text
stringlengths
7
318k
id
stringlengths
14
166
metadata
dict
__index_level_0__
int64
0
439
<!--Copyright 2023 The HuggingFace Team. All rights reserved. Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License. --> # Unconditional image generation [[open-in-colab]] Unconditional image generation generates images that look like a random sample from the training data the model was trained on because the denoising process is not guided by any additional context like text or image. To get started, use the [`DiffusionPipeline`] to load the [anton-l/ddpm-butterflies-128](https://huggingface.co/anton-l/ddpm-butterflies-128) checkpoint to generate images of butterflies. The [`DiffusionPipeline`] downloads and caches all the model components required to generate an image. ```py from diffusers import DiffusionPipeline generator = DiffusionPipeline.from_pretrained("anton-l/ddpm-butterflies-128").to("cuda") image = generator().images[0] image ``` <Tip> Want to generate images of something else? Take a look at the training [guide](../training/unconditional_training) to learn how to train a model to generate your own images. </Tip> The output image is a [`PIL.Image`](https://pillow.readthedocs.io/en/stable/reference/Image.html?highlight=image#the-image-class) object that can be saved: ```py image.save("generated_image.png") ``` You can also try experimenting with the `num_inference_steps` parameter, which controls the number of denoising steps. More denoising steps typically produce higher quality images, but it'll take longer to generate. Feel free to play around with this parameter to see how it affects the image quality. ```py image = generator(num_inference_steps=100).images[0] image ``` Try out the Space below to generate an image of a butterfly! <iframe src="https://stevhliu-unconditional-image-generation.hf.space" frameborder="0" width="850" height="500" ></iframe>
diffusers/docs/source/en/using-diffusers/unconditional_image_generation.md/0
{ "file_path": "diffusers/docs/source/en/using-diffusers/unconditional_image_generation.md", "repo_id": "diffusers", "token_count": 636 }
93
<!--Copyright 2023 The HuggingFace Team. All rights reserved. Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License. --> # Core ML๋กœ Stable Diffusion์„ ์‹คํ–‰ํ•˜๋Š” ๋ฐฉ๋ฒ• [Core ML](https://developer.apple.com/documentation/coreml)์€ Apple ํ”„๋ ˆ์ž„์›Œํฌ์—์„œ ์ง€์›ํ•˜๋Š” ๋ชจ๋ธ ํ˜•์‹ ๋ฐ ๋จธ์‹  ๋Ÿฌ๋‹ ๋ผ์ด๋ธŒ๋Ÿฌ๋ฆฌ์ž…๋‹ˆ๋‹ค. macOS ๋˜๋Š” iOS/iPadOS ์•ฑ ๋‚ด์—์„œ Stable Diffusion ๋ชจ๋ธ์„ ์‹คํ–‰ํ•˜๋Š” ๋ฐ ๊ด€์‹ฌ์ด ์žˆ๋Š” ๊ฒฝ์šฐ, ์ด ๊ฐ€์ด๋“œ์—์„œ๋Š” ๊ธฐ์กด PyTorch ์ฒดํฌํฌ์ธํŠธ๋ฅผ Core ML ํ˜•์‹์œผ๋กœ ๋ณ€ํ™˜ํ•˜๊ณ  ์ด๋ฅผ Python ๋˜๋Š” Swift๋กœ ์ถ”๋ก ์— ์‚ฌ์šฉํ•˜๋Š” ๋ฐฉ๋ฒ•์„ ์„ค๋ช…ํ•ฉ๋‹ˆ๋‹ค. Core ML ๋ชจ๋ธ์€ Apple ๊ธฐ๊ธฐ์—์„œ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ๋Š” ๋ชจ๋“  ์ปดํ“จํŒ… ์—”์ง„๋“ค, ์ฆ‰ CPU, GPU, Apple Neural Engine(๋˜๋Š” Apple Silicon Mac ๋ฐ ์ตœ์‹  iPhone/iPad์—์„œ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ๋Š” ํ…์„œ ์ตœ์ ํ™” ๊ฐ€์†๊ธฐ์ธ ANE)์„ ํ™œ์šฉํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ๋ชจ๋ธ๊ณผ ์‹คํ–‰ ์ค‘์ธ ๊ธฐ๊ธฐ์— ๋”ฐ๋ผ Core ML์€ ์ปดํ“จํŒ… ์—”์ง„๋„ ํ˜ผํ•ฉํ•˜์—ฌ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ์œผ๋ฏ€๋กœ, ์˜ˆ๋ฅผ ๋“ค์–ด ๋ชจ๋ธ์˜ ์ผ๋ถ€๊ฐ€ CPU์—์„œ ์‹คํ–‰๋˜๋Š” ๋ฐ˜๋ฉด ๋‹ค๋ฅธ ๋ถ€๋ถ„์€ GPU์—์„œ ์‹คํ–‰๋  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. <Tip> PyTorch์— ๋‚ด์žฅ๋œ `mps` ๊ฐ€์†๊ธฐ๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ Apple Silicon Macs์—์„œ `diffusers` Python ์ฝ”๋“œ๋ฒ ์ด์Šค๋ฅผ ์‹คํ–‰ํ•  ์ˆ˜๋„ ์žˆ์Šต๋‹ˆ๋‹ค. ์ด ๋ฐฉ๋ฒ•์€ [mps ๊ฐ€์ด๋“œ]์— ์ž์„ธํžˆ ์„ค๋ช…๋˜์–ด ์žˆ์ง€๋งŒ ๋„ค์ดํ‹ฐ๋ธŒ ์•ฑ๊ณผ ํ˜ธํ™˜๋˜์ง€ ์•Š์Šต๋‹ˆ๋‹ค. </Tip> ## Stable Diffusion Core ML ์ฒดํฌํฌ์ธํŠธ Stable Diffusion ๊ฐ€์ค‘์น˜(๋˜๋Š” ์ฒดํฌํฌ์ธํŠธ)๋Š” PyTorch ํ˜•์‹์œผ๋กœ ์ €์žฅ๋˜๊ธฐ ๋•Œ๋ฌธ์— ๋„ค์ดํ‹ฐ๋ธŒ ์•ฑ์—์„œ ์‚ฌ์šฉํ•˜๊ธฐ ์œ„ํ•ด์„œ๋Š” Core ML ํ˜•์‹์œผ๋กœ ๋ณ€ํ™˜ํ•ด์•ผ ํ•ฉ๋‹ˆ๋‹ค. ๋‹คํ–‰ํžˆ๋„ Apple ์—”์ง€๋‹ˆ์–ด๋“ค์ด `diffusers`๋ฅผ ๊ธฐ๋ฐ˜์œผ๋กœ ํ•œ [๋ณ€ํ™˜ ํˆด](https://github.com/apple/ml-stable-diffusion#-converting-models-to-core-ml)์„ ๊ฐœ๋ฐœํ•˜์—ฌ PyTorch ์ฒดํฌํฌ์ธํŠธ๋ฅผ Core ML๋กœ ๋ณ€ํ™˜ํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ๋ชจ๋ธ์„ ๋ณ€ํ™˜ํ•˜๊ธฐ ์ „์— ์ž ์‹œ ์‹œ๊ฐ„์„ ๋‚ด์–ด Hugging Face Hub๋ฅผ ์‚ดํŽด๋ณด์„ธ์š”. ๊ด€์‹ฌ ์žˆ๋Š” ๋ชจ๋ธ์ด ์ด๋ฏธ Core ML ํ˜•์‹์œผ๋กœ ์ œ๊ณต๋˜๊ณ  ์žˆ์„ ๊ฐ€๋Šฅ์„ฑ์ด ๋†’์Šต๋‹ˆ๋‹ค: - [Apple](https://huggingface.co/apple) organization์—๋Š” Stable Diffusion ๋ฒ„์ „ 1.4, 1.5, 2.0 base ๋ฐ 2.1 base๊ฐ€ ํฌํ•จ๋˜์–ด ์žˆ์Šต๋‹ˆ๋‹ค. - [coreml](https://huggingface.co/coreml) organization์—๋Š” ์ปค์Šคํ…€ DreamBooth๊ฐ€ ์ ์šฉ๋˜๊ฑฐ๋‚˜, ํŒŒ์ธํŠœ๋‹๋œ ๋ชจ๋ธ์ด ํฌํ•จ๋˜์–ด ์žˆ์Šต๋‹ˆ๋‹ค. - ์ด [ํ•„ํ„ฐ](https://huggingface.co/models?pipeline_tag=text-to-image&library=coreml&p=2&sort=likes)๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ ์‚ฌ์šฉ ๊ฐ€๋Šฅํ•œ ๋ชจ๋“  Core ML ์ฒดํฌํฌ์ธํŠธ๋“ค์„ ๋ฐ˜ํ™˜ํ•ฉ๋‹ˆ๋‹ค. ์›ํ•˜๋Š” ๋ชจ๋ธ์„ ์ฐพ์„ ์ˆ˜ ์—†๋Š” ๊ฒฝ์šฐ Apple์˜ [๋ชจ๋ธ์„ Core ML๋กœ ๋ณ€ํ™˜ํ•˜๊ธฐ](https://github.com/apple/ml-stable-diffusion#-converting-models-to-core-ml) ์ง€์นจ์„ ๋”ฐ๋ฅด๋Š” ๊ฒƒ์ด ์ข‹์Šต๋‹ˆ๋‹ค. ## ์‚ฌ์šฉํ•  Core ML ๋ณ€ํ˜•(Variant) ์„ ํƒํ•˜๊ธฐ Stable Diffusion ๋ชจ๋ธ์€ ๋‹ค์–‘ํ•œ ๋ชฉ์ ์— ๋”ฐ๋ผ ๋‹ค๋ฅธ Core ML ๋ณ€ํ˜•์œผ๋กœ ๋ณ€ํ™˜ํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค: - ์‚ฌ์šฉ๋˜๋Š” ์–ดํ…์…˜ ๋ธ”๋ก ์œ ํ˜•. ์–ดํ…์…˜ ์—ฐ์‚ฐ์€ ์ด๋ฏธ์ง€ ํ‘œํ˜„์˜ ์—ฌ๋Ÿฌ ์˜์—ญ ๊ฐ„์˜ ๊ด€๊ณ„์— '์ฃผ์˜๋ฅผ ๊ธฐ์šธ์ด๊ณ ' ์ด๋ฏธ์ง€์™€ ํ…์ŠคํŠธ ํ‘œํ˜„์ด ์–ด๋–ป๊ฒŒ ์—ฐ๊ด€๋˜์–ด ์žˆ๋Š”์ง€ ์ดํ•ดํ•˜๋Š” ๋ฐ ์‚ฌ์šฉ๋ฉ๋‹ˆ๋‹ค. ์–ดํ…์…˜ ์—ฐ์‚ฐ์€ ์ปดํ“จํŒ… ๋ฐ ๋ฉ”๋ชจ๋ฆฌ ์ง‘์•ฝ์ ์ด๋ฏ€๋กœ ๋‹ค์–‘ํ•œ ์žฅ์น˜์˜ ํ•˜๋“œ์›จ์–ด ํŠน์„ฑ์„ ๊ณ ๋ คํ•œ ๋‹ค์–‘ํ•œ ๊ตฌํ˜„์ด ์กด์žฌํ•ฉ๋‹ˆ๋‹ค. Core ML Stable Diffusion ๋ชจ๋ธ์˜ ๊ฒฝ์šฐ ๋‘ ๊ฐ€์ง€ ์ฃผ์˜ ๋ณ€ํ˜•์ด ์žˆ์Šต๋‹ˆ๋‹ค: * `split_einsum` ([Apple์—์„œ ๋„์ž…](https://machinelearning.apple.com/research/neural-engine-transformers)์€ ์ตœ์‹  iPhone, iPad ๋ฐ M ์‹œ๋ฆฌ์ฆˆ ์ปดํ“จํ„ฐ์—์„œ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ๋Š” ANE ์žฅ์น˜์— ์ตœ์ ํ™”๋˜์–ด ์žˆ์Šต๋‹ˆ๋‹ค. * "์›๋ณธ" ์–ดํ…์…˜(`diffusers`์— ์‚ฌ์šฉ๋˜๋Š” ๊ธฐ๋ณธ ๊ตฌํ˜„)๋Š” CPU/GPU์™€๋งŒ ํ˜ธํ™˜๋˜๋ฉฐ ANE์™€๋Š” ํ˜ธํ™˜๋˜์ง€ ์•Š์Šต๋‹ˆ๋‹ค. "์›๋ณธ" ์–ดํ…์…˜์„ ์‚ฌ์šฉํ•˜์—ฌ CPU + GPU์—์„œ ๋ชจ๋ธ์„ ์‹คํ–‰ํ•˜๋Š” ๊ฒƒ์ด ANE๋ณด๋‹ค *๋”* ๋น ๋ฅผ ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ์ž์„ธํ•œ ๋‚ด์šฉ์€ [์ด ์„ฑ๋Šฅ ๋ฒค์น˜๋งˆํฌ](https://huggingface.co/blog/fast-mac-diffusers#performance-benchmarks)์™€ ์ปค๋ฎค๋‹ˆํ‹ฐ์—์„œ ์ œ๊ณตํ•˜๋Š” ์ผ๋ถ€ [์ถ”๊ฐ€ ์ธก์ •](https://github.com/huggingface/swift-coreml-diffusers/issues/31)์„ ์ฐธ์กฐํ•˜์‹ญ์‹œ์˜ค. - ์ง€์›๋˜๋Š” ์ถ”๋ก  ํ”„๋ ˆ์ž„์›Œํฌ * `packages`๋Š” Python ์ถ”๋ก ์— ์ ํ•ฉํ•ฉ๋‹ˆ๋‹ค. ๋„ค์ดํ‹ฐ๋ธŒ ์•ฑ์— ํ†ตํ•ฉํ•˜๊ธฐ ์ „์— ๋ณ€ํ™˜๋œ Core ML ๋ชจ๋ธ์„ ํ…Œ์ŠคํŠธํ•˜๊ฑฐ๋‚˜, Core ML ์„ฑ๋Šฅ์„ ์•Œ๊ณ  ์‹ถ์ง€๋งŒ ๋„ค์ดํ‹ฐ๋ธŒ ์•ฑ์„ ์ง€์›ํ•  ํ•„์š”๋Š” ์—†๋Š” ๊ฒฝ์šฐ์— ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ์˜ˆ๋ฅผ ๋“ค์–ด, ์›น UI๊ฐ€ ์žˆ๋Š” ์• ํ”Œ๋ฆฌ์ผ€์ด์…˜์€ Python Core ML ๋ฐฑ์—”๋“œ๋ฅผ ์™„๋ฒฝํ•˜๊ฒŒ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. * Swift ์ฝ”๋“œ์—๋Š” `์ปดํŒŒ์ผ๋œ` ๋ชจ๋ธ์ด ํ•„์š”ํ•ฉ๋‹ˆ๋‹ค. Hub์˜ `์ปดํŒŒ์ผ๋œ` ๋ชจ๋ธ์€ iOS ๋ฐ iPadOS ๊ธฐ๊ธฐ์™€์˜ ํ˜ธํ™˜์„ฑ์„ ์œ„ํ•ด ํฐ UNet ๋ชจ๋ธ ๊ฐ€์ค‘์น˜๋ฅผ ์—ฌ๋Ÿฌ ํŒŒ์ผ๋กœ ๋ถ„ํ• ํ•ฉ๋‹ˆ๋‹ค. ์ด๋Š” [`--chunk-unet` ๋ณ€ํ™˜ ์˜ต์…˜](https://github.com/apple/ml-stable-diffusion#-converting-models-to-core-ml)์— ํ•ด๋‹นํ•ฉ๋‹ˆ๋‹ค. ๋„ค์ดํ‹ฐ๋ธŒ ์•ฑ์„ ์ง€์›ํ•˜๋ ค๋ฉด `์ปดํŒŒ์ผ๋œ` ๋ณ€ํ˜•์„ ์„ ํƒํ•ด์•ผ ํ•ฉ๋‹ˆ๋‹ค. ๊ณต์‹ Core ML Stable Diffusion [๋ชจ๋ธ](https://huggingface.co/apple/coreml-stable-diffusion-v1-4/tree/main)์—๋Š” ์ด๋Ÿฌํ•œ ๋ณ€ํ˜•์ด ํฌํ•จ๋˜์–ด ์žˆ์ง€๋งŒ ์ปค๋ฎค๋‹ˆํ‹ฐ ๋ฒ„์ „์€ ๋‹ค๋ฅผ ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค: ``` coreml-stable-diffusion-v1-4 โ”œโ”€โ”€ README.md โ”œโ”€โ”€ original โ”‚ โ”œโ”€โ”€ compiled โ”‚ โ””โ”€โ”€ packages โ””โ”€โ”€ split_einsum โ”œโ”€โ”€ compiled โ””โ”€โ”€ packages ``` ์•„๋ž˜์™€ ๊ฐ™์ด ํ•„์š”ํ•œ ๋ณ€ํ˜•์„ ๋‹ค์šด๋กœ๋“œํ•˜์—ฌ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ## Python์—์„œ Core ML ์ถ”๋ก  Python์—์„œ Core ML ์ถ”๋ก ์„ ์‹คํ–‰ํ•˜๋ ค๋ฉด ๋‹ค์Œ ๋ผ์ด๋ธŒ๋Ÿฌ๋ฆฌ๋ฅผ ์„ค์น˜ํ•˜์„ธ์š”: ```bash pip install huggingface_hub pip install git+https://github.com/apple/ml-stable-diffusion ``` ### ๋ชจ๋ธ ์ฒดํฌํฌ์ธํŠธ ๋‹ค์šด๋กœ๋“œํ•˜๊ธฐ `์ปดํŒŒ์ผ๋œ` ๋ฒ„์ „์€ Swift์™€๋งŒ ํ˜ธํ™˜๋˜๋ฏ€๋กœ Python์—์„œ ์ถ”๋ก ์„ ์‹คํ–‰ํ•˜๋ ค๋ฉด `packages` ํด๋”์— ์ €์žฅ๋œ ๋ฒ„์ „ ์ค‘ ํ•˜๋‚˜๋ฅผ ์‚ฌ์šฉํ•˜์„ธ์š”. `์›๋ณธ` ๋˜๋Š” `split_einsum` ์–ดํ…์…˜ ์ค‘ ์–ด๋А ๊ฒƒ์„ ์‚ฌ์šฉํ• ์ง€ ์„ ํƒํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ๋‹ค์Œ์€ Hub์—์„œ 'models'๋ผ๋Š” ๋””๋ ‰ํ† ๋ฆฌ๋กœ 'original' ์–ดํ…์…˜ ๋ณ€ํ˜•์„ ๋‹ค์šด๋กœ๋“œํ•˜๋Š” ๋ฐฉ๋ฒ•์ž…๋‹ˆ๋‹ค: ```Python from huggingface_hub import snapshot_download from pathlib import Path repo_id = "apple/coreml-stable-diffusion-v1-4" variant = "original/packages" model_path = Path("./models") / (repo_id.split("/")[-1] + "_" + variant.replace("/", "_")) snapshot_download(repo_id, allow_patterns=f"{variant}/*", local_dir=model_path, local_dir_use_symlinks=False) print(f"Model downloaded at {model_path}") ``` ### ์ถ”๋ก [[python-inference]] ๋ชจ๋ธ์˜ snapshot์„ ๋‹ค์šด๋กœ๋“œํ•œ ํ›„์—๋Š” Apple์˜ Python ์Šคํฌ๋ฆฝํŠธ๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ ํ…Œ์ŠคํŠธํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ```shell python -m python_coreml_stable_diffusion.pipeline --prompt "a photo of an astronaut riding a horse on mars" -i models/coreml-stable-diffusion-v1-4_original_packages -o </path/to/output/image> --compute-unit CPU_AND_GPU --seed 93 ``` `<output-mlpackages-directory>`๋Š” ์œ„ ๋‹จ๊ณ„์—์„œ ๋‹ค์šด๋กœ๋“œํ•œ ์ฒดํฌํฌ์ธํŠธ๋ฅผ ๊ฐ€๋ฆฌ์ผœ์•ผ ํ•˜๋ฉฐ, `--compute-unit`์€ ์ถ”๋ก ์„ ํ—ˆ์šฉํ•  ํ•˜๋“œ์›จ์–ด๋ฅผ ๋‚˜ํƒ€๋ƒ…๋‹ˆ๋‹ค. ์ด๋Š” ๋‹ค์Œ ์˜ต์…˜ ์ค‘ ํ•˜๋‚˜์ด์–ด์•ผ ํ•ฉ๋‹ˆ๋‹ค: `ALL`, `CPU_AND_GPU`, `CPU_ONLY`, `CPU_AND_NE`. ์„ ํƒ์  ์ถœ๋ ฅ ๊ฒฝ๋กœ์™€ ์žฌํ˜„์„ฑ์„ ์œ„ํ•œ ์‹œ๋“œ๋ฅผ ์ œ๊ณตํ•  ์ˆ˜๋„ ์žˆ์Šต๋‹ˆ๋‹ค. ์ถ”๋ก  ์Šคํฌ๋ฆฝํŠธ์—์„œ๋Š” Stable Diffusion ๋ชจ๋ธ์˜ ์›๋ž˜ ๋ฒ„์ „์ธ `CompVis/stable-diffusion-v1-4`๋ฅผ ์‚ฌ์šฉํ•œ๋‹ค๊ณ  ๊ฐ€์ •ํ•ฉ๋‹ˆ๋‹ค. ๋‹ค๋ฅธ ๋ชจ๋ธ์„ ์‚ฌ์šฉํ•˜๋Š” ๊ฒฝ์šฐ ์ถ”๋ก  ๋ช…๋ น์ค„์—์„œ `--model-version` ์˜ต์…˜์„ ์‚ฌ์šฉํ•˜์—ฌ ํ•ด๋‹น ํ—ˆ๋ธŒ ID๋ฅผ *์ง€์ •*ํ•ด์•ผ ํ•ฉ๋‹ˆ๋‹ค. ์ด๋Š” ์ด๋ฏธ ์ง€์›๋˜๋Š” ๋ชจ๋ธ๊ณผ ์‚ฌ์šฉ์ž๊ฐ€ ์ง์ ‘ ํ•™์Šตํ•˜๊ฑฐ๋‚˜ ํŒŒ์ธํŠœ๋‹ํ•œ ์‚ฌ์šฉ์ž ์ง€์ • ๋ชจ๋ธ์— ์ ์šฉ๋ฉ๋‹ˆ๋‹ค. ์˜ˆ๋ฅผ ๋“ค์–ด, [`runwayml/stable-diffusion-v1-5`](https://huggingface.co/runwayml/stable-diffusion-v1-5)๋ฅผ ์‚ฌ์šฉํ•˜๋ ค๋Š” ๊ฒฝ์šฐ์ž…๋‹ˆ๋‹ค: ```shell python -m python_coreml_stable_diffusion.pipeline --prompt "a photo of an astronaut riding a horse on mars" --compute-unit ALL -o output --seed 93 -i models/coreml-stable-diffusion-v1-5_original_packages --model-version runwayml/stable-diffusion-v1-5 ``` ## Swift์—์„œ Core ML ์ถ”๋ก ํ•˜๊ธฐ Swift์—์„œ ์ถ”๋ก ์„ ์‹คํ–‰ํ•˜๋Š” ๊ฒƒ์€ ๋ชจ๋ธ์ด ์ด๋ฏธ `mlmodelc` ํ˜•์‹์œผ๋กœ ์ปดํŒŒ์ผ๋˜์–ด ์žˆ๊ธฐ ๋•Œ๋ฌธ์— Python๋ณด๋‹ค ์•ฝ๊ฐ„ ๋น ๋ฆ…๋‹ˆ๋‹ค. ์ด๋Š” ์•ฑ์ด ์‹œ์ž‘๋  ๋•Œ ๋ชจ๋ธ์ด ๋ถˆ๋Ÿฌ์™€์ง€๋Š” ๊ฒƒ์ด ๋ˆˆ์— ๋„์ง€๋งŒ, ์ดํ›„ ์—ฌ๋Ÿฌ ๋ฒˆ ์‹คํ–‰ํ•˜๋ฉด ๋ˆˆ์— ๋„์ง€ ์•Š์„ ๊ฒƒ์ž…๋‹ˆ๋‹ค. ### ๋‹ค์šด๋กœ๋“œ Mac์—์„œ Swift์—์„œ ์ถ”๋ก ์„ ์‹คํ–‰ํ•˜๋ ค๋ฉด `์ปดํŒŒ์ผ๋œ` ์ฒดํฌํฌ์ธํŠธ ๋ฒ„์ „ ์ค‘ ํ•˜๋‚˜๊ฐ€ ํ•„์š”ํ•ฉ๋‹ˆ๋‹ค. ์ด์ „ ์˜ˆ์ œ์™€ ์œ ์‚ฌํ•˜์ง€๋งŒ `์ปดํŒŒ์ผ๋œ` ๋ณ€ํ˜• ์ค‘ ํ•˜๋‚˜๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ Python ์ฝ”๋“œ๋ฅผ ๋กœ์ปฌ๋กœ ๋‹ค์šด๋กœ๋“œํ•˜๋Š” ๊ฒƒ์ด ์ข‹์Šต๋‹ˆ๋‹ค: ```Python from huggingface_hub import snapshot_download from pathlib import Path repo_id = "apple/coreml-stable-diffusion-v1-4" variant = "original/compiled" model_path = Path("./models") / (repo_id.split("/")[-1] + "_" + variant.replace("/", "_")) snapshot_download(repo_id, allow_patterns=f"{variant}/*", local_dir=model_path, local_dir_use_symlinks=False) print(f"Model downloaded at {model_path}") ``` ### ์ถ”๋ก [[swift-inference]] ์ถ”๋ก ์„ ์‹คํ–‰ํ•˜๊ธฐ ์œ„ํ•ด์„œ, Apple์˜ ๋ฆฌํฌ์ง€ํ† ๋ฆฌ๋ฅผ ๋ณต์ œํ•˜์„ธ์š”: ```bash git clone https://github.com/apple/ml-stable-diffusion cd ml-stable-diffusion ``` ๊ทธ ๋‹ค์Œ Apple์˜ ๋ช…๋ น์–ด ๋„๊ตฌ์ธ [Swift ํŒจํ‚ค์ง€ ๊ด€๋ฆฌ์ž](https://www.swift.org/package-manager/#)๋ฅผ ์‚ฌ์šฉํ•ฉ๋‹ˆ๋‹ค: ```bash swift run StableDiffusionSample --resource-path models/coreml-stable-diffusion-v1-4_original_compiled --compute-units all "a photo of an astronaut riding a horse on mars" ``` `--resource-path`์— ์ด์ „ ๋‹จ๊ณ„์—์„œ ๋‹ค์šด๋กœ๋“œํ•œ ์ฒดํฌํฌ์ธํŠธ ์ค‘ ํ•˜๋‚˜๋ฅผ ์ง€์ •ํ•ด์•ผ ํ•˜๋ฏ€๋กœ ํ™•์žฅ์ž๊ฐ€ `.mlmodelc`์ธ ์ปดํŒŒ์ผ๋œ Core ML ๋ฒˆ๋“ค์ด ํฌํ•จ๋˜์–ด ์žˆ๋Š”์ง€ ํ™•์ธํ•˜์‹œ๊ธฐ ๋ฐ”๋ž๋‹ˆ๋‹ค. `--compute-units`๋Š” ๋‹ค์Œ ๊ฐ’ ์ค‘ ํ•˜๋‚˜์ด์–ด์•ผ ํ•ฉ๋‹ˆ๋‹ค: `all`, `cpuOnly`, `cpuAndGPU`, `cpuAndNeuralEngine`. ์ž์„ธํ•œ ๋‚ด์šฉ์€ [Apple์˜ ๋ฆฌํฌ์ง€ํ† ๋ฆฌ ์•ˆ์˜ ์ง€์นจ](https://github.com/apple/ml-stable-diffusion)์„ ์ฐธ๊ณ ํ•˜์‹œ๊ธฐ ๋ฐ”๋ž๋‹ˆ๋‹ค. ## ์ง€์›๋˜๋Š” Diffusers ๊ธฐ๋Šฅ Core ML ๋ชจ๋ธ๊ณผ ์ถ”๋ก  ์ฝ”๋“œ๋Š” ๐Ÿงจ Diffusers์˜ ๋งŽ์€ ๊ธฐ๋Šฅ, ์˜ต์…˜ ๋ฐ ์œ ์—ฐ์„ฑ์„ ์ง€์›ํ•˜์ง€ ์•Š์Šต๋‹ˆ๋‹ค. ๋‹ค์Œ์€ ์œ ์˜ํ•ด์•ผ ํ•  ๋ช‡ ๊ฐ€์ง€ ์ œํ•œ ์‚ฌํ•ญ์ž…๋‹ˆ๋‹ค: - Core ML ๋ชจ๋ธ์€ ์ถ”๋ก ์—๋งŒ ์ ํ•ฉํ•ฉ๋‹ˆ๋‹ค. ํ•™์Šต์ด๋‚˜ ํŒŒ์ธํŠœ๋‹์—๋Š” ์‚ฌ์šฉํ•  ์ˆ˜ ์—†์Šต๋‹ˆ๋‹ค. - Swift์— ํฌํŒ…๋œ ์Šค์ผ€์ค„๋Ÿฌ๋Š” Stable Diffusion์—์„œ ์‚ฌ์šฉํ•˜๋Š” ๊ธฐ๋ณธ ์Šค์ผ€์ค„๋Ÿฌ์™€ `diffusers` ๊ตฌํ˜„์—์„œ Swift๋กœ ํฌํŒ…ํ•œ `DPMSolverMultistepScheduler` ๋‘ ๊ฐœ๋ฟ์ž…๋‹ˆ๋‹ค. ์ด๋“ค ์ค‘ ์•ฝ ์ ˆ๋ฐ˜์˜ ์Šคํ…์œผ๋กœ ๋™์ผํ•œ ํ’ˆ์งˆ์„ ์ƒ์„ฑํ•˜๋Š” `DPMSolverMultistepScheduler`๋ฅผ ์‚ฌ์šฉํ•˜๋Š” ๊ฒƒ์ด ์ข‹์Šต๋‹ˆ๋‹ค. - ์ถ”๋ก  ์ฝ”๋“œ์—์„œ ๋„ค๊ฑฐํ‹ฐ๋ธŒ ํ”„๋กฌํ”„ํŠธ, classifier-free guidance scale ๋ฐ image-to-image ์ž‘์—…์„ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. depth guidance, ControlNet, latent upscalers์™€ ๊ฐ™์€ ๊ณ ๊ธ‰ ๊ธฐ๋Šฅ์€ ์•„์ง ์‚ฌ์šฉํ•  ์ˆ˜ ์—†์Šต๋‹ˆ๋‹ค. Apple์˜ [๋ณ€ํ™˜ ๋ฐ ์ถ”๋ก  ๋ฆฌํฌ์ง€ํ† ๋ฆฌ](https://github.com/apple/ml-stable-diffusion)์™€ ์ž์ฒด [swift-coreml-diffusers](https://github.com/huggingface/swift-coreml-diffusers) ๋ฆฌํฌ์ง€ํ† ๋ฆฌ๋Š” ๋‹ค๋ฅธ ๊ฐœ๋ฐœ์ž๋“ค์ด ๊ตฌ์ถ•ํ•  ์ˆ˜ ์žˆ๋Š” ๊ธฐ์ˆ ์ ์ธ ๋ฐ๋ชจ์ž…๋‹ˆ๋‹ค. ๋ˆ„๋ฝ๋œ ๊ธฐ๋Šฅ์ด ์žˆ๋‹ค๊ณ  ์ƒ๊ฐ๋˜๋ฉด ์–ธ์ œ๋“ ์ง€ ๊ธฐ๋Šฅ์„ ์š”์ฒญํ•˜๊ฑฐ๋‚˜, ๋” ์ข‹์€ ๋ฐฉ๋ฒ•์€ ๊ธฐ์—ฌ PR์„ ์—ด์–ด์ฃผ์„ธ์š”. :) ## ๋„ค์ดํ‹ฐ๋ธŒ Diffusers Swift ์•ฑ ์ž์ฒด Apple ํ•˜๋“œ์›จ์–ด์—์„œ Stable Diffusion์„ ์‹คํ–‰ํ•˜๋Š” ์‰ฌ์šด ๋ฐฉ๋ฒ• ์ค‘ ํ•˜๋‚˜๋Š” `diffusers`์™€ Apple์˜ ๋ณ€ํ™˜ ๋ฐ ์ถ”๋ก  ๋ฆฌํฌ์ง€ํ† ๋ฆฌ๋ฅผ ๊ธฐ๋ฐ˜์œผ๋กœ ํ•˜๋Š” [์ž์ฒด ์˜คํ”ˆ ์†Œ์Šค Swift ๋ฆฌํฌ์ง€ํ† ๋ฆฌ](https://github.com/huggingface/swift-coreml-diffusers)๋ฅผ ์‚ฌ์šฉํ•˜๋Š” ๊ฒƒ์ž…๋‹ˆ๋‹ค. ์ฝ”๋“œ๋ฅผ ๊ณต๋ถ€ํ•˜๊ณ  [Xcode](https://developer.apple.com/xcode/)๋กœ ์ปดํŒŒ์ผํ•˜์—ฌ ํ•„์š”์— ๋งž๊ฒŒ ์กฐ์ •ํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ํŽธ์˜๋ฅผ ์œ„ํ•ด ์•ฑ์Šคํ† ์–ด์— [๋…๋ฆฝํ˜• Mac ์•ฑ](https://apps.apple.com/app/diffusers/id1666309574)๋„ ์žˆ์œผ๋ฏ€๋กœ ์ฝ”๋“œ๋‚˜ IDE๋ฅผ ๋‹ค๋ฃจ์ง€ ์•Š๊ณ ๋„ ์‚ฌ์šฉํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ๊ฐœ๋ฐœ์ž๋กœ์„œ Core ML์ด Stable Diffusion ์•ฑ์„ ๊ตฌ์ถ•ํ•˜๋Š” ๋ฐ ๊ฐ€์žฅ ์ ํ•ฉํ•œ ์†”๋ฃจ์…˜์ด๋ผ๊ณ  ํŒ๋‹จํ–ˆ๋‹ค๋ฉด, ์ด ๊ฐ€์ด๋“œ์˜ ๋‚˜๋จธ์ง€ ๋ถ€๋ถ„์„ ์‚ฌ์šฉํ•˜์—ฌ ํ”„๋กœ์ ํŠธ๋ฅผ ์‹œ์ž‘ํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ์—ฌ๋Ÿฌ๋ถ„์ด ๋ฌด์—‡์„ ๋นŒ๋“œํ• ์ง€ ๊ธฐ๋Œ€๋ฉ๋‹ˆ๋‹ค. :)
diffusers/docs/source/ko/optimization/coreml.md/0
{ "file_path": "diffusers/docs/source/ko/optimization/coreml.md", "repo_id": "diffusers", "token_count": 8286 }
94
# ์—ฌ๋Ÿฌ GPU๋ฅผ ์‚ฌ์šฉํ•œ ๋ถ„์‚ฐ ์ถ”๋ก  ๋ถ„์‚ฐ ์„ค์ •์—์„œ๋Š” ์—ฌ๋Ÿฌ ๊ฐœ์˜ ํ”„๋กฌํ”„ํŠธ๋ฅผ ๋™์‹œ์— ์ƒ์„ฑํ•  ๋•Œ ์œ ์šฉํ•œ ๐Ÿค— [Accelerate](https://huggingface.co/docs/accelerate/index) ๋˜๋Š” [PyTorch Distributed](https://pytorch.org/tutorials/beginner/dist_overview.html)๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ ์—ฌ๋Ÿฌ GPU์—์„œ ์ถ”๋ก ์„ ์‹คํ–‰ํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ์ด ๊ฐ€์ด๋“œ์—์„œ๋Š” ๋ถ„์‚ฐ ์ถ”๋ก ์„ ์œ„ํ•ด ๐Ÿค— Accelerate์™€ PyTorch Distributed๋ฅผ ์‚ฌ์šฉํ•˜๋Š” ๋ฐฉ๋ฒ•์„ ๋ณด์—ฌ๋“œ๋ฆฝ๋‹ˆ๋‹ค. ## ๐Ÿค— Accelerate ๐Ÿค— [Accelerate](https://huggingface.co/docs/accelerate/index)๋Š” ๋ถ„์‚ฐ ์„ค์ •์—์„œ ์ถ”๋ก ์„ ์‰ฝ๊ฒŒ ํ›ˆ๋ จํ•˜๊ฑฐ๋‚˜ ์‹คํ–‰ํ•  ์ˆ˜ ์žˆ๋„๋ก ์„ค๊ณ„๋œ ๋ผ์ด๋ธŒ๋Ÿฌ๋ฆฌ์ž…๋‹ˆ๋‹ค. ๋ถ„์‚ฐ ํ™˜๊ฒฝ ์„ค์ • ํ”„๋กœ์„ธ์Šค๋ฅผ ๊ฐ„์†Œํ™”ํ•˜์—ฌ PyTorch ์ฝ”๋“œ์— ์ง‘์ค‘ํ•  ์ˆ˜ ์žˆ๋„๋ก ํ•ด์ค๋‹ˆ๋‹ค. ์‹œ์ž‘ํ•˜๋ ค๋ฉด Python ํŒŒ์ผ์„ ์ƒ์„ฑํ•˜๊ณ  [`accelerate.PartialState`]๋ฅผ ์ดˆ๊ธฐํ™”ํ•˜์—ฌ ๋ถ„์‚ฐ ํ™˜๊ฒฝ์„ ์ƒ์„ฑํ•˜๋ฉด, ์„ค์ •์ด ์ž๋™์œผ๋กœ ๊ฐ์ง€๋˜๋ฏ€๋กœ `rank` ๋˜๋Š” `world_size`๋ฅผ ๋ช…์‹œ์ ์œผ๋กœ ์ •์˜ํ•  ํ•„์š”๊ฐ€ ์—†์Šต๋‹ˆ๋‹ค. ['DiffusionPipeline`]์„ `distributed_state.device`๋กœ ์ด๋™ํ•˜์—ฌ ๊ฐ ํ”„๋กœ์„ธ์Šค์— GPU๋ฅผ ํ• ๋‹นํ•ฉ๋‹ˆ๋‹ค. ์ด์ œ ์ปจํ…์ŠคํŠธ ๊ด€๋ฆฌ์ž๋กœ [`~accelerate.PartialState.split_between_processes`] ์œ ํ‹ธ๋ฆฌํ‹ฐ๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ ํ”„๋กœ์„ธ์Šค ์ˆ˜์— ๋”ฐ๋ผ ํ”„๋กฌํ”„ํŠธ๋ฅผ ์ž๋™์œผ๋กœ ๋ถ„๋ฐฐํ•ฉ๋‹ˆ๋‹ค. ```py from accelerate import PartialState from diffusers import DiffusionPipeline pipeline = DiffusionPipeline.from_pretrained("runwayml/stable-diffusion-v1-5", torch_dtype=torch.float16) distributed_state = PartialState() pipeline.to(distributed_state.device) with distributed_state.split_between_processes(["a dog", "a cat"]) as prompt: result = pipeline(prompt).images[0] result.save(f"result_{distributed_state.process_index}.png") ``` Use the `--num_processes` argument to specify the number of GPUs to use, and call `accelerate launch` to run the script: ```bash accelerate launch run_distributed.py --num_processes=2 ``` <Tip>์ž์„ธํ•œ ๋‚ด์šฉ์€ [๐Ÿค— Accelerate๋ฅผ ์‚ฌ์šฉํ•œ ๋ถ„์‚ฐ ์ถ”๋ก ](https://huggingface.co/docs/accelerate/en/usage_guides/distributed_inference#distributed-inference-with-accelerate) ๊ฐ€์ด๋“œ๋ฅผ ์ฐธ์กฐํ•˜์„ธ์š”. </Tip> ## Pytoerch ๋ถ„์‚ฐ PyTorch๋Š” ๋ฐ์ดํ„ฐ ๋ณ‘๋ ฌ ์ฒ˜๋ฆฌ๋ฅผ ๊ฐ€๋Šฅํ•˜๊ฒŒ ํ•˜๋Š” [`DistributedDataParallel`](https://pytorch.org/docs/stable/generated/torch.nn.parallel.DistributedDataParallel.html)์„ ์ง€์›ํ•ฉ๋‹ˆ๋‹ค. ์‹œ์ž‘ํ•˜๋ ค๋ฉด Python ํŒŒ์ผ์„ ์ƒ์„ฑํ•˜๊ณ  `torch.distributed` ๋ฐ `torch.multiprocessing`์„ ์ž„ํฌํŠธํ•˜์—ฌ ๋ถ„์‚ฐ ํ”„๋กœ์„ธ์Šค ๊ทธ๋ฃน์„ ์„ค์ •ํ•˜๊ณ  ๊ฐ GPU์—์„œ ์ถ”๋ก ์šฉ ํ”„๋กœ์„ธ์Šค๋ฅผ ์ƒ์„ฑํ•ฉ๋‹ˆ๋‹ค. ๊ทธ๋ฆฌ๊ณ  [`DiffusionPipeline`]๋„ ์ดˆ๊ธฐํ™”ํ•ด์•ผ ํ•ฉ๋‹ˆ๋‹ค: ํ™•์‚ฐ ํŒŒ์ดํ”„๋ผ์ธ์„ `rank`๋กœ ์ด๋™ํ•˜๊ณ  `get_rank`๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ ๊ฐ ํ”„๋กœ์„ธ์Šค์— GPU๋ฅผ ํ• ๋‹นํ•˜๋ฉด ๊ฐ ํ”„๋กœ์„ธ์Šค๊ฐ€ ๋‹ค๋ฅธ ํ”„๋กฌํ”„ํŠธ๋ฅผ ์ฒ˜๋ฆฌํ•ฉ๋‹ˆ๋‹ค: ```py import