to get to planet number 2. | ```python
print("_RANDOM_GUESS_1691073718.949566")# 1691073718.9495845
``` | 0 |
|
894 | A | QAQ | PROGRAMMING | 800 | [
"brute force",
"dp"
] | null | null | "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. | The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. | Print a single integer — the number of subsequences "QAQ" in the string. | [
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] | [
"4\n",
"3\n"
] | In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | 500 | [
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,601,596,734 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 77 | 0 | def main():
q1 = a = q2 = 0
for s in input():
if s == 'Q':
q1 += 1
q2 += a
else:
a += q1
return q2
for m in range(1, 2 + 1):
o = str(main())
e = input()
if o != e:
print(f'Test {m} failed.\nOut: {o}\nExp: {e}\n')
else:
print(f'Test {m} passed!\n')
| Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | ```python
def main():
q1 = a = q2 = 0
for s in input():
if s == 'Q':
q1 += 1
q2 += a
else:
a += q1
return q2
for m in range(1, 2 + 1):
o = str(main())
e = input()
if o != e:
print(f'Test {m} failed.\nOut: {o}\nExp: {e}\n')
else:
print(f'Test {m} passed!\n')
``` | -1 |
|
975 | B | Mancala | PROGRAMMING | 1,100 | [
"brute force",
"implementation"
] | null | null | Mancala is a game famous in the Middle East. It is played on a board that consists of 14 holes.
Initially, each hole has $a_i$ stones. When a player makes a move, he chooses a hole which contains a positive number of stones. He takes all the stones inside it and then redistributes these stones one by one in the next holes in a counter-clockwise direction.
Note that the counter-clockwise order means if the player takes the stones from hole $i$, he will put one stone in the $(i+1)$-th hole, then in the $(i+2)$-th, etc. If he puts a stone in the $14$-th hole, the next one will be put in the first hole.
After the move, the player collects all the stones from holes that contain even number of stones. The number of stones collected by player is the score, according to Resli.
Resli is a famous Mancala player. He wants to know the maximum score he can obtain after one move. | The only line contains 14 integers $a_1, a_2, \ldots, a_{14}$ ($0 \leq a_i \leq 10^9$) — the number of stones in each hole.
It is guaranteed that for any $i$ ($1\leq i \leq 14$) $a_i$ is either zero or odd, and there is at least one stone in the board. | Output one integer, the maximum possible score after one move. | [
"0 1 1 0 0 0 0 0 0 7 0 0 0 0\n",
"5 1 1 1 1 0 0 0 0 0 0 0 0 0\n"
] | [
"4\n",
"8\n"
] | In the first test case the board after the move from the hole with $7$ stones will look like 1 2 2 0 0 0 0 0 0 0 1 1 1 1. Then the player collects the even numbers and ends up with a score equal to $4$. | 1,000 | [
{
"input": "0 1 1 0 0 0 0 0 0 7 0 0 0 0",
"output": "4"
},
{
"input": "5 1 1 1 1 0 0 0 0 0 0 0 0 0",
"output": "8"
},
{
"input": "10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 10001 1",
"output": "54294"
},
{
"input": "0 0 0 0 0 0 0 0 0 0 0 0 0 15",
"output": "2"
},
{
"input": "1 0 0 0 0 1 0 0 0 0 1 0 0 0",
"output": "0"
},
{
"input": "5 5 1 1 1 3 3 3 5 7 5 3 7 5",
"output": "38"
},
{
"input": "787 393 649 463 803 365 81 961 989 531 303 407 579 915",
"output": "7588"
},
{
"input": "8789651 4466447 1218733 6728667 1796977 6198853 8263135 6309291 8242907 7136751 3071237 5397369 6780785 9420869",
"output": "81063456"
},
{
"input": "0 0 0 0 0 0 0 0 0 0 0 0 0 29",
"output": "26"
},
{
"input": "282019717 109496191 150951267 609856495 953855615 569750143 6317733 255875779 645191029 572053369 290936613 338480779 879775193 177172893",
"output": "5841732816"
},
{
"input": "105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505 105413505",
"output": "120472578"
},
{
"input": "404418821 993626161 346204297 122439813 461187221 628048227 625919459 628611733 938993057 701270099 398043779 684205961 630975553 575964835",
"output": "8139909016"
},
{
"input": "170651077 730658441 824213789 583764177 129437345 717005779 675398017 314979709 380861369 265878463 746564659 797260041 506575735 335169317",
"output": "6770880638"
},
{
"input": "622585025 48249287 678950449 891575125 637411965 457739735 829353393 235216425 284006447 875591469 492839209 296444305 513776057 810057753",
"output": "7673796644"
},
{
"input": "475989857 930834747 786217439 927967137 489188151 869354161 276693267 56154399 131055697 509249443 143116853 426254423 44465165 105798821",
"output": "6172339560"
},
{
"input": "360122921 409370351 226220005 604004145 85173909 600403773 624052991 138163383 729239967 189036661 619842883 270087537 749500483 243727913",
"output": "5848946922"
},
{
"input": "997102881 755715147 273805839 436713689 547411799 72470207 522269145 647688957 137422311 422612659 197751751 679663349 821420227 387967237",
"output": "6900015198"
},
{
"input": "690518849 754551537 652949719 760695679 491633619 477564457 11669279 700467439 470069297 782338983 718169393 884421719 24619427 215745577",
"output": "7635414974"
},
{
"input": "248332749 486342237 662201929 917696895 555278549 252122023 850296207 463343655 832574345 954281071 168282553 825538865 996753493 461254663",
"output": "6400166934"
},
{
"input": "590789361 636464947 404477303 337309187 476703809 426863069 120608741 703406277 645444697 761482231 996635839 33459441 677458865 483861751",
"output": "7294965518"
},
{
"input": "297857621 238127103 749085829 139033277 597985489 202617713 982184715 183932743 278551059 297781685 330124279 338959601 682874531 187519685",
"output": "5201808164"
},
{
"input": "1 1 1 1 1 0 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "1 1 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "1 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "2"
},
{
"input": "0 0 0 0 0 0 0 0 0 0 0 0 1 1",
"output": "2"
}
] | 1,534,360,532 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 93 | 0 | n=list(map(int,input().split()))
top=[]
for item in n:
top.append(item)
f=[]
y=0
t=y
taa=[]
for x in range(14):
if n[y]!=0:
if n[y]>13:
ol=n[y]//13
for z in range(14):
if t!=13:
t+=1
n[t]+=ol
else:
t=0
n[t]+=ol
n[y]-=13*ol
t=y
for x in range(n[y]):
if t!=13:
t+=1
n[t]+=1
else:
t=0
n[t]+=1
for item in n:
if item%2==0:
f.append(item)
pass
else:
pass
taa.append(sum(f))
f=[]
y+=1
t=y
n=[]
for item in top:
n.append(item)
else:
for l in range(n[y]):
if t!=13:
t+=1
n[t]+=1
else:
t=0
n[t]+=1
for item in n:
if item%2==0:
f.append(item)
else:
pass
taa.append(sum(f))
y+=1
f=[]
t=y
n=[]
for item in top:
n.append(item)
else:
y+=1
t=y
f=[]
n=[]
for item in top:
n.append(item)
pass
print(max(taa))
| Title: Mancala
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mancala is a game famous in the Middle East. It is played on a board that consists of 14 holes.
Initially, each hole has $a_i$ stones. When a player makes a move, he chooses a hole which contains a positive number of stones. He takes all the stones inside it and then redistributes these stones one by one in the next holes in a counter-clockwise direction.
Note that the counter-clockwise order means if the player takes the stones from hole $i$, he will put one stone in the $(i+1)$-th hole, then in the $(i+2)$-th, etc. If he puts a stone in the $14$-th hole, the next one will be put in the first hole.
After the move, the player collects all the stones from holes that contain even number of stones. The number of stones collected by player is the score, according to Resli.
Resli is a famous Mancala player. He wants to know the maximum score he can obtain after one move.
Input Specification:
The only line contains 14 integers $a_1, a_2, \ldots, a_{14}$ ($0 \leq a_i \leq 10^9$) — the number of stones in each hole.
It is guaranteed that for any $i$ ($1\leq i \leq 14$) $a_i$ is either zero or odd, and there is at least one stone in the board.
Output Specification:
Output one integer, the maximum possible score after one move.
Demo Input:
['0 1 1 0 0 0 0 0 0 7 0 0 0 0\n', '5 1 1 1 1 0 0 0 0 0 0 0 0 0\n']
Demo Output:
['4\n', '8\n']
Note:
In the first test case the board after the move from the hole with $7$ stones will look like 1 2 2 0 0 0 0 0 0 0 1 1 1 1. Then the player collects the even numbers and ends up with a score equal to $4$. | ```python
n=list(map(int,input().split()))
top=[]
for item in n:
top.append(item)
f=[]
y=0
t=y
taa=[]
for x in range(14):
if n[y]!=0:
if n[y]>13:
ol=n[y]//13
for z in range(14):
if t!=13:
t+=1
n[t]+=ol
else:
t=0
n[t]+=ol
n[y]-=13*ol
t=y
for x in range(n[y]):
if t!=13:
t+=1
n[t]+=1
else:
t=0
n[t]+=1
for item in n:
if item%2==0:
f.append(item)
pass
else:
pass
taa.append(sum(f))
f=[]
y+=1
t=y
n=[]
for item in top:
n.append(item)
else:
for l in range(n[y]):
if t!=13:
t+=1
n[t]+=1
else:
t=0
n[t]+=1
for item in n:
if item%2==0:
f.append(item)
else:
pass
taa.append(sum(f))
y+=1
f=[]
t=y
n=[]
for item in top:
n.append(item)
else:
y+=1
t=y
f=[]
n=[]
for item in top:
n.append(item)
pass
print(max(taa))
``` | 0 |
|
237 | A | Free Cash | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period. | Print a single integer — the minimum number of cashes, needed to serve all clients next day. | [
"4\n8 0\n8 10\n8 10\n8 45\n",
"3\n0 12\n10 11\n22 22\n"
] | [
"2\n",
"1\n"
] | In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash. | 500 | [
{
"input": "4\n8 0\n8 10\n8 10\n8 45",
"output": "2"
},
{
"input": "3\n0 12\n10 11\n22 22",
"output": "1"
},
{
"input": "5\n12 8\n15 27\n15 27\n16 2\n19 52",
"output": "2"
},
{
"input": "7\n5 6\n7 34\n7 34\n7 34\n12 29\n15 19\n20 23",
"output": "3"
},
{
"input": "8\n0 36\n4 7\n4 7\n4 7\n11 46\n12 4\n15 39\n18 6",
"output": "3"
},
{
"input": "20\n4 12\n4 21\n4 27\n4 56\n5 55\n7 56\n11 28\n11 36\n14 58\n15 59\n16 8\n17 12\n17 23\n17 23\n17 23\n17 23\n17 23\n17 23\n20 50\n22 32",
"output": "6"
},
{
"input": "10\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30",
"output": "10"
},
{
"input": "50\n0 23\n1 21\n2 8\n2 45\n3 1\n4 19\n4 37\n7 7\n7 40\n8 43\n9 51\n10 13\n11 2\n11 19\n11 30\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 54\n13 32\n13 42\n14 29\n14 34\n14 48\n15 0\n15 27\n16 22\n16 31\n17 25\n17 26\n17 33\n18 14\n18 16\n18 20\n19 0\n19 5\n19 56\n20 22\n21 26\n22 0\n22 10\n22 11\n22 36\n23 17\n23 20",
"output": "8"
},
{
"input": "10\n0 39\n1 35\n1 49\n1 51\n5 24\n7 40\n7 56\n16 42\n23 33\n23 49",
"output": "1"
},
{
"input": "15\n0 16\n6 15\n8 2\n8 6\n8 7\n10 1\n10 1\n10 3\n10 12\n13 5\n14 16\n14 16\n14 16\n14 16\n14 16",
"output": "5"
},
{
"input": "2\n0 24\n1 0",
"output": "1"
},
{
"input": "1\n0 0",
"output": "1"
},
{
"input": "1\n1 5",
"output": "1"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "3"
},
{
"input": "1\n5 0",
"output": "1"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "5"
},
{
"input": "1\n10 10",
"output": "1"
},
{
"input": "1\n8 0",
"output": "1"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "10"
},
{
"input": "2\n0 0\n0 1",
"output": "1"
},
{
"input": "2\n8 5\n8 5",
"output": "2"
}
] | 1,661,421,757 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 6 | 92 | 0 | n = int(input())
k = 1
people = set()
for i in range(n):
man = tuple(map(int, input().split()))
if man in people:
k += 1
people.add(man)
print(k)
| Title: Free Cash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
Output Specification:
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
Demo Input:
['4\n8 0\n8 10\n8 10\n8 45\n', '3\n0 12\n10 11\n22 22\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash. | ```python
n = int(input())
k = 1
people = set()
for i in range(n):
man = tuple(map(int, input().split()))
if man in people:
k += 1
people.add(man)
print(k)
``` | 0 |
|
9 | A | Die Roll | PROGRAMMING | 800 | [
"math",
"probabilities"
] | A. Die Roll | 1 | 64 | Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. | The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. | Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». | [
"4 2\n"
] | [
"1/2\n"
] | Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | 0 | [
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,596,949,055 | 2,147,483,647 | Python 3 | OK | TESTS | 36 | 342 | 7,987,200 | rolls = list(map(int, input().split()))
highest = max(rolls)
fraction = [0, 6]
fraction[0] = 6 - highest + 1
from fractions import Fraction
result = str(Fraction(fraction[0], fraction[1]))
if result == '1':
print("1/1")
else:
print(result)
| Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | ```python
rolls = list(map(int, input().split()))
highest = max(rolls)
fraction = [0, 6]
fraction[0] = 6 - highest + 1
from fractions import Fraction
result = str(Fraction(fraction[0], fraction[1]))
if result == '1':
print("1/1")
else:
print(result)
``` | 3.769491 |
272 | C | Dima and Staircase | PROGRAMMING | 1,500 | [
"data structures",
"implementation"
] | null | null | Dima's got a staircase that consists of *n* stairs. The first stair is at height *a*1, the second one is at *a*2, the last one is at *a**n* (1<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n*).
Dima decided to play with the staircase, so he is throwing rectangular boxes at the staircase from above. The *i*-th box has width *w**i* and height *h**i*. Dima throws each box vertically down on the first *w**i* stairs of the staircase, that is, the box covers stairs with numbers 1,<=2,<=...,<=*w**i*. Each thrown box flies vertically down until at least one of the two following events happen:
- the bottom of the box touches the top of a stair; - the bottom of the box touches the top of a box, thrown earlier.
We only consider touching of the horizontal sides of stairs and boxes, at that touching with the corners isn't taken into consideration. Specifically, that implies that a box with width *w**i* cannot touch the stair number *w**i*<=+<=1.
You are given the description of the staircase and the sequence in which Dima threw the boxes at it. For each box, determine how high the bottom of the box after landing will be. Consider a box to fall after the previous one lands. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of stairs in the staircase. The second line contains a non-decreasing sequence, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109; *a**i*<=≤<=*a**i*<=+<=1).
The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of boxes. Each of the following *m* lines contains a pair of integers *w**i*,<=*h**i* (1<=≤<=*w**i*<=≤<=*n*; 1<=≤<=*h**i*<=≤<=109) — the size of the *i*-th thrown box.
The numbers in the lines are separated by spaces. | Print *m* integers — for each box the height, where the bottom of the box will be after landing. Print the answers for the boxes in the order, in which the boxes are given in the input.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"5\n1 2 3 6 6\n4\n1 1\n3 1\n1 1\n4 3\n",
"3\n1 2 3\n2\n1 1\n3 1\n",
"1\n1\n5\n1 2\n1 10\n1 10\n1 10\n1 10\n"
] | [
"1\n3\n4\n6\n",
"1\n3\n",
"1\n3\n13\n23\n33\n"
] | The first sample are shown on the picture. | 1,500 | [
{
"input": "5\n1 2 3 6 6\n4\n1 1\n3 1\n1 1\n4 3",
"output": "1\n3\n4\n6"
},
{
"input": "3\n1 2 3\n2\n1 1\n3 1",
"output": "1\n3"
},
{
"input": "1\n1\n5\n1 2\n1 10\n1 10\n1 10\n1 10",
"output": "1\n3\n13\n23\n33"
},
{
"input": "8\n6 10 18 23 30 31 31 33\n1\n5 3",
"output": "30"
},
{
"input": "7\n8 13 19 21 25 30 32\n3\n5 4\n6 5\n1 2",
"output": "25\n30\n35"
},
{
"input": "5\n4 7 10 12 12\n9\n3 9\n2 1\n3 5\n4 7\n1 1\n5 1\n1 7\n2 4\n4 10",
"output": "10\n19\n20\n25\n32\n33\n34\n41\n45"
},
{
"input": "3\n1 6 8\n5\n3 4\n3 9\n3 3\n1 2\n1 6",
"output": "8\n12\n21\n24\n26"
},
{
"input": "3\n2 10 15\n1\n1 830",
"output": "2"
},
{
"input": "2\n1 6\n5\n2 6\n1 2\n1 1\n1 2\n1 7",
"output": "6\n12\n14\n15\n17"
},
{
"input": "1\n9\n8\n1 4\n1 10\n1 9\n1 9\n1 7\n1 1\n1 9\n1 2",
"output": "9\n13\n23\n32\n41\n48\n49\n58"
},
{
"input": "1\n8\n1\n1 42",
"output": "8"
},
{
"input": "1\n1\n1\n1 1",
"output": "1"
},
{
"input": "5\n1 2 3 6 6\n25\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000",
"output": "1\n1000000001\n2000000001\n3000000001\n4000000001\n5000000001\n6000000001\n7000000001\n8000000001\n9000000001\n10000000001\n11000000001\n12000000001\n13000000001\n14000000001\n15000000001\n16000000001\n17000000001\n18000000001\n19000000001\n20000000001\n21000000001\n22000000001\n23000000001\n24000000001"
},
{
"input": "1\n1000000000\n6\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000\n1 1000000000",
"output": "1000000000\n2000000000\n3000000000\n4000000000\n5000000000\n6000000000"
}
] | 1,509,390,277 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 12 | 2,000 | 8,089,600 | cin = lambda : map(int, input().split())
n = int(input())
a = list(cin())
m = int(input())
mx = 0
for i in range(m):
w, h = cin()
mx = max(a[0], a[w - 1])
print(mx)
a[0] = mx + h | Title: Dima and Staircase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima's got a staircase that consists of *n* stairs. The first stair is at height *a*1, the second one is at *a*2, the last one is at *a**n* (1<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n*).
Dima decided to play with the staircase, so he is throwing rectangular boxes at the staircase from above. The *i*-th box has width *w**i* and height *h**i*. Dima throws each box vertically down on the first *w**i* stairs of the staircase, that is, the box covers stairs with numbers 1,<=2,<=...,<=*w**i*. Each thrown box flies vertically down until at least one of the two following events happen:
- the bottom of the box touches the top of a stair; - the bottom of the box touches the top of a box, thrown earlier.