torch import torch.distributed as dist import torch.multiprocessing as mp from diffusers import DiffusionPipeline sd = DiffusionPipeline.from_pretrained("runwayml/stable-diffusion-v1-5", torch_dtype=torch.float16) ``` ์‚ฌ์šฉํ•  ๋ฐฑ์—”๋“œ ์œ ํ˜•, ํ˜„์žฌ ํ”„๋กœ์„ธ์Šค์˜ `rank`, `world_size` ๋˜๋Š” ์ฐธ์—ฌํ•˜๋Š” ํ”„๋กœ์„ธ์Šค ์ˆ˜๋กœ ๋ถ„์‚ฐ ํ™˜๊ฒฝ ์ƒ์„ฑ์„ ์ฒ˜๋ฆฌํ•˜๋Š” ํ•จ์ˆ˜[`init_process_group`]๋ฅผ ๋งŒ๋“ค์–ด ์ถ”๋ก ์„ ์‹คํ–‰ํ•ด์•ผ ํ•ฉ๋‹ˆ๋‹ค. 2๊ฐœ์˜ GPU์—์„œ ์ถ”๋ก ์„ ๋ณ‘๋ ฌ๋กœ ์‹คํ–‰ํ•˜๋Š” ๊ฒฝ์šฐ `world_size`๋Š” 2์ž…๋‹ˆ๋‹ค. ```py def run_inference(rank, world_size): dist.init_process_group("nccl", rank=rank, world_size=world_size) sd.to(rank) if torch.distributed.get_rank() == 0: prompt = "a dog" elif torch.distributed.get_rank() == 1: prompt = "a cat" image = sd(prompt).images[0] image.save(f"./{'_'.join(prompt)}.png") ``` ๋ถ„์‚ฐ ์ถ”๋ก ์„ ์‹คํ–‰ํ•˜๋ ค๋ฉด [`mp.spawn`](https://pytorch.org/docs/stable/multiprocessing.html#torch.multiprocessing.spawn)์„ ํ˜ธ์ถœํ•˜์—ฌ `world_size`์— ์ •์˜๋œ GPU ์ˆ˜์— ๋Œ€ํ•ด `run_inference` ํ•จ์ˆ˜๋ฅผ ์‹คํ–‰ํ•ฉ๋‹ˆ๋‹ค: ```py def main(): world_size = 2 mp.spawn(run_inference, args=(world_size,), nprocs=world_size, join=True) if __name__ == "__main__": main() ``` ์ถ”๋ก  ์Šคํฌ๋ฆฝํŠธ๋ฅผ ์™„๋ฃŒํ–ˆ์œผ๋ฉด `--nproc_per_node` ์ธ์ˆ˜๋ฅผ ์‚ฌ์šฉํ•˜์—ฌ ์‚ฌ์šฉํ•  GPU ์ˆ˜๋ฅผ ์ง€์ •ํ•˜๊ณ  `torchrun`์„ ํ˜ธ์ถœํ•˜์—ฌ ์Šคํฌ๋ฆฝํŠธ๋ฅผ ์‹คํ–‰ํ•ฉ๋‹ˆ๋‹ค: ```bash torchrun run_distributed.py --nproc_per_node=2 ```
diffusers/docs/source/ko/training/distributed_inference.md/0
{ "file_path": "diffusers/docs/source/ko/training/distributed_inference.md", "repo_id": "diffusers", "token_count": 2604 }
95
<!--Copyright 2023 The HuggingFace Team. All rights reserved. Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License. --> # Text-guided depth-to-image ์ƒ์„ฑ [[open-in-colab]] [`StableDiffusionDepth2ImgPipeline`]์„ ์‚ฌ์šฉํ•˜๋ฉด ํ…์ŠคํŠธ ํ”„๋กฌํ”„ํŠธ์™€ ์ดˆ๊ธฐ ์ด๋ฏธ์ง€๋ฅผ ์ „๋‹ฌํ•˜์—ฌ ์ƒˆ ์ด๋ฏธ์ง€์˜ ์ƒ์„ฑ์„ ์กฐ์ ˆํ•  ์ˆ˜ ์žˆ์Šต๋‹ˆ๋‹ค. ๋˜ํ•œ ์ด๋ฏธ์ง€ ๊ตฌ์กฐ๋ฅผ ๋ณด์กดํ•˜๊ธฐ ์œ„ํ•ด `depth_map`์„ ์ „๋‹ฌํ•  ์ˆ˜๋„ ์žˆ์Šต๋‹ˆ๋‹ค. `depth_map`์ด ์ œ๊ณต๋˜์ง€ ์•Š์œผ๋ฉด ํŒŒ์ดํ”„๋ผ์ธ์€ ํ†ตํ•ฉ๋œ [depth-estimation model](https://github.com/isl-org/MiDaS)์„ ํ†ตํ•ด ์ž๋™์œผ๋กœ ๊นŠ์ด๋ฅผ ์˜ˆ์ธกํ•ฉ๋‹ˆ๋‹ค. ๋จผ์ € [`StableDiffusionDepth2ImgPipeline`]์˜ ์ธ์Šคํ„ด์Šค๋ฅผ ์ƒ์„ฑํ•ฉ๋‹ˆ๋‹ค: ```python import torch import requests from PIL import Image from diffusers import StableDiffusionDepth2ImgPipeline pipe = StableDiffusionDepth2ImgPipeline.from_pretrained( "stabilityai/stable-diffusion-2-depth", torch_dtype=torch.float16, ).to("cuda") ``` ์ด์ œ ํ”„๋กฌํ”„ํŠธ๋ฅผ ํŒŒ์ดํ”„๋ผ์ธ์— ์ „๋‹ฌํ•ฉ๋‹ˆ๋‹ค. ํŠน์ • ๋‹จ์–ด๊ฐ€ ์ด๋ฏธ์ง€ ์ƒ์„ฑ์„ ๊ฐ€์ด๋“œ ํ•˜๋Š”๊ฒƒ์„ ๋ฐฉ์ง€ํ•˜๊ธฐ ์œ„ํ•ด `negative_prompt`๋ฅผ ์ „๋‹ฌํ•  ์ˆ˜๋„ ์žˆ์Šต๋‹ˆ๋‹ค: ```python url = "http://images.cocodataset.org/val2017/000000039769.jpg" init_image = Image.open(requests.get(url, stream=True).raw) prompt = "two tigers" n_prompt = "bad, deformed, ugly, bad anatomy" image = pipe(prompt=prompt, image=init_image, negative_prompt=n_prompt, strength=0.7).images[0] image ``` | Input | Output | |---------------------------------------------------------------------------------|---------------------------------------------------------------------------------------------------------------------------------------| | <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/diffusers/coco-cats.png" width="500"/> | <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/diffusers/depth2img-tigers.png" width="500"/> | ์•„๋ž˜์˜ Spaces๋ฅผ ๊ฐ€์ง€๊ณ  ๋†€๋ฉฐ depth map์ด ์žˆ๋Š” ์ด๋ฏธ์ง€์™€ ์—†๋Š” ์ด๋ฏธ์ง€์˜ ์ฐจ์ด๊ฐ€ ์žˆ๋Š”์ง€ ํ™•์ธํ•ด ๋ณด์„ธ์š”! <iframe src="https://radames-stable-diffusion-depth2img.hf.space" frameborder="0" width="850" height="500" ></iframe>
diffusers/docs/source/ko/using-diffusers/depth2img.md/0
{ "file_path": "diffusers/docs/source/ko/using-diffusers/depth2img.md", "repo_id": "diffusers", "token_count": 1377 }
96
- sections: - local: index title: ๐Ÿงจ Diffusers - local: quicktour title: Tour rรกpido - local: installation title: Instalaรงรฃo title: Primeiros passos
diffusers/docs/source/pt/_toctree.yml/0
{ "file_path": "diffusers/docs/source/pt/_toctree.yml", "repo_id": "diffusers", "token_count": 77 }
97
import glob import os from typing import Dict, List, Union import safetensors.torch import torch from huggingface_hub import snapshot_download from huggingface_hub.utils import validate_hf_hub_args from diffusers import DiffusionPipeline, __version__ from diffusers.schedulers.scheduling_utils import SCHEDULER_CONFIG_NAME from diffusers.utils import CONFIG_NAME, ONNX_WEIGHTS_NAME, WEIGHTS_NAME class CheckpointMergerPipeline(DiffusionPipeline): """ A class that supports merging diffusion models based on the discussion here: https://github.com/huggingface/diffusers/issues/877 Example usage:- pipe = DiffusionPipeline.from_pretrained("CompVis/stable-diffusion-v1-4", custom_pipeline="checkpoint_merger.py") merged_pipe = pipe.merge(["CompVis/stable-diffusion-v1-4","prompthero/openjourney"], interp = 'inv_sigmoid', alpha = 0.8, force = True) merged_pipe.to('cuda') prompt = "An astronaut riding a unicycle on Mars" results = merged_pipe(prompt) ## For more details, see the docstring for the merge method. """ def __init__(self): self.register_to_config() super().__init__() def _compare_model_configs(self, dict0, dict1): if dict0 == dict1: return True else: config0, meta_keys0 = self._remove_meta_keys(dict0) config1, meta_keys1 = self._remove_meta_keys(dict1) if config0 == config1: print(f"Warning !: Mismatch in keys {meta_keys0} and {meta_keys1}.") return True return False def _remove_meta_keys(self, config_dict: Dict): meta_keys = [] temp_dict = config_dict.copy() for key in config_dict.keys(): if key.startswith("_"): temp_dict.pop(key) meta_keys.append(key) return (temp_dict, meta_keys) @torch.no_grad() @validate_hf_hub_args def merge(self, pretrained_model_name_or_path_list: List[Union[str, os.PathLike]], **kwargs): """ Returns a new pipeline object of the class 'DiffusionPipeline' with the merged checkpoints(weights) of the models passed in the argument 'pretrained_model_name_or_path_list' as a list. Parameters: ----------- pretrained_model_name_or_path_list : A list of valid pretrained model names in the HuggingFace hub or paths to locally stored models in the HuggingFace format. **kwargs: Supports all the default DiffusionPipeline.get_config_dict kwargs viz.. cache_dir, resume_download, force_download, proxies, local_files_only, token, revision, torch_dtype, device_map. alpha - The interpolation parameter. Ranges from 0 to 1. It affects the ratio in which the checkpoints are merged. A 0.8 alpha would mean that the first model checkpoints would affect the final result far less than an alpha of 0.2 interp - The interpolation method to use for the merging. Supports "sigmoid", "inv_sigmoid", "add_diff" and None. Passing None uses the default interpolation which is weighted sum interpolation. For merging three checkpoints, only "add_diff" is supported. force - Whether to ignore mismatch in model_config.json for the current models. Defaults to False. """ # Default kwargs from DiffusionPipeline cache_dir = kwargs.pop("cache_dir", None) resume_download = kwargs.pop("resume_download", False) force_download = kwargs.pop("force_download", False) proxies = kwargs.pop("proxies", None) local_files_only = kwargs.pop("local_files_only", False) token = kwargs.pop("token", None) revision = kwargs.pop("revision", None) torch_dtype = kwargs.pop("torch_dtype", None) device_map = kwargs.pop("device_map", None) alpha = kwargs.pop("alpha", 0.5) interp = kwargs.pop("interp", None) print("Received list", pretrained_model_name_or_path_list) print(f"Combining with alpha={alpha}, interpolation mode={interp}") checkpoint_count = len(pretrained_model_name_or_path_list) # Ignore result from model_index_json comparision of the two checkpoints force = kwargs.pop("force", False) # If less than 2 checkpoints, nothing to merge. If more than 3, not supported for now. if checkpoint_count > 3 or checkpoint_count < 2: raise ValueError( "Received incorrect number of checkpoints to merge. Ensure that either 2 or 3 checkpoints are being" " passed." ) print("Received the right number of checkpoints") # chkpt0, chkpt1 = pretrained_model_name_or_path_list[0:2] # chkpt2 = pretrained_model_name_or_path_list[2] if checkpoint_count == 3 else None # Validate that the checkpoints can be merged # Step 1: Load the model config and compare the checkpoints. We'll compare the model_index.json first while ignoring the keys starting with '_' config_dicts = [] for pretrained_model_name_or_path in pretrained_model_name_or_path_list: config_dict = DiffusionPipeline.load_config( pretrained_model_name_or_path, cache_dir=cache_dir, resume_download=resume_download, force_download=force_download, proxies=proxies, local_files_only=local_files_only, token=token, revision=revision, ) config_dicts.append(config_dict) comparison_result = True for idx in range(1, len(config_dicts)): comparison_result &= self._compare_model_configs(config_dicts[idx - 1], config_dicts[idx]) if not force and comparison_result is False: raise ValueError("Incompatible checkpoints. Please check model_index.json for the models.") print(config_dicts[0], config_dicts[1]) print("Compatible model_index.json files found") # Step 2: Basic Validation has succeeded. Let's download the models and save them into our local files. cached_folders = [] for pretrained_model_name_or_path, config_dict in zip(pretrained_model_name_or_path_list, config_dicts): folder_names = [k for k in config_dict.keys() if not k.startswith("_")] allow_patterns = [os.path.join(k, "*") for k in folder_names] allow_patterns += [ WEIGHTS_NAME, SCHEDULER_CONFIG_NAME, CONFIG_NAME, ONNX_WEIGHTS_NAME, DiffusionPipeline.config_name, ] requested_pipeline_class = config_dict.get("_class_name") user_agent = {"diffusers": __version__, "pipeline_class": requested_pipeline_class} cached_folder = ( pretrained_model_name_or_path if os.path.isdir(pretrained_model_name_or_path) else snapshot_download( pretrained_model_name_or_path, cache_dir=cache_dir, resume_download=resume_download, proxies=proxies, local_files_only=local_files_only, token=token, revision=revision, allow_patterns=allow_patterns, user_agent=user_agent, ) ) print("Cached Folder", cached_folder) cached_folders.append(cached_folder) # Step 3:- # Load the first checkpoint as a diffusion pipeline and modify its module state_dict in place final_pipe = DiffusionPipeline.from_pretrained( cached_folders[0], torch_dtype=torch_dtype, device_map=device_map ) final_pipe.to(self.device) checkpoint_path_2 = None if len(cached_folders) > 2: checkpoint_path_2 = os.path.join(cached_folders[2]) if interp == "sigmoid": theta_func = CheckpointMergerPipeline.sigmoid elif interp == "inv_sigmoid": theta_func = CheckpointMergerPipeline.inv_sigmoid elif interp == "add_diff": theta_func = CheckpointMergerPipeline.add_difference else: theta_func = CheckpointMergerPipeline.weighted_sum # Find each module's state dict. for attr in final_pipe.config.keys(): if not attr.startswith("_"): checkpoint_path_1 = os.path.join(cached_folders[1], attr) if os.path.exists(checkpoint_path_1): files = [ *glob.glob(os.path.join(checkpoint_path_1, "*.safetensors")), *glob.glob(os.path.join(checkpoint_path_1, "*.bin")), ] checkpoint_path_1 = files[0] if len(files) > 0 else None if len(cached_folders) < 3: checkpoint_path_2 = None else: checkpoint_path_2 = os.path.join(cached_folders[2], attr) if os.path.exists(checkpoint_path_2): files = [ *glob.glob(os.path.join(checkpoint_path_2, "*.safetensors")), *glob.glob(os.path.join(checkpoint_path_2, "*.bin")), ] checkpoint_path_2 = files[0] if len(files) > 0 else None # For an attr if both checkpoint_path_1 and 2 are None, ignore. # If atleast one is present, deal with it according to interp method, of course only if the state_dict keys match. if checkpoint_path_1 is None and checkpoint_path_2 is None: print(f"Skipping {attr}: not present in 2nd or 3d model") continue try: module = getattr(final_pipe, attr) if isinstance(module, bool): # ignore requires_safety_checker boolean continue theta_0 = getattr(module, "state_dict") theta_0 = theta_0() update_theta_0 = getattr(module, "load_state_dict") theta_1 = ( safetensors.torch.load_file(checkpoint_path_1) if (checkpoint_path_1.endswith(".safetensors")) else torch.load(checkpoint_path_1, map_location="cpu") ) theta_2 = None if checkpoint_path_2: theta_2 = ( safetensors.torch.load_file(checkpoint_path_2) if (checkpoint_path_2.endswith(".safetensors")) else torch.load(checkpoint_path_2, map_location="cpu") ) if not theta_0.keys() == theta_1.keys(): print(f"Skipping {attr}: key mismatch") continue if theta_2 and not theta_1.keys() == theta_2.keys(): print(f"Skipping {attr}:y mismatch") except Exception as e: print(f"Skipping {attr} do to an unexpected error: {str(e)}") continue print(f"MERGING {attr}") for key in theta_0.keys(): if theta_2: theta_0[key] = theta_func(theta_0[key], theta_1[key], theta_2[key], alpha) else: theta_0[key] = theta_func(theta_0[key], theta_1[key], None, alpha) del theta_1 del theta_2 update_theta_0(theta_0) del theta_0 return final_pipe @staticmethod def weighted_sum(theta0, theta1, theta2, alpha): return ((1 - alpha) * theta0) + (alpha * theta1) # Smoothstep (https://en.wikipedia.org/wiki/Smoothstep) @staticmethod def sigmoid(theta0, theta1, theta2, alpha): alpha = alpha * alpha * (3 - (2 * alpha)) return theta0 + ((theta1 - theta0) * alpha) # Inverse Smoothstep (https://en.wikipedia.org/wiki/Smoothstep) @staticmethod def inv_sigmoid(theta0, theta1, theta2, alpha): import math alpha = 0.5 - math.sin(math.asin(1.0 - 2.0 * alpha) / 3.0) return theta0 + ((theta1 - theta0) * alpha) @staticmethod def add_difference(theta0, theta1, theta2, alpha): return theta0 + (theta1 - theta2) * (1.0 - alpha)
diffusers/examples/community/checkpoint_merger.py/0
{ "file_path": "diffusers/examples/community/checkpoint_merger.py", "repo_id": "diffusers", "token_count": 6070 }
98
import inspect from typing import Any, Callable, Dict, List, Optional, Union import numpy as np import torch from transformers import CLIPImageProcessor, CLIPTextModel, CLIPTokenizer from diffusers.image_processor import VaeImageProcessor from diffusers.loaders import FromSingleFileMixin, LoraLoaderMixin, TextualInversionLoaderMixin from diffusers.models import AutoencoderKL, UNet2DConditionModel from diffusers.models.lora import adjust_lora_scale_text_encoder from diffusers.pipelines.pipeline_utils import DiffusionPipeline from diffusers.pipelines.stable_diffusion import StableDiffusionPipelineOutput, StableDiffusionSafetyChecker from diffusers.schedulers import LCMScheduler from diffusers.utils import ( USE_PEFT_BACKEND, deprecate, logging, replace_example_docstring, scale_lora_layers, unscale_lora_layers, ) from diffusers.utils.torch_utils import randn_tensor logger = logging.get_logger(__name__) # pylint: disable=invalid-name EXAMPLE_DOC_STRING = """ Examples: ```py >>> import torch >>> import numpy as np >>> from diffusers import DiffusionPipeline >>> pipe = DiffusionPipeline.from_pretrained("SimianLuo/LCM_Dreamshaper_v7", custom_pipeline="latent_consistency_interpolate") >>> # To save GPU memory, torch.float16 can be used, but it may compromise image quality. >>> pipe.to(torch_device="cuda", torch_dtype=torch.float32) >>> prompts = ["A cat", "A dog", "A horse"] >>> num_inference_steps = 4 >>> num_interpolation_steps = 24 >>> seed = 1337 >>> torch.manual_seed(seed) >>> np.random.seed(seed) >>> images = pipe( prompt=prompts, height=512, width=512, num_inference_steps=num_inference_steps, num_interpolation_steps=num_interpolation_steps, guidance_scale=8.0, embedding_interpolation_type="lerp", latent_interpolation_type="slerp", process_batch_size=4, # Make it higher or lower based on your GPU memory generator=torch.Generator(seed), ) >>> # Save the images as a video >>> import imageio >>> from PIL import Image >>> def pil_to_video(images: List[Image.Image], filename: str, fps: int = 60) -> None: frames = [np.array(image) for image in images] with imageio.get_writer(filename, fps=fps) as video_writer: for frame in frames: video_writer.append_data(frame) >>> pil_to_video(images, "lcm_interpolate.mp4", fps=24) ``` """ def lerp( v0: Union[torch.Tensor, np.ndarray], v1: Union[torch.Tensor, np.ndarray], t: Union[float, torch.Tensor, np.ndarray], ) -> Union[torch.Tensor, np.ndarray]: """ Linearly interpolate between two vectors/tensors. Args: v0 (`torch.Tensor` or `np.ndarray`): First vector/tensor. v1 (`torch.Tensor` or `np.ndarray`): Second vector/tensor. t: (`float`, `torch.Tensor`, or `np.ndarray`): Interpolation factor. If float, must be between 0 and 1. If np.ndarray or torch.Tensor, must be one dimensional with values between 0 and 1. Returns: Union[torch.Tensor, np.ndarray] Interpolated vector/tensor between v0 and v1. """ inputs_are_torch = False t_is_float = False if isinstance(v0, torch.Tensor): inputs_are_torch = True input_device = v0.device v0 = v0.cpu().numpy() v1 = v1.cpu().numpy() if isinstance(t, torch.Tensor): inputs_are_torch = True input_device = t.device t = t.cpu().numpy() elif isinstance(t, float): t_is_float = True t = np.array([t]) t = t[..., None] v0 = v0[None, ...] v1 = v1[None, ...] v2 = (1 - t) * v0 + t * v1 if t_is_float and v0.ndim > 1: assert v2.shape[0] == 1 v2 = np.squeeze(v2, axis=0) if inputs_are_torch: v2 = torch.from_numpy(v2).to(input_device) return v2 def slerp( v0: Union[torch.Tensor, np.ndarray], v1: Union[torch.Tensor, np.ndarray], t: Union[float, torch.Tensor, np.ndarray], DOT_THRESHOLD=0.9995, ) -> Union[torch.Tensor, np.ndarray]: """ Spherical linear interpolation between two vectors/tensors. Args: v0 (`torch.Tensor` or `np.ndarray`): First vector/tensor. v1 (`torch.Tensor` or `np.ndarray`): Second vector/tensor. t: (`float`, `torch.Tensor`, or `np.ndarray`): Interpolation factor. If float, must be between 0 and 1. If np.ndarray or torch.Tensor, must be one dimensional with values between 0 and 1. DOT_THRESHOLD (`float`, *optional*, default=0.9995): Threshold for when to use linear interpolation instead of spherical interpolation. Returns: `torch.Tensor` or `np.ndarray`: Interpolated vector/tensor between v0 and v1. """ inputs_are_torch = False t_is_float = False if isinstance(v0, torch.Tensor): inputs_are_torch = True input_device = v0.device v0 = v0.cpu().numpy() v1 = v1.cpu().numpy() if isinstance(t, torch.Tensor): inputs_are_torch = True input_device = t.device t = t.cpu().numpy() elif isinstance(t, float): t_is_float = True t = np.array([t], dtype=v0.dtype) dot = np.sum(v0 * v1 / (np.linalg.norm(v0) * np.linalg.norm(v1))) if np.abs(dot) > DOT_THRESHOLD: # v1 and v2 are close to parallel # Use linear interpolation instead v2 = lerp(v0, v1, t) else: theta_0 = np.arccos(dot) sin_theta_0 = np.sin(theta_0) theta_t = theta_0 * t sin_theta_t = np.sin(theta_t) s0 = np.sin(theta_0 - theta_t) / sin_theta_0 s1 = sin_theta_t / sin_theta_0 s0 = s0[..., None] s1 = s1[..., None] v0 = v0[None, ...] v1 = v1[None, ...] v2 = s0 * v0 + s1 * v1 if t_is_float and v0.ndim > 1: assert v2.shape[0] == 1 v2 = np.squeeze(v2, axis=0) if inputs_are_torch: v2 = torch.from_numpy(v2).to(input_device) return v2 class LatentConsistencyModelWalkPipeline( DiffusionPipeline, TextualInversionLoaderMixin, LoraLoaderMixin, FromSingleFileMixin ): r""" Pipeline for text-to-image generation using a latent consistency model. This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods implemented for all pipelines (downloading, saving, running on a particular device, etc.). The pipeline also inherits the following loading methods: - [`~loaders.TextualInversionLoaderMixin.load_textual_inversion`] for loading textual inversion embeddings - [`~loaders.LoraLoaderMixin.load_lora_weights`] for loading LoRA weights - [`~loaders.LoraLoaderMixin.save_lora_weights`] for saving LoRA weights - [`~loaders.FromSingleFileMixin.from_single_file`] for loading `.ckpt` files Args: vae ([`AutoencoderKL`]): Variational Auto-Encoder (VAE) model to encode and decode images to and from latent representations. text_encoder ([`~transformers.CLIPTextModel`]): Frozen text-encoder ([clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14)). tokenizer ([`~transformers.CLIPTokenizer`]): A `CLIPTokenizer` to tokenize text. unet ([`UNet2DConditionModel`]): A `UNet2DConditionModel` to denoise the encoded image latents. scheduler ([`SchedulerMixin`]): A scheduler to be used in combination with `unet` to denoise the encoded image latents. Currently only supports [`LCMScheduler`]. safety_checker ([`StableDiffusionSafetyChecker`]): Classification module that estimates whether generated images could be considered offensive or harmful. Please refer to the [model card](https://huggingface.co/runwayml/stable-diffusion-v1-5) for more details about a model's potential harms. feature_extractor ([`~transformers.CLIPImageProcessor`]): A `CLIPImageProcessor` to extract features from generated images; used as inputs to the `safety_checker`. requires_safety_checker (`bool`, *optional*, defaults to `True`): Whether the pipeline requires a safety checker component. """ model_cpu_offload_seq = "text_encoder->unet->vae" _optional_components = ["safety_checker", "feature_extractor"] _exclude_from_cpu_offload = ["safety_checker"] _callback_tensor_inputs = ["latents", "denoised", "prompt_embeds", "w_embedding"] def __init__( self, vae: AutoencoderKL, text_encoder: CLIPTextModel, tokenizer: CLIPTokenizer, unet: UNet2DConditionModel, scheduler: LCMScheduler, safety_checker: StableDiffusionSafetyChecker, feature_extractor: CLIPImageProcessor, requires_safety_checker: bool = True, ): super().__init__() if safety_checker is None and requires_safety_checker: logger.warning( f"You have disabled the safety checker for {self.__class__} by passing `safety_checker=None`. Ensure" " that you abide to the conditions of the Stable Diffusion license and do not expose unfiltered" " results in services or applications open to the public. Both the diffusers team and Hugging Face" " strongly recommend to keep the safety filter enabled in all public facing circumstances, disabling" " it only for use-cases that involve analyzing network behavior or auditing its results. For more" " information, please have a look at https://github.com/huggingface/diffusers/pull/254 ." ) if safety_checker is not None and feature_extractor is None: raise ValueError( "Make sure to define a feature extractor when loading {self.__class__} if you want to use the safety" " checker. If you do not want to use the safety checker, you can pass `'safety_checker=None'` instead." ) self.register_modules( vae=vae, text_encoder=text_encoder, tokenizer=tokenizer, unet=unet, scheduler=scheduler, safety_checker=safety_checker, feature_extractor=feature_extractor, ) self.vae_scale_factor = 2 ** (len(self.vae.config.block_out_channels) - 1) self.image_processor = VaeImageProcessor(vae_scale_factor=self.vae_scale_factor) self.register_to_config(requires_safety_checker=requires_safety_checker) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_vae_slicing def enable_vae_slicing(self): r""" Enable sliced VAE decoding. When this option is enabled, the VAE will split the input tensor in slices to compute decoding in several steps. This is useful to save some memory and allow larger batch sizes. """ self.vae.enable_slicing() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_vae_slicing def disable_vae_slicing(self): r""" Disable sliced VAE decoding. If `enable_vae_slicing` was previously enabled, this method will go back to computing decoding in one step. """ self.vae.disable_slicing() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_vae_tiling def enable_vae_tiling(self): r""" Enable tiled VAE decoding. When this option is enabled, the VAE will split the input tensor into tiles to compute decoding and encoding in several steps. This is useful for saving a large amount of memory and to allow processing larger images. """ self.vae.enable_tiling() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_vae_tiling def disable_vae_tiling(self): r""" Disable tiled VAE decoding. If `enable_vae_tiling` was previously enabled, this method will go back to computing decoding in one step. """ self.vae.disable_tiling() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_freeu def enable_freeu(self, s1: float, s2: float, b1: float, b2: float): r"""Enables the FreeU mechanism as in https://arxiv.org/abs/2309.11497. The suffixes after the scaling factors represent the stages where they are being applied. Please refer to the [official repository](https://github.com/ChenyangSi/FreeU) for combinations of the values that are known to work well for different pipelines such as Stable Diffusion v1, v2, and Stable Diffusion XL. Args: s1 (`float`): Scaling factor for stage 1 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. s2 (`float`): Scaling factor for stage 2 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. b1 (`float`): Scaling factor for stage 1 to amplify the contributions of backbone features. b2 (`float`): Scaling factor for stage 2 to amplify the contributions of backbone features. """ if not hasattr(self, "unet"): raise ValueError("The pipeline must have `unet` for using FreeU.") self.unet.enable_freeu(s1=s1, s2=s2, b1=b1, b2=b2) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_freeu def disable_freeu(self): """Disables the FreeU mechanism if enabled.""" self.unet.disable_freeu() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.encode_prompt def encode_prompt( self, prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt=None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, clip_skip: Optional[int] = None, ): r""" Encodes the prompt into text encoder hidden states. Args: prompt (`str` or `List[str]`, *optional*): prompt to be encoded device: (`torch.device`): torch device num_images_per_prompt (`int`): number of images that should be generated per prompt do_classifier_free_guidance (`bool`): whether to use classifier free guidance or not negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. lora_scale (`float`, *optional*): A LoRA scale that will be applied to all LoRA layers of the text encoder if LoRA layers are loaded. clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. """ # set lora scale so that monkey patched LoRA # function of text encoder can correctly access it if lora_scale is not None and isinstance(self, LoraLoaderMixin): self._lora_scale = lora_scale # dynamically adjust the LoRA scale if not USE_PEFT_BACKEND: adjust_lora_scale_text_encoder(self.text_encoder, lora_scale) else: scale_lora_layers(self.text_encoder, lora_scale) if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if prompt_embeds is None: # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): prompt = self.maybe_convert_prompt(prompt, self.tokenizer) text_inputs = self.tokenizer( prompt, padding="max_length", max_length=self.tokenizer.model_max_length, truncation=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = self.tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal( text_input_ids, untruncated_ids ): removed_text = self.tokenizer.batch_decode( untruncated_ids[:, self.tokenizer.model_max_length - 1 : -1] ) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {self.tokenizer.model_max_length} tokens: {removed_text}" ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = text_inputs.attention_mask.to(device) else: attention_mask = None if clip_skip is None: prompt_embeds = self.text_encoder(text_input_ids.to(device), attention_mask=attention_mask) prompt_embeds = prompt_embeds[0] else: prompt_embeds = self.text_encoder( text_input_ids.to(device), attention_mask=attention_mask, output_hidden_states=True ) # Access the `hidden_states` first, that contains a tuple of # all the hidden states from the encoder layers. Then index into # the tuple to access the hidden states from the desired layer. prompt_embeds = prompt_embeds[-1][-(clip_skip + 1)] # We also need to apply the final LayerNorm here to not mess with the # representations. The `last_hidden_states` that we typically use for # obtaining the final prompt representations passes through the LayerNorm # layer. prompt_embeds = self.text_encoder.text_model.final_layer_norm(prompt_embeds) if self.text_encoder is not None: prompt_embeds_dtype = self.text_encoder.dtype elif self.unet is not None: prompt_embeds_dtype = self.unet.dtype else: prompt_embeds_dtype = prompt_embeds.dtype prompt_embeds = prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) bs_embed, seq_len, _ = prompt_embeds.shape # duplicate text embeddings for each generation per prompt, using mps friendly method prompt_embeds = prompt_embeds.repeat(1, num_images_per_prompt, 1) prompt_embeds = prompt_embeds.view(bs_embed * num_images_per_prompt, seq_len, -1) # get unconditional embeddings for classifier free guidance if do_classifier_free_guidance and negative_prompt_embeds is None: uncond_tokens: List[str] if negative_prompt is None: uncond_tokens = [""] * batch_size elif prompt is not None and type(prompt) is not type(negative_prompt): raise TypeError( f"`negative_prompt` should be the same type to `prompt`, but got {type(negative_prompt)} !=" f" {type(prompt)}." ) elif isinstance(negative_prompt, str): uncond_tokens = [negative_prompt] elif batch_size != len(negative_prompt): raise ValueError( f"`negative_prompt`: {negative_prompt} has batch size {len(negative_prompt)}, but `prompt`:" f" {prompt} has batch size {batch_size}. Please make sure that passed `negative_prompt` matches" " the batch size of `prompt`." ) else: uncond_tokens = negative_prompt # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): uncond_tokens = self.maybe_convert_prompt(uncond_tokens, self.tokenizer) max_length = prompt_embeds.shape[1] uncond_input = self.tokenizer( uncond_tokens, padding="max_length", max_length=max_length, truncation=True, return_tensors="pt", ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = uncond_input.attention_mask.to(device) else: attention_mask = None negative_prompt_embeds = self.text_encoder( uncond_input.input_ids.to(device), attention_mask=attention_mask, ) negative_prompt_embeds = negative_prompt_embeds[0] if do_classifier_free_guidance: # duplicate unconditional embeddings for each generation per prompt, using mps friendly method seq_len = negative_prompt_embeds.shape[1] negative_prompt_embeds = negative_prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) negative_prompt_embeds = negative_prompt_embeds.repeat(1, num_images_per_prompt, 1) negative_prompt_embeds = negative_prompt_embeds.view(batch_size * num_images_per_prompt, seq_len, -1) if isinstance(self, LoraLoaderMixin) and USE_PEFT_BACKEND: # Retrieve the original scale by scaling back the LoRA layers unscale_lora_layers(self.text_encoder, lora_scale) return prompt_embeds, negative_prompt_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.run_safety_checker def run_safety_checker(self, image, device, dtype): if self.safety_checker is None: has_nsfw_concept = None else: if torch.is_tensor(image): feature_extractor_input = self.image_processor.postprocess(image, output_type="pil") else: feature_extractor_input = self.image_processor.numpy_to_pil(image) safety_checker_input = self.feature_extractor(feature_extractor_input, return_tensors="pt").to(device) image, has_nsfw_concept = self.safety_checker( images=image, clip_input=safety_checker_input.pixel_values.to(dtype) ) return image, has_nsfw_concept # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_latents def prepare_latents(self, batch_size, num_channels_latents, height, width, dtype, device, generator, latents=None): shape = (batch_size, num_channels_latents, height // self.vae_scale_factor, width // self.vae_scale_factor) if isinstance(generator, list) and len(generator) != batch_size: raise ValueError( f"You have passed a list of generators of length {len(generator)}, but requested an effective batch" f" size of {batch_size}. Make sure the batch size matches the length of the generators." ) if latents is None: latents = randn_tensor(shape, generator=generator, device=device, dtype=dtype) else: latents = latents.to(device) # scale the initial noise by the standard deviation required by the scheduler latents = latents * self.scheduler.init_noise_sigma return latents def get_guidance_scale_embedding(self, w, embedding_dim=512, dtype=torch.float32): """ See https://github.com/google-research/vdm/blob/dc27b98a554f65cdc654b800da5aa1846545d41b/model_vdm.py#L298 Args: timesteps (`torch.Tensor`): generate embedding vectors at these timesteps embedding_dim (`int`, *optional*, defaults to 512): dimension of the embeddings to generate dtype: data type of the generated embeddings Returns: `torch.FloatTensor`: Embedding vectors with shape `(len(timesteps), embedding_dim)` """ assert len(w.shape) == 1 w = w * 1000.0 half_dim = embedding_dim // 2 emb = torch.log(torch.tensor(10000.0)) / (half_dim - 1) emb = torch.exp(torch.arange(half_dim, dtype=dtype) * -emb) emb = w.to(dtype)[:, None] * emb[None, :] emb = torch.cat([torch.sin(emb), torch.cos(emb)], dim=1) if embedding_dim % 2 == 1: # zero pad emb = torch.nn.functional.pad(emb, (0, 1)) assert emb.shape == (w.shape[0], embedding_dim) return emb # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_extra_step_kwargs def prepare_extra_step_kwargs(self, generator, eta): # prepare extra kwargs for the scheduler step, since not all schedulers have the same signature # eta (ฮท) is only used with the DDIMScheduler, it will be ignored for other schedulers. # eta corresponds to ฮท in DDIM paper: https://arxiv.org/abs/2010.02502 # and should be between [0, 1] accepts_eta = "eta" in set(inspect.signature(self.scheduler.step).parameters.keys()) extra_step_kwargs = {} if accepts_eta: extra_step_kwargs["eta"] = eta # check if the scheduler accepts generator accepts_generator = "generator" in set(inspect.signature(self.scheduler.step).parameters.keys()) if accepts_generator: extra_step_kwargs["generator"] = generator return extra_step_kwargs # Currently StableDiffusionPipeline.check_inputs with negative prompt stuff removed def check_inputs( self, prompt: Union[str, List[str]], height: int, width: int, callback_steps: int, prompt_embeds: Optional[torch.FloatTensor] = None, callback_on_step_end_tensor_inputs=None, ): if height % 8 != 0 or width % 8 != 0: raise ValueError(f"`height` and `width` have to be divisible by 8 but are {height} and {width}.") if callback_steps is not None and (not isinstance(callback_steps, int) or callback_steps <= 0): raise ValueError( f"`callback_steps` has to be a positive integer but is {callback_steps} of type" f" {type(callback_steps)}." ) if callback_on_step_end_tensor_inputs is not None and not all( k in self._callback_tensor_inputs for k in callback_on_step_end_tensor_inputs ): raise ValueError( f"`callback_on_step_end_tensor_inputs` has to be in {self._callback_tensor_inputs}, but found {[k for k in callback_on_step_end_tensor_inputs if k not in self._callback_tensor_inputs]}" ) if prompt is not None and prompt_embeds is not None: raise ValueError( f"Cannot forward both `prompt`: {prompt} and `prompt_embeds`: {prompt_embeds}. Please make sure to" " only forward one of the two." ) elif prompt is None and prompt_embeds is None: raise ValueError( "Provide either `prompt` or `prompt_embeds`. Cannot leave both `prompt` and `prompt_embeds` undefined." ) elif prompt is not None and (not isinstance(prompt, str) and not isinstance(prompt, list)): raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") @torch.no_grad() def