We only consider touching of the horizontal sides of stairs and boxes, at that touching with the corners isn't taken into consideration. Specifically, that implies that a box with width *w**i* cannot touch the stair number *w**i*<=+<=1.
You are given the description of the staircase and the sequence in which Dima threw the boxes at it. For each box, determine how high the bottom of the box after landing will be. Consider a box to fall after the previous one lands.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of stairs in the staircase. The second line contains a non-decreasing sequence, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109; *a**i*<=≤<=*a**i*<=+<=1).
The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of boxes. Each of the following *m* lines contains a pair of integers *w**i*,<=*h**i* (1<=≤<=*w**i*<=≤<=*n*; 1<=≤<=*h**i*<=≤<=109) — the size of the *i*-th thrown box.
The numbers in the lines are separated by spaces.
Output Specification:
Print *m* integers — for each box the height, where the bottom of the box will be after landing. Print the answers for the boxes in the order, in which the boxes are given in the input.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['5\n1 2 3 6 6\n4\n1 1\n3 1\n1 1\n4 3\n', '3\n1 2 3\n2\n1 1\n3 1\n', '1\n1\n5\n1 2\n1 10\n1 10\n1 10\n1 10\n']
Demo Output:
['1\n3\n4\n6\n', '1\n3\n', '1\n3\n13\n23\n33\n']
Note:
The first sample are shown on the picture. | ```python
cin = lambda : map(int, input().split())
n = int(input())
a = list(cin())
m = int(input())
mx = 0
for i in range(m):
w, h = cin()
mx = max(a[0], a[w - 1])
print(mx)
a[0] = mx + h
``` | 0 |
|
288 | A | Polo the Penguin and Strings | PROGRAMMING | 1,300 | [
"greedy"
] | null | null | Little penguin Polo adores strings. But most of all he adores strings of length *n*.
One day he wanted to find a string that meets the following conditions:
1. The string consists of *n* lowercase English letters (that is, the string's length equals *n*), exactly *k* of these letters are distinct. 1. No two neighbouring letters of a string coincide; that is, if we represent a string as *s*<==<=*s*1*s*2... *s**n*, then the following inequality holds, *s**i*<=≠<=*s**i*<=+<=1(1<=≤<=*i*<=<<=*n*). 1. Among all strings that meet points 1 and 2, the required string is lexicographically smallest.
Help him find such string or state that such string doesn't exist.
String *x*<==<=*x*1*x*2... *x**p* is lexicographically less than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=<<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there is such number *r* (*r*<=<<=*p*,<=*r*<=<<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=<<=*y**r*<=+<=1. The characters of the strings are compared by their ASCII codes. | A single line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=106,<=1<=≤<=*k*<=≤<=26) — the string's length and the number of distinct letters. | In a single line print the required string. If there isn't such string, print "-1" (without the quotes). | [
"7 4\n",
"4 7\n"
] | [
"ababacd\n",
"-1\n"
] | none | 500 | [
{
"input": "7 4",
"output": "ababacd"
},
{
"input": "4 7",
"output": "-1"
},
{
"input": "10 5",
"output": "abababacde"
},
{
"input": "47 2",
"output": "abababababababababababababababababababababababa"
},
{
"input": "10 7",
"output": "ababacdefg"
},
{
"input": "20 7",
"output": "abababababababacdefg"
},
{
"input": "26 26",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "47 1",
"output": "-1"
},
{
"input": "128 26",
"output": "ababababababababababababababababababababababababababababababababababababababababababababababababababababcdefghijklmnopqrstuvwxyz"
},
{
"input": "999 7",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "4585 1",
"output": "-1"
},
{
"input": "6875 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "7642 3",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "100000 7",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "68754 25",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "1000000 1",
"output": "-1"
},
{
"input": "999999 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "1000000 26",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "100000 20",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "579466 17",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "679854 9",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "978458 16",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "6791 21",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababababa..."
},
{
"input": "6795 1",
"output": "-1"
},
{
"input": "12 17",
"output": "-1"
},
{
"input": "1 1",
"output": "a"
},
{
"input": "2 2",
"output": "ab"
},
{
"input": "1 2",
"output": "-1"
},
{
"input": "1 26",
"output": "-1"
},
{
"input": "26 2",
"output": "ababababababababababababab"
},
{
"input": "123 21",
"output": "ababababababababababababababababababababababababababababababababababababababababababababababababababababcdefghijklmnopqrstu"
},
{
"input": "3 3",
"output": "abc"
}
] | 1,645,107,285 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 25 | 1,808 | 307,200 | # Author: Riddhish V. Lichade
# username: root_rvl
from collections import Counter
from sys import stdin, stdout
from heapq import nlargest, nsmallest
def outnl(x): stdout.write(str(x) + '\n')
def outsl(x): stdout.write(str(x) + '')
def instr(): return stdin.readline().strip()
def inint(): return int(stdin.readline())
def inspsint(): return map(int, stdin.readline().strip().split())
def inlist(): return list(map(int, stdin.readline().strip().split()))
for _ in range(1):
n,x=inspsint()
if x>n or (x==1 and n>1):
outnl(-1)
continue
if(x==2):
for i in range(n):
if i%2==0:
outsl('a')
else:
outsl('b')
print()
continue
l=n-x+2
for i in range(l):
if i%2==0:
outsl('a')
else:
outsl('b')
c=99
for i in range(n-l):
outsl(chr(c))
c+=1
print()
| Title: Polo the Penguin and Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little penguin Polo adores strings. But most of all he adores strings of length *n*.
One day he wanted to find a string that meets the following conditions:
1. The string consists of *n* lowercase English letters (that is, the string's length equals *n*), exactly *k* of these letters are distinct. 1. No two neighbouring letters of a string coincide; that is, if we represent a string as *s*<==<=*s*1*s*2... *s**n*, then the following inequality holds, *s**i*<=≠<=*s**i*<=+<=1(1<=≤<=*i*<=<<=*n*). 1. Among all strings that meet points 1 and 2, the required string is lexicographically smallest.
Help him find such string or state that such string doesn't exist.
String *x*<==<=*x*1*x*2... *x**p* is lexicographically less than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=<<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there is such number *r* (*r*<=<<=*p*,<=*r*<=<<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=<<=*y**r*<=+<=1. The characters of the strings are compared by their ASCII codes.
Input Specification:
A single line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=106,<=1<=≤<=*k*<=≤<=26) — the string's length and the number of distinct letters.
Output Specification:
In a single line print the required string. If there isn't such string, print "-1" (without the quotes).
Demo Input:
['7 4\n', '4 7\n']
Demo Output:
['ababacd\n', '-1\n']
Note:
none | ```python
# Author: Riddhish V. Lichade
# username: root_rvl
from collections import Counter
from sys import stdin, stdout
from heapq import nlargest, nsmallest
def outnl(x): stdout.write(str(x) + '\n')
def outsl(x): stdout.write(str(x) + '')
def instr(): return stdin.readline().strip()
def inint(): return int(stdin.readline())
def inspsint(): return map(int, stdin.readline().strip().split())
def inlist(): return list(map(int, stdin.readline().strip().split()))
for _ in range(1):
n,x=inspsint()
if x>n or (x==1 and n>1):
outnl(-1)
continue
if(x==2):
for i in range(n):
if i%2==0:
outsl('a')
else:
outsl('b')
print()
continue
l=n-x+2
for i in range(l):
if i%2==0:
outsl('a')
else:
outsl('b')
c=99
for i in range(n-l):
outsl(chr(c))
c+=1
print()
``` | 0 |
|
651 | B | Beautiful Paintings | PROGRAMMING | 1,200 | [
"greedy",
"sortings"
] | null | null | There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one.
We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≤<=*i*<=≤<=*n*<=-<=1), such that *a**i*<=+<=1<=><=*a**i*. | The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of painting.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where *a**i* means the beauty of the *i*-th painting. | Print one integer — the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=><=*a**i*, after the optimal rearrangement. | [
"5\n20 30 10 50 40\n",
"4\n200 100 100 200\n"
] | [
"4\n",
"2\n"
] | In the first sample, the optimal order is: 10, 20, 30, 40, 50.
In the second sample, the optimal order is: 100, 200, 100, 200. | 1,000 | [
{
"input": "5\n20 30 10 50 40",
"output": "4"
},
{
"input": "4\n200 100 100 200",
"output": "2"
},
{
"input": "10\n2 2 2 2 2 2 2 2 2 2",
"output": "0"
},
{
"input": "1\n1000",
"output": "0"
},
{
"input": "2\n444 333",
"output": "1"
},
{
"input": "100\n9 9 72 55 14 8 55 58 35 67 3 18 73 92 41 49 15 60 18 66 9 26 97 47 43 88 71 97 19 34 48 96 79 53 8 24 69 49 12 23 77 12 21 88 66 9 29 13 61 69 54 77 41 13 4 68 37 74 7 6 29 76 55 72 89 4 78 27 29 82 18 83 12 4 32 69 89 85 66 13 92 54 38 5 26 56 17 55 29 4 17 39 29 94 3 67 85 98 21 14",
"output": "95"
},
{
"input": "1\n995",
"output": "0"
},
{
"input": "10\n103 101 103 103 101 102 100 100 101 104",
"output": "7"
},
{
"input": "20\n102 100 102 104 102 101 104 103 100 103 105 105 100 105 100 100 101 105 105 102",
"output": "15"
},
{
"input": "20\n990 994 996 999 997 994 990 992 990 993 992 990 999 999 992 994 997 990 993 998",
"output": "15"
},
{
"input": "100\n1 8 3 8 10 8 5 3 10 3 5 8 4 5 5 5 10 3 6 6 6 6 6 7 2 7 2 4 7 8 3 8 7 2 5 6 1 5 5 7 9 7 6 9 1 8 1 3 6 5 1 3 6 9 5 6 8 4 8 6 10 9 2 9 3 8 7 5 2 10 2 10 3 6 5 5 3 5 10 2 3 7 10 8 8 4 3 4 9 6 10 7 6 6 6 4 9 9 8 9",
"output": "84"
}
] | 1,589,985,700 | 2,147,483,647 | Python 3 | OK | TESTS | 31 | 124 | 307,200 | def most_frequent(List):
return max(set(List), key = List.count)
n=int(input())
l=list(map(int,input().split()))
m=set(l)
h=[0]*len(m)
print((n-1)-(l.count(most_frequent(l))-1))
| Title: Beautiful Paintings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* pictures delivered for the new exhibition. The *i*-th painting has beauty *a**i*. We know that a visitor becomes happy every time he passes from a painting to a more beautiful one.
We are allowed to arranged pictures in any order. What is the maximum possible number of times the visitor may become happy while passing all pictures from first to last? In other words, we are allowed to rearrange elements of *a* in any order. What is the maximum possible number of indices *i* (1<=≤<=*i*<=≤<=*n*<=-<=1), such that *a**i*<=+<=1<=><=*a**i*.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of painting.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where *a**i* means the beauty of the *i*-th painting.
Output Specification:
Print one integer — the maximum possible number of neighbouring pairs, such that *a**i*<=+<=1<=><=*a**i*, after the optimal rearrangement.
Demo Input:
['5\n20 30 10 50 40\n', '4\n200 100 100 200\n']
Demo Output:
['4\n', '2\n']
Note:
In the first sample, the optimal order is: 10, 20, 30, 40, 50.
In the second sample, the optimal order is: 100, 200, 100, 200. | ```python
def most_frequent(List):
return max(set(List), key = List.count)
n=int(input())
l=list(map(int,input().split()))
m=set(l)
h=[0]*len(m)
print((n-1)-(l.count(most_frequent(l))-1))
``` | 3 |
|
916 | A | Jamie and Alarm Snooze | PROGRAMMING | 900 | [
"brute force",
"implementation",
"math"
] | null | null | Jamie loves sleeping. One day, he decides that he needs to wake up at exactly *hh*:<=*mm*. However, he hates waking up, so he wants to make waking up less painful by setting the alarm at a lucky time. He will then press the snooze button every *x* minutes until *hh*:<=*mm* is reached, and only then he will wake up. He wants to know what is the smallest number of times he needs to press the snooze button.
A time is considered lucky if it contains a digit '7'. For example, 13:<=07 and 17:<=27 are lucky, while 00:<=48 and 21:<=34 are not lucky.
Note that it is not necessary that the time set for the alarm and the wake-up time are on the same day. It is guaranteed that there is a lucky time Jamie can set so that he can wake at *hh*:<=*mm*.
Formally, find the smallest possible non-negative integer *y* such that the time representation of the time *x*·*y* minutes before *hh*:<=*mm* contains the digit '7'.
Jamie uses 24-hours clock, so after 23:<=59 comes 00:<=00. | The first line contains a single integer *x* (1<=≤<=*x*<=≤<=60).
The second line contains two two-digit integers, *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59). | Print the minimum number of times he needs to press the button. | [
"3\n11 23\n",
"5\n01 07\n"
] | [
"2\n",
"0\n"
] | In the first sample, Jamie needs to wake up at 11:23. So, he can set his alarm at 11:17. He would press the snooze button when the alarm rings at 11:17 and at 11:20.
In the second sample, Jamie can set his alarm at exactly at 01:07 which is lucky. | 500 | [
{
"input": "3\n11 23",
"output": "2"
},
{
"input": "5\n01 07",
"output": "0"
},
{
"input": "34\n09 24",
"output": "3"
},
{
"input": "2\n14 37",
"output": "0"
},
{
"input": "14\n19 54",
"output": "9"
},
{
"input": "42\n15 44",
"output": "12"
},
{
"input": "46\n02 43",
"output": "1"
},
{
"input": "14\n06 41",
"output": "1"
},
{
"input": "26\n04 58",
"output": "26"
},
{
"input": "54\n16 47",
"output": "0"
},
{
"input": "38\n20 01",
"output": "3"
},
{
"input": "11\n02 05",
"output": "8"
},
{
"input": "55\n22 10",
"output": "5"
},
{
"input": "23\n10 08",
"output": "6"
},
{
"input": "23\n23 14",
"output": "9"
},
{
"input": "51\n03 27",
"output": "0"
},
{
"input": "35\n15 25",
"output": "13"
},
{
"input": "3\n12 15",
"output": "6"
},
{
"input": "47\n00 28",
"output": "3"
},
{
"input": "31\n13 34",
"output": "7"
},
{
"input": "59\n17 32",
"output": "0"
},
{
"input": "25\n11 03",
"output": "8"
},
{
"input": "9\n16 53",
"output": "4"
},
{
"input": "53\n04 06",
"output": "3"
},
{
"input": "37\n00 12",
"output": "5"
},
{
"input": "5\n13 10",
"output": "63"
},
{
"input": "50\n01 59",
"output": "10"
},
{
"input": "34\n06 13",
"output": "4"
},
{
"input": "2\n18 19",
"output": "1"
},
{
"input": "46\n06 16",
"output": "17"
},
{
"input": "14\n03 30",
"output": "41"
},
{
"input": "40\n13 37",
"output": "0"
},
{
"input": "24\n17 51",
"output": "0"
},
{
"input": "8\n14 57",
"output": "0"
},
{
"input": "52\n18 54",
"output": "2"
},
{
"input": "20\n15 52",
"output": "24"
},
{
"input": "20\n03 58",
"output": "30"
},
{
"input": "48\n07 11",
"output": "0"
},
{
"input": "32\n04 01",
"output": "2"
},
{
"input": "60\n08 15",
"output": "1"
},
{
"input": "44\n20 20",
"output": "4"
},
{
"input": "55\n15 35",
"output": "9"
},
{
"input": "55\n03 49",
"output": "11"
},
{
"input": "23\n16 39",
"output": "4"
},
{
"input": "7\n20 36",
"output": "7"
},
{
"input": "35\n16 42",
"output": "1"
},
{
"input": "35\n05 56",
"output": "21"
},
{
"input": "3\n17 45",
"output": "0"
},
{
"input": "47\n05 59",
"output": "6"
},
{
"input": "15\n10 13",
"output": "9"
},
{
"input": "59\n06 18",
"output": "9"
},
{
"input": "34\n17 18",
"output": "0"
},
{
"input": "18\n05 23",
"output": "2"
},
{
"input": "46\n17 21",
"output": "0"
},
{
"input": "30\n06 27",
"output": "0"
},
{
"input": "14\n18 40",
"output": "3"
},
{
"input": "58\n22 54",
"output": "6"
},
{
"input": "26\n19 44",
"output": "5"
},
{
"input": "10\n15 57",
"output": "0"
},
{
"input": "54\n20 47",
"output": "0"
},
{
"input": "22\n08 45",
"output": "3"
},
{
"input": "48\n18 08",
"output": "1"
},
{
"input": "32\n07 06",
"output": "0"
},
{
"input": "60\n19 19",
"output": "2"
},
{
"input": "45\n07 25",
"output": "0"
},
{
"input": "29\n12 39",
"output": "8"
},
{
"input": "13\n08 28",
"output": "3"
},
{
"input": "41\n21 42",
"output": "5"
},
{
"input": "41\n09 32",
"output": "3"
},
{
"input": "9\n21 45",
"output": "2"
},
{
"input": "37\n10 43",
"output": "5"
},
{
"input": "3\n20 50",
"output": "1"
},
{
"input": "47\n00 04",
"output": "1"
},
{
"input": "15\n13 10",
"output": "21"
},
{
"input": "15\n17 23",
"output": "0"
},
{
"input": "43\n22 13",
"output": "2"
},
{
"input": "27\n10 26",
"output": "6"
},
{
"input": "55\n22 24",
"output": "5"
},
{
"input": "55\n03 30",
"output": "11"
},
{
"input": "24\n23 27",
"output": "0"
},
{
"input": "52\n11 33",
"output": "3"
},
{
"input": "18\n22 48",
"output": "17"
},
{
"input": "1\n12 55",
"output": "8"
},
{
"input": "1\n04 27",
"output": "0"
},
{
"input": "1\n12 52",
"output": "5"
},
{
"input": "1\n20 16",
"output": "9"
},
{
"input": "1\n04 41",
"output": "4"
},
{
"input": "1\n20 21",
"output": "4"
},
{
"input": "1\n04 45",
"output": "8"
},
{
"input": "1\n12 18",
"output": "1"
},
{
"input": "1\n04 42",
"output": "5"
},
{
"input": "1\n02 59",
"output": "2"
},
{
"input": "1\n18 24",
"output": "7"
},
{
"input": "1\n02 04",
"output": "7"
},
{
"input": "1\n18 28",
"output": "1"
},
{
"input": "1\n18 01",
"output": "2"
},
{
"input": "1\n10 25",
"output": "8"
},
{
"input": "1\n02 49",
"output": "2"
},
{
"input": "1\n02 30",
"output": "3"
},
{
"input": "1\n18 54",
"output": "7"
},
{
"input": "1\n02 19",
"output": "2"
},
{
"input": "1\n05 25",
"output": "8"
},
{
"input": "60\n23 55",
"output": "6"
},
{
"input": "60\n08 19",
"output": "1"
},
{
"input": "60\n00 00",
"output": "7"
},
{
"input": "60\n08 24",
"output": "1"
},
{
"input": "60\n16 13",
"output": "9"
},
{
"input": "60\n08 21",
"output": "1"
},
{
"input": "60\n16 45",
"output": "9"
},
{
"input": "60\n08 26",
"output": "1"
},
{
"input": "60\n08 50",
"output": "1"
},
{
"input": "60\n05 21",
"output": "12"
},
{
"input": "60\n13 29",
"output": "6"
},
{
"input": "60\n05 18",
"output": "12"
},
{
"input": "60\n13 42",
"output": "6"
},
{
"input": "60\n05 07",
"output": "0"
},
{
"input": "60\n05 47",
"output": "0"
},
{
"input": "60\n21 55",
"output": "4"
},
{
"input": "60\n05 36",
"output": "12"
},
{
"input": "60\n21 08",
"output": "4"
},
{
"input": "60\n21 32",
"output": "4"
},
{
"input": "60\n16 31",
"output": "9"
},
{
"input": "5\n00 00",
"output": "73"
},
{
"input": "2\n06 58",
"output": "390"
},
{
"input": "60\n00 00",
"output": "7"
},
{
"input": "2\n00 00",
"output": "181"
},
{
"input": "10\n00 00",
"output": "37"
},
{
"input": "60\n01 00",
"output": "8"
},
{
"input": "12\n00 06",
"output": "31"
},
{
"input": "1\n00 01",
"output": "4"
},
{
"input": "5\n00 05",
"output": "74"
},
{
"input": "60\n01 01",
"output": "8"
},
{
"input": "11\n18 11",
"output": "2"
},
{
"input": "60\n01 15",
"output": "8"
},
{
"input": "10\n00 16",
"output": "38"
},
{
"input": "60\n00 59",
"output": "7"
},
{
"input": "30\n00 00",
"output": "13"
},
{
"input": "60\n01 05",
"output": "8"
},
{
"input": "4\n00 03",
"output": "4"
},
{
"input": "4\n00 00",
"output": "91"
},
{
"input": "60\n00 01",
"output": "7"
},
{
"input": "6\n00 03",
"output": "1"
},
{
"input": "13\n00 00",
"output": "1"
},
{
"input": "1\n18 01",
"output": "2"
},
{
"input": "5\n06 00",
"output": "145"
},
{
"input": "60\n04 08",
"output": "11"
},
{
"input": "5\n01 55",
"output": "96"
},
{
"input": "8\n00 08",
"output": "47"
},
{
"input": "23\n18 23",
"output": "2"
},
{
"input": "6\n00 06",
"output": "62"
},
{
"input": "59\n18 59",
"output": "2"
},
{
"input": "11\n00 10",
"output": "3"
},
{
"input": "10\n00 01",
"output": "37"
},
{
"input": "59\n00 00",
"output": "7"
},
{
"input": "10\n18 10",
"output": "2"
},
{
"input": "5\n00 01",
"output": "73"
},
{
"input": "1\n00 00",
"output": "3"
},
{
"input": "8\n00 14",
"output": "47"
},
{
"input": "60\n03 00",
"output": "10"
},
{
"input": "60\n00 10",
"output": "7"
},
{
"input": "5\n01 13",
"output": "87"
},
{
"input": "30\n02 43",
"output": "18"
},
{
"input": "17\n00 08",
"output": "3"
},
{
"input": "3\n00 00",
"output": "1"
},
{
"input": "60\n00 05",
"output": "7"
},
{
"input": "5\n18 05",
"output": "2"
},
{
"input": "30\n00 30",
"output": "14"
},
{
"input": "1\n00 06",
"output": "9"
},
{
"input": "55\n00 00",
"output": "7"
},
{
"input": "8\n02 08",
"output": "62"
},
{
"input": "7\n00 00",
"output": "9"
},
{
"input": "6\n08 06",
"output": "2"
},
{
"input": "48\n06 24",
"output": "16"
},
{
"input": "8\n06 58",
"output": "98"
},
{
"input": "3\n12 00",
"output": "1"
},
{
"input": "5\n01 06",
"output": "86"
},
{
"input": "2\n00 08",
"output": "185"
},
{
"input": "3\n18 03",
"output": "2"
},
{
"input": "1\n17 00",
"output": "0"
},
{
"input": "59\n00 48",
"output": "7"
},
{
"input": "5\n12 01",
"output": "49"
},
{
"input": "55\n01 25",
"output": "9"
},
{
"input": "2\n07 23",
"output": "0"
},
{
"input": "10\n01 10",
"output": "44"
},
{
"input": "2\n00 01",
"output": "2"
},
{
"input": "59\n00 01",
"output": "6"
},
{
"input": "5\n00 02",
"output": "1"
},
{
"input": "4\n01 02",
"output": "106"
},
{
"input": "5\n00 06",
"output": "74"
},
{
"input": "42\n00 08",
"output": "9"
},
{
"input": "60\n01 20",
"output": "8"
},
{
"input": "3\n06 00",
"output": "1"
},
{
"input": "4\n00 01",
"output": "1"
},
{
"input": "2\n00 06",
"output": "184"
},
{
"input": "1\n00 57",
"output": "0"
},
{
"input": "6\n00 00",
"output": "61"
},
{
"input": "5\n08 40",
"output": "9"
},
{
"input": "58\n00 55",
"output": "1"
},
{
"input": "2\n00 02",
"output": "182"
},
{
"input": "1\n08 01",
"output": "2"
},
{
"input": "10\n10 10",
"output": "14"
},
{
"input": "60\n01 11",
"output": "8"
},
{
"input": "2\n07 00",
"output": "0"
},
{
"input": "15\n00 03",
"output": "25"
},
{
"input": "6\n04 34",
"output": "106"
},
{
"input": "16\n00 16",
"output": "24"
},
{
"input": "2\n00 59",
"output": "1"
},
{
"input": "59\n00 08",
"output": "7"
},
{
"input": "10\n03 10",
"output": "56"
},
{
"input": "3\n08 03",
"output": "2"
},
{
"input": "20\n06 11",
"output": "37"
},
{
"input": "4\n01 00",
"output": "106"
},
{
"input": "38\n01 08",
"output": "12"
},
{
"input": "60\n00 06",
"output": "7"
},
{
"input": "5\n12 00",
"output": "49"
},
{
"input": "6\n01 42",
"output": "78"
},
{
"input": "4\n00 04",
"output": "92"
},
{
"input": "60\n04 05",
"output": "11"
},
{
"input": "1\n00 53",
"output": "6"
},
{
"input": "5\n08 05",
"output": "2"
},
{
"input": "60\n18 45",
"output": "1"
},
{
"input": "60\n06 23",
"output": "13"
},
{
"input": "6\n00 15",
"output": "3"
},
{
"input": "58\n00 06",
"output": "7"
},
{
"input": "2\n06 44",
"output": "383"
},
{
"input": "1\n08 00",
"output": "1"
},
{
"input": "10\n06 58",
"output": "78"
},
{
"input": "59\n00 58",
"output": "8"
},
{
"input": "1\n18 00",
"output": "1"
},
{
"input": "50\n00 42",
"output": "9"
},
{
"input": "30\n18 30",
"output": "2"
},
{
"input": "60\n21 59",
"output": "4"
},
{
"input": "2\n10 52",
"output": "87"
},
{
"input": "56\n00 00",
"output": "7"
},
{
"input": "16\n18 16",
"output": "2"
},
{
"input": "5\n01 05",
"output": "86"
},
{
"input": "5\n05 00",
"output": "133"
},
{
"input": "5\n23 59",
"output": "72"
},
{
"input": "7\n17 13",
"output": "0"
},
{
"input": "58\n00 00",
"output": "7"
},
{
"input": "15\n00 07",
"output": "0"
},
{
"input": "59\n08 00",
"output": "1"
},
{
"input": "46\n00 00",
"output": "8"
},
{
"input": "59\n01 05",
"output": "2"
},
{
"input": "2\n01 00",
"output": "211"
},
{
"input": "60\n00 24",
"output": "7"
},
{
"input": "10\n00 08",
"output": "37"
},
{
"input": "10\n00 06",
"output": "37"
},
{
"input": "60\n01 24",
"output": "8"
},
{
"input": "50\n00 10",
"output": "8"
},
{
"input": "2\n03 00",
"output": "271"
},
{
"input": "4\n19 04",
"output": "17"
},
{
"input": "25\n00 23",
"output": "16"
},
{
"input": "10\n01 01",
"output": "43"
}
] | 1,522,510,776 | 516 | Python 3 | WRONG_ANSWER | TESTS | 2 | 77 | 7,065,600 | x = int(input())
hhs, mms = input().split()
hh, mm = int(hhs), int(mms)
if '7' in hhs or '7' in mms:
print(0)
else:
if mm > 57:
if '7' in str(hh + 1):
q = 60 - mm
else:
q = 67 - mm
else:
if mm % 10 > 7:
q = 7 + (10 - (mm % 10))
else:
q = 7 - (mm % 10)
print(q // x + 1)
| Title: Jamie and Alarm Snooze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jamie loves sleeping. One day, he decides that he needs to wake up at exactly *hh*:<=*mm*. However, he hates waking up, so he wants to make waking up less painful by setting the alarm at a lucky time. He will then press the snooze button every *x* minutes until *hh*:<=*mm* is reached, and only then he will wake up. He wants to know what is the smallest number of times he needs to press the snooze button.
A time is considered lucky if it contains a digit '7'. For example, 13:<=07 and 17:<=27 are lucky, while 00:<=48 and 21:<=34 are not lucky.
Note that it is not necessary that the time set for the alarm and the wake-up time are on the same day. It is guaranteed that there is a lucky time Jamie can set so that he can wake at *hh*:<=*mm*.
Formally, find the smallest possible non-negative integer *y* such that the time representation of the time *x*·*y* minutes before *hh*:<=*mm* contains the digit '7'.
Jamie uses 24-hours clock, so after 23:<=59 comes 00:<=00.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=60).
The second line contains two two-digit integers, *hh* and *mm* (00<=≤<=*hh*<=≤<=23,<=00<=≤<=*mm*<=≤<=59).
Output Specification:
Print the minimum number of times he needs to press the button.
Demo Input:
['3\n11 23\n', '5\n01 07\n']
Demo Output:
['2\n', '0\n']
Note:
In the first sample, Jamie needs to wake up at 11:23. So, he can set his alarm at 11:17. He would press the snooze button when the alarm rings at 11:17 and at 11:20.
In the second sample, Jamie can set his alarm at exactly at 01:07 which is lucky. | ```python
x = int(input())
hhs, mms = input().split()
hh, mm = int(hhs), int(mms)
if '7' in hhs or '7' in mms:
print(0)
else:
if mm > 57:
if '7' in str(hh + 1):
q = 60 - mm
else:
q = 67 - mm
else:
if mm % 10 > 7:
q = 7 + (10 - (mm % 10))
else:
q = 7 - (mm % 10)
print(q // x + 1)
``` | 0 |
|
908 | C | New Year and Curling | PROGRAMMING | 1,500 | [
"brute force",
"geometry",
"implementation",
"math"
] | null | null | Carol is currently curling.
She has *n* disks each with radius *r* on the 2D plane.
Initially she has all these disks above the line *y*<==<=10100.
She then will slide the disks towards the line *y*<==<=0 one by one in order from 1 to *n*.
When she slides the *i*-th disk, she will place its center at the point (*x**i*,<=10100). She will then push it so the disk’s *y* coordinate continuously decreases, and *x* coordinate stays constant. The disk stops once it touches the line *y*<==<=0 or it touches any previous disk. Note that once a disk stops moving, it will not move again, even if hit by another disk.
Compute the *y*-coordinates of centers of all the disks after all disks have been pushed. | The first line will contain two integers *n* and *r* (1<=≤<=*n*,<=*r*<=≤<=1<=000), the number of disks, and the radius of the disks, respectively.
The next line will contain *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=1<=000) — the *x*-coordinates of the disks. | Print a single line with *n* numbers. The *i*-th number denotes the *y*-coordinate of the center of the *i*-th disk. The output will be accepted if it has absolute or relative error at most 10<=-<=6.
Namely, let's assume that your answer for a particular value of a coordinate is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if for all coordinates. | [
"6 2\n5 5 6 8 3 12\n"
] | [
"2 6.0 9.87298334621 13.3370849613 12.5187346573 13.3370849613\n"
] | The final positions of the disks will look as follows:
In particular, note the position of the last disk. | 1,000 | [
{
"input": "6 2\n5 5 6 8 3 12",
"output": "2 6.0 9.87298334621 13.3370849613 12.5187346573 13.3370849613"
},
{
"input": "1 1\n5",
"output": "1"
},
{
"input": "5 300\n939 465 129 611 532",
"output": "300 667.864105343 1164.9596696 1522.27745533 2117.05388391"
},
{
"input": "5 1\n416 387 336 116 81",
"output": "1 1 1 1 1"
},
{
"input": "3 10\n1 100 1000",
"output": "10 10 10"
},
{
"input": "2 1\n2 20",
"output": "1 1"
},
{
"input": "3 2\n10 10 100",
"output": "2 6.0 2"
}
] | 1,514,574,895 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 46 | 5,529,600 | n,r=map(int,input().split())
a=list(map(int,input().split()))
b=[0 for i in range(n)]
b[0]=a[0]
for i in range(1,n+1):
w=r
for j in range(1,i):
if abs(a[j]-a[i]>2*r):continue
w=max(w,b[j]+math.sqrt(4*(r**2)-dx**2))
b[i]=w
print(*b) | Title: New Year and Curling
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Carol is currently curling.
She has *n* disks each with radius *r* on the 2D plane.
Initially she has all these disks above the line *y*<==<=10100.
She then will slide the disks towards the line *y*<==<=0 one by one in order from 1 to *n*.
When she slides the *i*-th disk, she will place its center at the point (*x**i*,<=10100). She will then push it so the disk’s *y* coordinate continuously decreases, and *x* coordinate stays constant. The disk stops once it touches the line *y*<==<=0 or it touches any previous disk. Note that once a disk stops moving, it will not move again, even if hit by another disk.
Compute the *y*-coordinates of centers of all the disks after all disks have been pushed.
Input Specification:
The first line will contain two integers *n* and *r* (1<=≤<=*n*,<=*r*<=≤<=1<=000), the number of disks, and the radius of the disks, respectively.
The next line will contain *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=1<=000) — the *x*-coordinates of the disks.
Output Specification:
Print a single line with *n* numbers. The *i*-th number denotes the *y*-coordinate of the center of the *i*-th disk. The output will be accepted if it has absolute or relative error at most 10<=-<=6.
Namely, let's assume that your answer for a particular value of a coordinate is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if for all coordinates.
Demo Input:
['6 2\n5 5 6 8 3 12\n']
Demo Output:
['2 6.0 9.87298334621 13.3370849613 12.5187346573 13.3370849613\n']
Note:
The final positions of the disks will look as follows:
In particular, note the position of the last disk. | ```python
n,r=map(int,input().split())
a=list(map(int,input().split()))
b=[0 for i in range(n)]
b[0]=a[0]
for i in range(1,n+1):
w=r
for j in range(1,i):
if abs(a[j]-a[i]>2*r):continue
w=max(w,b[j]+math.sqrt(4*(r**2)-dx**2))
b[i]=w
print(*b)
``` | -1 |
|
165 | C | Another Problem on Strings | PROGRAMMING | 1,600 | [
"binary search",
"brute force",
"dp",
"math",
"strings",
"two pointers"
] | null | null | A string is binary, if it consists only of characters "0" and "1".
String *v* is a substring of string *w* if it has a non-zero length and can be read starting from some position in string *w*. For example, string "010" has six substrings: "0", "1", "0", "01", "10", "010". Two substrings are considered different if their positions of occurrence are different. So, if some string occurs multiple times, we should consider it the number of times it occurs.
You are given a binary string *s*. Your task is to find the number of its substrings, containing exactly *k* characters "1". | The first line contains the single integer *k* (0<=≤<=*k*<=≤<=106). The second line contains a non-empty binary string *s*. The length of *s* does not exceed 106 characters. | Print the single number — the number of substrings of the given string, containing exactly *k* characters "1".
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"1\n1010\n",
"2\n01010\n",
"100\n01010\n"
] | [
"6\n",
"4\n",
"0\n"
] | In the first sample the sought substrings are: "1", "1", "10", "01", "10", "010".
In the second sample the sought substrings are: "101", "0101", "1010", "01010". | 1,500 | [
{
"input": "1\n1010",
"output": "6"
},
{
"input": "2\n01010",
"output": "4"
},
{
"input": "100\n01010",
"output": "0"
},
{
"input": "0\n01010",
"output": "3"
},
{
"input": "0\n0010100011",
"output": "10"
},
{
"input": "0\n10000",
"output": "10"
},
{
"input": "988205\n000110001001000",
"output": "0"
},
{
"input": "10\n1011110011111001100",
"output": "8"
},
{
"input": "0\n000",
"output": "6"
},
{
"input": "16\n1111011111110110111111111",
"output": "8"
},
{
"input": "0\n0",
"output": "1"
},
{
"input": "0\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n0",
"output": "0"
},
{
"input": "2\n1",
"output": "0"
},
{
"input": "1000000\n0",
"output": "0"
},
{
"input": "1000000\n1",
"output": "0"
},
{
"input": "0\n00",
"output": "3"
},
{
"input": "0\n01",
"output": "1"
},
{
"input": "0\n10",
"output": "1"
},
{
"input": "0\n11",
"output": "0"
},
{
"input": "1\n00",
"output": "0"
},
{
"input": "1\n01",
"output": "2"
},
{
"input": "1\n10",
"output": "2"
},
{
"input": "1\n11",
"output": "2"
},
{
"input": "2\n00",
"output": "0"
},
{
"input": "2\n01",
"output": "0"
},
{
"input": "2\n10",
"output": "0"
},
{
"input": "2\n11",
"output": "1"
},
{
"input": "94\n111111111111010111100111111111111011011111111011111111111011111111111111101111101111110111011111111110011111111001111101111",
"output": "17"
}
] | 1,691,534,866 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | def count_substrings(s, k):
answer = 0
prefix_sums = [0]
for i in range(len(s)):
prefix_sums.append(prefix_sums[i] + int(s[i]))
for i in range(len(prefix_sums)):
left = lower_bound(prefix_sums, i + 1, len(prefix_sums), prefix_sums[i] + k)
right = upper_bound(prefix_sums, i + 1, len(prefix_sums), prefix_sums[i] + k)
answer += right - left
return answer
def lower_bound(array, start, end, value):
answer = -1
while start <= end:
mid = (start + end) // 2
if value == array[mid]:
answer = mid
end = mid - 1
elif value < array[mid]:
end = mid - 1
else:
start = mid + 1
return answer
def upper_bound(array, start, end, value):
answer = -1
while start <= end:
mid = (start + end) // 2
if value == array[mid]:
answer = mid + 1
start = mid + 1
elif value < array[mid]:
end = mid - 1
else:
start = mid + 1
return answer
| Title: Another Problem on Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is binary, if it consists only of characters "0" and "1".
String *v* is a substring of string *w* if it has a non-zero length and can be read starting from some position in string *w*. For example, string "010" has six substrings: "0", "1", "0", "01", "10", "010". Two substrings are considered different if their positions of occurrence are different. So, if some string occurs multiple times, we should consider it the number of times it occurs.
You are given a binary string *s*. Your task is to find the number of its substrings, containing exactly *k* characters "1".
Input Specification:
The first line contains the single integer *k* (0<=≤<=*k*<=≤<=106). The second line contains a non-empty binary string *s*. The length of *s* does not exceed 106 characters.
Output Specification:
Print the single number — the number of substrings of the given string, containing exactly *k* characters "1".
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['1\n1010\n', '2\n01010\n', '100\n01010\n']
Demo Output:
['6\n', '4\n', '0\n']
Note:
In the first sample the sought substrings are: "1", "1", "10", "01", "10", "010".
In the second sample the sought substrings are: "101", "0101", "1010", "01010". | ```python
def count_substrings(s, k):
answer = 0
prefix_sums = [0]
for i in range(len(s)):
prefix_sums.append(prefix_sums[i] + int(s[i]))
for i in range(len(prefix_sums)):
left = lower_bound(prefix_sums, i + 1, len(prefix_sums), prefix_sums[i] + k)
right = upper_bound(prefix_sums, i + 1, len(prefix_sums), prefix_sums[i] + k)
answer += right - left
return answer
def lower_bound(array, start, end, value):
answer = -1
while start <= end:
mid = (start + end) // 2
if value == array[mid]:
answer = mid
end = mid - 1
elif value < array[mid]:
end = mid - 1
else:
start = mid + 1
return answer
def upper_bound(array, start, end, value):
answer = -1
while start <= end:
mid = (start + end) // 2
if value == array[mid]:
answer = mid + 1
start = mid + 1
elif value < array[mid]:
end = mid - 1
else:
start = mid + 1
return answer
``` | 0 |
|
208 | A | Dubstep | PROGRAMMING | 900 | [
"strings"
] | null | null | Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. | The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. | Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. | [
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] | [
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] | In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | 500 | [
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,693,403,666 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 71 | 124 | 0 | remix = input()
ori_song = [word for word in remix.split("WUB") if word]
ori_song_str = " ".join(ori_song)
print(ori_song_str)
| Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | ```python
remix = input()
ori_song = [word for word in remix.split("WUB") if word]
ori_song_str = " ".join(ori_song)
print(ori_song_str)
``` | 3 |
|
733 | A | Grasshopper And the String | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'. | The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100. | Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels. | [
"ABABBBACFEYUKOTT\n",
"AAA\n"
] | [
"4",
"1"
] | none | 500 | [
{
"input": "ABABBBACFEYUKOTT",
"output": "4"
},
{
"input": "AAA",
"output": "1"
},
{
"input": "A",
"output": "1"
},
{
"input": "B",
"output": "2"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIKLMJNHGTRWSDZXCVBNMHGFDSXVWRTPPPLKMNBXIUOIUOIUOIUOOIU",
"output": "39"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIAEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOI",
"output": "1"
},
{
"input": "KMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVCKMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVC",
"output": "85"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZ",
"output": "18"
},
{
"input": "PKLKBWTXVJ",
"output": "11"
},
{
"input": "CFHFPTGMOKXVLJJZJDQW",
"output": "12"
},
{
"input": "TXULTFSBUBFLRNQORMMULWNVLPWTYJXZBPBGAWNX",
"output": "9"
},
{
"input": "DAIUSEAUEUYUWEIOOEIOUYVYYOPEEWEBZOOOAOXUOIEUKYYOJOYAUYUUIYUXOUJLGIYEIIYUOCUAACRY",
"output": "4"
},
{
"input": "VRPHBNWNWVWBWMFJJDCTJQJDJBKSJRZLVQRVVFLTZFSGCGDXCWQVWWWMFVCQHPKXXVRKTGWGPSMQTPKNDQJHNSKLXPCXDJDQDZZD",
"output": "101"
},
{
"input": "SGDDFCDRDWGPNNFBBZZJSPXFYMZKPRXTCHVJSJJBWZXXQMDZBNKDHRGSRLGLRKPMWXNSXJPNJLDPXBSRCQMHJKPZNTPNTZXNPCJC",
"output": "76"
},
{
"input": "NVTQVNLGWFDBCBKSDLTBGWBMNQZWZQJWNGVCTCQBGWNTYJRDBPZJHXCXFMIXNRGSTXHQPCHNFQPCMDZWJGLJZWMRRFCVLBKDTDSC",
"output": "45"
},
{
"input": "SREZXQFVPQCLRCQGMKXCBRWKYZKWKRMZGXPMKWNMFZTRDPHJFCSXVPPXWKZMZTBFXGNLPLHZIPLFXNRRQFDTLFPKBGCXKTMCFKKT",
"output": "48"
},
{
"input": "ICKJKMVPDNZPLKDSLTPZNRLSQSGHQJQQPJJSNHNWVDLJRLZEJSXZDPHYXGGWXHLCTVQSKWNWGTLJMOZVJNZPVXGVPJKHFVZTGCCX",
"output": "47"
},
{
"input": "XXFPZDRPXLNHGDVCBDKJMKLGUQZXLLWYLOKFZVGXVNPJWZZZNRMQBRJCZTSDRHSNCVDMHKVXCXPCRBWSJCJWDRDPVZZLCZRTDRYA",
"output": "65"
},
{
"input": "HDDRZDKCHHHEDKHZMXQSNQGSGNNSCCPVJFGXGNCEKJMRKSGKAPQWPCWXXWHLSMRGSJWEHWQCSJJSGLQJXGVTBYALWMLKTTJMFPFS",
"output": "28"
},
{
"input": "PXVKJHXVDPWGLHWFWMJPMCCNHCKSHCPZXGIHHNMYNFQBUCKJJTXXJGKRNVRTQFDFMLLGPQKFOVNNLTNDIEXSARRJKGSCZKGGJCBW",
"output": "35"
},
{
"input": "EXNMTTFPJLDHXDQBJJRDRYBZVFFHUDCHCPNFZWXSMZXNFVJGHZWXVBRQFNUIDVLZOVPXQNVMFNBTJDSCKRLNGXPSADTGCAHCBJKL",
"output": "30"
},
{
"input": "NRNLSQQJGIJBCZFTNKJCXMGPARGWXPSHZXOBNSFOLDQVXTVAGJZNLXULHBRDGMNQKQGWMRRDPYCSNFVPUFTFBUBRXVJGNGSPJKLL",
"output": "19"
},
{
"input": "SRHOKCHQQMVZKTCVQXJJCFGYFXGMBZSZFNAFETXILZHPGHBWZRZQFMGSEYRUDVMCIQTXTBTSGFTHRRNGNTHHWWHCTDFHSVARMCMB",
"output": "30"
},
{
"input": "HBSVZHDKGNIRQUBYKYHUPJCEETGFMVBZJTHYHFQPFBVBSMQACYAVWZXSBGNKWXFNMQJFMSCHJVWBZXZGSNBRUHTHAJKVLEXFBOFB",
"output": "34"
},
{
"input": "NXKMUGOPTUQNSRYTKUKSCWCRQSZKKFPYUMDIBJAHJCEKZJVWZAWOLOEFBFXLQDDPNNZKCQHUPBFVDSXSUCVLMZXQROYQYIKPQPWR",
"output": "17"
},
{
"input": "TEHJDICFNOLQVQOAREVAGUAWODOCXJXIHYXFAEPEXRHPKEIIRCRIVASKNTVYUYDMUQKSTSSBYCDVZKDDHTSDWJWACPCLYYOXGCLT",
"output": "15"
},
{
"input": "LCJJUZZFEIUTMSEXEYNOOAIZMORQDOANAMUCYTFRARDCYHOYOPHGGYUNOGNXUAOYSEMXAZOOOFAVHQUBRNGORSPNQWZJYQQUNPEB",
"output": "9"
},
{
"input": "UUOKAOOJBXUTSMOLOOOOSUYYFTAVBNUXYFVOOGCGZYQEOYISIYOUULUAIJUYVVOENJDOCLHOSOHIHDEJOIGZNIXEMEGZACHUAQFW",
"output": "5"
},
{
"input": "OUUBEHXOOURMOAIAEHXCUOIYHUJEVAWYRCIIAGDRIPUIPAIUYAIWJEVYEYYUYBYOGVYESUJCFOJNUAHIOOKBUUHEJFEWPOEOUHYA",
"output": "4"
},
{
"input": "EMNOYEEUIOUHEWZITIAEZNCJUOUAOQEAUYEIHYUSUYUUUIAEDIOOERAEIRBOJIEVOMECOGAIAIUIYYUWYIHIOWVIJEYUEAFYULSE",
"output": "5"
},
{
"input": "BVOYEAYOIEYOREJUYEUOEOYIISYAEOUYAAOIOEOYOOOIEFUAEAAESUOOIIEUAAGAEISIAPYAHOOEYUJHUECGOYEIDAIRTBHOYOYA",
"output": "5"
},
{
"input": "GOIEOAYIEYYOOEOAIAEOOUWYEIOTNYAANAYOOXEEOEAVIOIAAIEOIAUIAIAAUEUAOIAEUOUUZYIYAIEUEGOOOOUEIYAEOSYAEYIO",
"output": "3"
},
{
"input": "AUEAOAYIAOYYIUIOAULIOEUEYAIEYYIUOEOEIEYRIYAYEYAEIIMMAAEAYAAAAEOUICAUAYOUIAOUIAIUOYEOEEYAEYEYAAEAOYIY",
"output": "3"
},
{
"input": "OAIIYEYYAOOEIUOEEIOUOIAEFIOAYETUYIOAAAEYYOYEYOEAUIIUEYAYYIIAOIEEYGYIEAAOOWYAIEYYYIAOUUOAIAYAYYOEUEOY",
"output": "2"
},
{
"input": "EEEAOEOEEIOUUUEUEAAOEOIUYJEYAIYIEIYYEAUOIIYIUOOEUCYEOOOYYYIUUAYIAOEUEIEAOUOIAACAOOUAUIYYEAAAOOUYIAAE",
"output": "2"
},
{
"input": "AYEYIIEUIYOYAYEUEIIIEUYUUAUEUIYAIAAUYONIEYIUIAEUUOUOYYOUUUIUIAEYEOUIIUOUUEOAIUUYAAEOAAEOYUUIYAYRAIII",
"output": "2"
},
{
"input": "YOOAAUUAAAYEUYIUIUYIUOUAEIEEIAUEOAUIIAAIUYEUUOYUIYEAYAAAYUEEOEEAEOEEYYOUAEUYEEAIIYEUEYJOIIYUIOIUOIEE",
"output": "2"
},
{
"input": "UYOIIIAYOOAIUUOOEEUYIOUAEOOEIOUIAIEYOAEAIOOEOOOIUYYUYIAAUIOUYYOOUAUIEYYUOAAUUEAAIEUIAUEUUIAUUOYOAYIU",
"output": "1"
},
{
"input": "ABBABBB",
"output": "4"
},
{
"input": "ABCD",
"output": "4"
},
{
"input": "XXYC",
"output": "3"
},
{
"input": "YYY",
"output": "1"
},
{
"input": "ABABBBBBBB",
"output": "8"
},
{
"input": "YYYY",
"output": "1"
},
{
"input": "YYYYY",
"output": "1"
},
{
"input": "AXXX",
"output": "4"
},
{
"input": "YYYYYYY",
"output": "1"
},
{
"input": "BYYBBB",
"output": "4"
},
{
"input": "YYYYYYYYY",
"output": "1"
},
{
"input": "CAAAAA",
"output": "2"
},
{
"input": "CCCACCCC",
"output": "5"
},
{
"input": "ABABBBACFEYUKOTTTT",
"output": "5"
},
{
"input": "AABBYYYYYYYY",
"output": "3"
},
{
"input": "BYBACYC",
"output": "2"
},
{
"input": "Y",
"output": "1"
},
{
"input": "ABBBBBB",
"output": "7"
},
{
"input": "BACDYDI",
"output": "3"
},
{
"input": "XEXXXXXXXXXXXXXXX",
"output": "16"
},
{
"input": "TTYTT",
"output": "3"
},
{
"input": "AAYBC",
"output": "3"
},
{
"input": "ABABBBACFEYUKOTTTTT",
"output": "6"
},
{
"input": "YYAYY",
"output": "1"
},
{
"input": "YZZY",
"output": "3"
},
{
"input": "YY",
"output": "1"
},
{
"input": "ZZYZZ",
"output": "3"
},
{
"input": "YBBBY",
"output": "4"
},
{
"input": "BBBACCCCCCC",
"output": "8"
},
{
"input": "YBBBBY",
"output": "5"
},
{
"input": "YYYYYYYYYY",
"output": "1"
},
{
"input": "ABABBBBBBBBBBBB",
"output": "13"
}
] | 1,606,370,938 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 5 | 124 | 0 | s=list(input())
n=len(s)
m=0
l=['A','E','I','O','U']
c=0
for i in range(n):
if(s[i] not in l):
c+=1
if(c>m):
m=c
else:
c=0
print(m+1)
| Title: Grasshopper And the String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
Input Specification:
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
Output Specification:
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
Demo Input:
['ABABBBACFEYUKOTT\n', 'AAA\n']
Demo Output:
['4', '1']
Note:
none | ```python
s=list(input())
n=len(s)
m=0
l=['A','E','I','O','U']
c=0
for i in range(n):
if(s[i] not in l):
c+=1
if(c>m):
m=c
else:
c=0
print(m+1)
``` | 0 |
|
581 | A | Vasya the Hipster | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him? | The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. | Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. | [
"3 1\n",
"2 3\n",
"7 3\n"
] | [
"1 1\n",
"2 0\n",
"3 2\n"
] | In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | 500 | [
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,693,251,876 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 30 | 62 | 0 | entrada = list(map(int, input().split()))
print(min(entrada), end=" ")
print(abs(entrada[0] - entrada[1]) // 2)
| Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | ```python
entrada = list(map(int, input().split()))
print(min(entrada), end=" ")
print(abs(entrada[0] - entrada[1]) // 2)
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Slastyona and her loyal dog Pushok are playing a meaningless game that is indeed very interesting.
The game consists of multiple rounds. Its rules are very simple: in each round, a natural number *k* is chosen. Then, the one who says (or barks) it faster than the other wins the round. After that, the winner's score is multiplied by *k*2, and the loser's score is multiplied by *k*. In the beginning of the game, both Slastyona and Pushok have scores equal to one.
Unfortunately, Slastyona had lost her notepad where the history of all *n* games was recorded. She managed to recall the final results for each games, though, but all of her memories of them are vague. Help Slastyona verify their correctness, or, to put it another way, for each given pair of scores determine whether it was possible for a game to finish with such result or not. | In the first string, the number of games *n* (1<=≤<=*n*<=≤<=350000) is given.
Each game is represented by a pair of scores *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) – the results of Slastyona and Pushok, correspondingly. | For each pair of scores, answer "Yes" if it's possible for a game to finish with given score, and "No" otherwise.
You can output each letter in arbitrary case (upper or lower). | [
"6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000\n"
] | [
"Yes\nYes\nYes\nNo\nNo\nYes\n"
] | First game might have been consisted of one round, in which the number 2 would have been chosen and Pushok would have won.
The second game needs exactly two rounds to finish with such result: in the first one, Slastyona would have said the number 5, and in the second one, Pushok would have barked the number 3. | 0 | [
{
"input": "6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000",
"output": "Yes\nYes\nYes\nNo\nNo\nYes"
},
{
"input": "3\n1 1\n8 27\n1000 1331",
"output": "Yes\nNo\nNo"
},
{
"input": "1\n12004 18012002",
"output": "Yes"
},
{
"input": "1\n3331 11095561",
"output": "Yes"
},
{
"input": "1\n2 3",
"output": "No"
},
{
"input": "1\n1062961 1031",
"output": "Yes"
},
{
"input": "1\n6 12",
"output": "No"
},
{
"input": "1\n3 1",
"output": "No"
},
{
"input": "1\n3 10",
"output": "No"
},
{
"input": "1\n31159 970883281",
"output": "Yes"
},
{
"input": "1\n9907 98148649",
"output": "Yes"
},
{
"input": "1\n16 8",
"output": "No"
},
{
"input": "1\n90 72",
"output": "No"
}
] | 1,641,313,006 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 7 | 1,000 | 8,908,800 | t = int(input())
for _ in range(t):
a, b = map(int, input().split())
c = a*b
cbrt = int(c**(1/3))
if (cbrt+1)**3 == c:
cbrt += 1
if (cbrt-1)**3 == c:
cbrt -= 1
if cbrt**3 == c and a%cbrt == 0 and b%cbrt == 0:
print('YES')
else:
print('NO') | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Slastyona and her loyal dog Pushok are playing a meaningless game that is indeed very interesting.
The game consists of multiple rounds. Its rules are very simple: in each round, a natural number *k* is chosen. Then, the one who says (or barks) it faster than the other wins the round. After that, the winner's score is multiplied by *k*2, and the loser's score is multiplied by *k*. In the beginning of the game, both Slastyona and Pushok have scores equal to one.
Unfortunately, Slastyona had lost her notepad where the history of all *n* games was recorded. She managed to recall the final results for each games, though, but all of her memories of them are vague. Help Slastyona verify their correctness, or, to put it another way, for each given pair of scores determine whether it was possible for a game to finish with such result or not.
Input Specification:
In the first string, the number of games *n* (1<=≤<=*n*<=≤<=350000) is given.
Each game is represented by a pair of scores *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) – the results of Slastyona and Pushok, correspondingly.
Output Specification:
For each pair of scores, answer "Yes" if it's possible for a game to finish with given score, and "No" otherwise.
You can output each letter in arbitrary case (upper or lower).
Demo Input:
['6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000\n']
Demo Output:
['Yes\nYes\nYes\nNo\nNo\nYes\n']
Note:
First game might have been consisted of one round, in which the number 2 would have been chosen and Pushok would have won.
The second game needs exactly two rounds to finish with such result: in the first one, Slastyona would have said the number 5, and in the second one, Pushok would have barked the number 3. | ```python
t = int(input())
for _ in range(t):
a, b = map(int, input().split())
c = a*b
cbrt = int(c**(1/3))
if (cbrt+1)**3 == c:
cbrt += 1
if (cbrt-1)**3 == c:
cbrt -= 1
if cbrt**3 == c and a%cbrt == 0 and b%cbrt == 0:
print('YES')
else:
print('NO')
``` | 0 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.