interpolate_embedding( self, start_embedding: torch.FloatTensor, end_embedding: torch.FloatTensor, num_interpolation_steps: Union[int, List[int]], interpolation_type: str, ) -> torch.FloatTensor: if interpolation_type == "lerp": interpolation_fn = lerp elif interpolation_type == "slerp": interpolation_fn = slerp else: raise ValueError( f"embedding_interpolation_type must be one of ['lerp', 'slerp'], got {interpolation_type}." ) embedding = torch.cat([start_embedding, end_embedding]) steps = torch.linspace(0, 1, num_interpolation_steps, dtype=embedding.dtype).cpu().numpy() steps = np.expand_dims(steps, axis=tuple(range(1, embedding.ndim))) interpolations = [] # Interpolate between text embeddings # TODO(aryan): Think of a better way of doing this # See if it can be done parallelly instead for i in range(embedding.shape[0] - 1): interpolations.append(interpolation_fn(embedding[i], embedding[i + 1], steps).squeeze(dim=1)) interpolations = torch.cat(interpolations) return interpolations @torch.no_grad() def interpolate_latent( self, start_latent: torch.FloatTensor, end_latent: torch.FloatTensor, num_interpolation_steps: Union[int, List[int]], interpolation_type: str, ) -> torch.FloatTensor: if interpolation_type == "lerp": interpolation_fn = lerp elif interpolation_type == "slerp": interpolation_fn = slerp latent = torch.cat([start_latent, end_latent]) steps = torch.linspace(0, 1, num_interpolation_steps, dtype=latent.dtype).cpu().numpy() steps = np.expand_dims(steps, axis=tuple(range(1, latent.ndim))) interpolations = [] # Interpolate between latents # TODO: Think of a better way of doing this # See if it can be done parallelly instead for i in range(latent.shape[0] - 1): interpolations.append(interpolation_fn(latent[i], latent[i + 1], steps).squeeze(dim=1)) return torch.cat(interpolations) @property def guidance_scale(self): return self._guidance_scale @property def cross_attention_kwargs(self): return self._cross_attention_kwargs @property def clip_skip(self): return self._clip_skip @property def num_timesteps(self): return self._num_timesteps @torch.no_grad() @replace_example_docstring(EXAMPLE_DOC_STRING) def __call__( self, prompt: Union[str, List[str]] = None, height: Optional[int] = None, width: Optional[int] = None, num_inference_steps: int = 4, num_interpolation_steps: int = 8, original_inference_steps: int = None, guidance_scale: float = 8.5, num_images_per_prompt: Optional[int] = 1, generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, latents: Optional[torch.FloatTensor] = None, prompt_embeds: Optional[torch.FloatTensor] = None, output_type: Optional[str] = "pil", return_dict: bool = True, cross_attention_kwargs: Optional[Dict[str, Any]] = None, clip_skip: Optional[int] = None, callback_on_step_end: Optional[Callable[[int, int, Dict], None]] = None, callback_on_step_end_tensor_inputs: List[str] = ["latents"], embedding_interpolation_type: str = "lerp", latent_interpolation_type: str = "slerp", process_batch_size: int = 4, **kwargs, ): r""" The call function to the pipeline for generation. Args: prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide image generation. If not defined, you need to pass `prompt_embeds`. height (`int`, *optional*, defaults to `self.unet.config.sample_size * self.vae_scale_factor`): The height in pixels of the generated image. width (`int`, *optional*, defaults to `self.unet.config.sample_size * self.vae_scale_factor`): The width in pixels of the generated image. num_inference_steps (`int`, *optional*, defaults to 50): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. original_inference_steps (`int`, *optional*): The original number of inference steps use to generate a linearly-spaced timestep schedule, from which we will draw `num_inference_steps` evenly spaced timesteps from as our final timestep schedule, following the Skipping-Step method in the paper (see Section 4.3). If not set this will default to the scheduler's `original_inference_steps` attribute. guidance_scale (`float`, *optional*, defaults to 7.5): A higher guidance scale value encourages the model to generate images closely linked to the text `prompt` at the expense of lower image quality. Guidance scale is enabled when `guidance_scale > 1`. Note that the original latent consistency models paper uses a different CFG formulation where the guidance scales are decreased by 1 (so in the paper formulation CFG is enabled when `guidance_scale > 0`). num_images_per_prompt (`int`, *optional*, defaults to 1): The number of images to generate per prompt. generator (`torch.Generator` or `List[torch.Generator]`, *optional*): A [`torch.Generator`](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor is generated by sampling using the supplied random `generator`. prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs (prompt weighting). If not provided, text embeddings are generated from the `prompt` input argument. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generated image. Choose between `PIL.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] instead of a plain tuple. cross_attention_kwargs (`dict`, *optional*): A kwargs dictionary that if specified is passed along to the [`AttentionProcessor`] as defined in [`self.processor`](https://github.com/huggingface/diffusers/blob/main/src/diffusers/models/attention_processor.py). clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. callback_on_step_end (`Callable`, *optional*): A function that calls at the end of each denoising steps during the inference. The function is called with the following arguments: `callback_on_step_end(self: DiffusionPipeline, step: int, timestep: int, callback_kwargs: Dict)`. `callback_kwargs` will include a list of all tensors as specified by `callback_on_step_end_tensor_inputs`. callback_on_step_end_tensor_inputs (`List`, *optional*): The list of tensor inputs for the `callback_on_step_end` function. The tensors specified in the list will be passed as `callback_kwargs` argument. You will only be able to include variables listed in the `._callback_tensor_inputs` attribute of your pipeine class. embedding_interpolation_type (`str`, *optional*, defaults to `"lerp"`): The type of interpolation to use for interpolating between text embeddings. Choose between `"lerp"` and `"slerp"`. latent_interpolation_type (`str`, *optional*, defaults to `"slerp"`): The type of interpolation to use for interpolating between latents. Choose between `"lerp"` and `"slerp"`. process_batch_size (`int`, *optional*, defaults to 4): The batch size to use for processing the images. This is useful when generating a large number of images and you want to avoid running out of memory. Examples: Returns: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] or `tuple`: If `return_dict` is `True`, [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] is returned, otherwise a `tuple` is returned where the first element is a list with the generated images and the second element is a list of `bool`s indicating whether the corresponding generated image contains "not-safe-for-work" (nsfw) content. """ callback = kwargs.pop("callback", None) callback_steps = kwargs.pop("callback_steps", None) if callback is not None: deprecate( "callback", "1.0.0", "Passing `callback` as an input argument to `__call__` is deprecated, consider use `callback_on_step_end`", ) if callback_steps is not None: deprecate( "callback_steps", "1.0.0", "Passing `callback_steps` as an input argument to `__call__` is deprecated, consider use `callback_on_step_end`", ) # 0. Default height and width to unet height = height or self.unet.config.sample_size * self.vae_scale_factor width = width or self.unet.config.sample_size * self.vae_scale_factor # 1. Check inputs. Raise error if not correct self.check_inputs(prompt, height, width, callback_steps, prompt_embeds, callback_on_step_end_tensor_inputs) self._guidance_scale = guidance_scale self._clip_skip = clip_skip self._cross_attention_kwargs = cross_attention_kwargs # 2. Define call parameters if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if batch_size < 2: raise ValueError(f"`prompt` must have length of atleast 2 but found {batch_size}") if num_images_per_prompt != 1: raise ValueError("`num_images_per_prompt` must be `1` as no other value is supported yet") if prompt_embeds is not None: raise ValueError("`prompt_embeds` must be None since it is not supported yet") if latents is not None: raise ValueError("`latents` must be None since it is not supported yet") device = self._execution_device # do_classifier_free_guidance = guidance_scale > 1.0 lora_scale = ( self.cross_attention_kwargs.get("scale", None) if self.cross_attention_kwargs is not None else None ) self.scheduler.set_timesteps(num_inference_steps, device, original_inference_steps=original_inference_steps) timesteps = self.scheduler.timesteps num_channels_latents = self.unet.config.in_channels # bs = batch_size * num_images_per_prompt # 3. Encode initial input prompt prompt_embeds_1, _ = self.encode_prompt( prompt[:1], device, num_images_per_prompt=num_images_per_prompt, do_classifier_free_guidance=False, negative_prompt=None, prompt_embeds=prompt_embeds, negative_prompt_embeds=None, lora_scale=lora_scale, clip_skip=self.clip_skip, ) # 4. Prepare initial latent variables latents_1 = self.prepare_latents( 1, num_channels_latents, height, width, prompt_embeds_1.dtype, device, generator, latents, ) extra_step_kwargs = self.prepare_extra_step_kwargs(generator, None) num_warmup_steps = len(timesteps) - num_inference_steps * self.scheduler.order self._num_timesteps = len(timesteps) images = [] # 5. Iterate over prompts and perform latent walk. Note that we do this two prompts at a time # otherwise the memory usage ends up being too high. with self.progress_bar(total=batch_size - 1) as prompt_progress_bar: for i in range(1, batch_size): # 6. Encode current prompt prompt_embeds_2, _ = self.encode_prompt( prompt[i : i + 1], device, num_images_per_prompt=num_images_per_prompt, do_classifier_free_guidance=False, negative_prompt=None, prompt_embeds=prompt_embeds, negative_prompt_embeds=None, lora_scale=lora_scale, clip_skip=self.clip_skip, ) # 7. Prepare current latent variables latents_2 = self.prepare_latents( 1, num_channels_latents, height, width, prompt_embeds_2.dtype, device, generator, latents, ) # 8. Interpolate between previous and current prompt embeddings and latents inference_embeddings = self.interpolate_embedding( start_embedding=prompt_embeds_1, end_embedding=prompt_embeds_2, num_interpolation_steps=num_interpolation_steps, interpolation_type=embedding_interpolation_type, ) inference_latents = self.interpolate_latent( start_latent=latents_1, end_latent=latents_2, num_interpolation_steps=num_interpolation_steps, interpolation_type=latent_interpolation_type, ) next_prompt_embeds = inference_embeddings[-1:].detach().clone() next_latents = inference_latents[-1:].detach().clone() bs = num_interpolation_steps # 9. Perform inference in batches. Note the use of `process_batch_size` to control the batch size # of the inference. This is useful for reducing memory usage and can be configured based on the # available GPU memory. with self.progress_bar( total=(bs + process_batch_size - 1) // process_batch_size ) as batch_progress_bar: for batch_index in range(0, bs, process_batch_size): batch_inference_latents = inference_latents[batch_index : batch_index + process_batch_size] batch_inference_embedddings = inference_embeddings[ batch_index : batch_index + process_batch_size ] self.scheduler.set_timesteps( num_inference_steps, device, original_inference_steps=original_inference_steps ) timesteps = self.scheduler.timesteps current_bs = batch_inference_embedddings.shape[0] w = torch.tensor(self.guidance_scale - 1).repeat(current_bs) w_embedding = self.get_guidance_scale_embedding( w, embedding_dim=self.unet.config.time_cond_proj_dim ).to(device=device, dtype=latents_1.dtype) # 10. Perform inference for current batch with self.progress_bar(total=num_inference_steps) as progress_bar: for index, t in enumerate(timesteps): batch_inference_latents = batch_inference_latents.to(batch_inference_embedddings.dtype) # model prediction (v-prediction, eps, x) model_pred = self.unet( batch_inference_latents, t, timestep_cond=w_embedding, encoder_hidden_states=batch_inference_embedddings, cross_attention_kwargs=self.cross_attention_kwargs, return_dict=False, )[0] # compute the previous noisy sample x_t -> x_t-1 batch_inference_latents, denoised = self.scheduler.step( model_pred, t, batch_inference_latents, **extra_step_kwargs, return_dict=False ) if callback_on_step_end is not None: callback_kwargs = {} for k in callback_on_step_end_tensor_inputs: callback_kwargs[k] = locals()[k] callback_outputs = callback_on_step_end(self, index, t, callback_kwargs) batch_inference_latents = callback_outputs.pop("latents", batch_inference_latents) batch_inference_embedddings = callback_outputs.pop( "prompt_embeds", batch_inference_embedddings ) w_embedding = callback_outputs.pop("w_embedding", w_embedding) denoised = callback_outputs.pop("denoised", denoised) # call the callback, if provided if index == len(timesteps) - 1 or ( (index + 1) > num_warmup_steps and (index + 1) % self.scheduler.order == 0 ): progress_bar.update() if callback is not None and index % callback_steps == 0: step_idx = index // getattr(self.scheduler, "order", 1) callback(step_idx, t, batch_inference_latents) denoised = denoised.to(batch_inference_embedddings.dtype) # Note: This is not supported because you would get black images in your latent walk if # NSFW concept is detected # if not output_type == "latent": # image = self.vae.decode(denoised / self.vae.config.scaling_factor, return_dict=False)[0] # image, has_nsfw_concept = self.run_safety_checker(image, device, inference_embeddings.dtype) # else: # image = denoised # has_nsfw_concept = None # if has_nsfw_concept is None: # do_denormalize = [True] * image.shape[0] # else: # do_denormalize = [not has_nsfw for has_nsfw in has_nsfw_concept] image = self.vae.decode(denoised / self.vae.config.scaling_factor, return_dict=False)[0] do_denormalize = [True] * image.shape[0] has_nsfw_concept = None image = self.image_processor.postprocess( image, output_type=output_type, do_denormalize=do_denormalize ) images.append(image) batch_progress_bar.update() prompt_embeds_1 = next_prompt_embeds latents_1 = next_latents prompt_progress_bar.update() # 11. Determine what should be returned if output_type == "pil": images = [image for image_list in images for image in image_list] elif output_type == "np": images = np.concatenate(images) elif output_type == "pt": images = torch.cat(images) else: raise ValueError("`output_type` must be one of 'pil', 'np' or 'pt'.") # Offload all models self.maybe_free_model_hooks() if not return_dict: return (images, has_nsfw_concept) return StableDiffusionPipelineOutput(images=images, nsfw_content_detected=has_nsfw_concept)
diffusers/examples/community/latent_consistency_interpolate.py/0
{ "file_path": "diffusers/examples/community/latent_consistency_interpolate.py", "repo_id": "diffusers", "token_count": 23232 }
99
# Copyright 2023 FABRIC authors and the HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from typing import List, Optional, Union import torch from packaging import version from PIL import Image from transformers import CLIPTextModel, CLIPTokenizer from diffusers import AutoencoderKL, UNet2DConditionModel from diffusers.configuration_utils import FrozenDict from diffusers.image_processor import VaeImageProcessor from diffusers.loaders import LoraLoaderMixin, TextualInversionLoaderMixin from diffusers.models.attention import BasicTransformerBlock from diffusers.models.attention_processor import LoRAAttnProcessor from diffusers.pipelines.pipeline_utils import DiffusionPipeline from diffusers.pipelines.stable_diffusion import StableDiffusionPipelineOutput from diffusers.schedulers import EulerAncestralDiscreteScheduler, KarrasDiffusionSchedulers from diffusers.utils import ( deprecate, logging, replace_example_docstring, ) from diffusers.utils.torch_utils import randn_tensor logger = logging.get_logger(__name__) # pylint: disable=invalid-name EXAMPLE_DOC_STRING = """ Examples: ```py >>> from diffusers import DiffusionPipeline >>> import torch >>> model_id = "dreamlike-art/dreamlike-photoreal-2.0" >>> pipe = DiffusionPipeline(model_id, torch_dtype=torch.float16, custom_pipeline="pipeline_fabric") >>> pipe = pipe.to("cuda") >>> prompt = "a giant standing in a fantasy landscape best quality" >>> liked = [] # list of images for positive feedback >>> disliked = [] # list of images for negative feedback >>> image = pipe(prompt, num_images=4, liked=liked, disliked=disliked).images[0] ``` """ class FabricCrossAttnProcessor: def __init__(self): self.attntion_probs = None def __call__( self, attn, hidden_states, encoder_hidden_states=None, attention_mask=None, weights=None, lora_scale=1.0, ): batch_size, sequence_length, _ = ( hidden_states.shape if encoder_hidden_states is None else encoder_hidden_states.shape ) attention_mask = attn.prepare_attention_mask(attention_mask, sequence_length, batch_size) if isinstance(attn.processor, LoRAAttnProcessor): query = attn.to_q(hidden_states) + lora_scale * attn.processor.to_q_lora(hidden_states) else: query = attn.to_q(hidden_states) if encoder_hidden_states is None: encoder_hidden_states = hidden_states elif attn.norm_cross: encoder_hidden_states = attn.norm_encoder_hidden_states(encoder_hidden_states) if isinstance(attn.processor, LoRAAttnProcessor): key = attn.to_k(encoder_hidden_states) + lora_scale * attn.processor.to_k_lora(encoder_hidden_states) value = attn.to_v(encoder_hidden_states) + lora_scale * attn.processor.to_v_lora(encoder_hidden_states) else: key = attn.to_k(encoder_hidden_states) value = attn.to_v(encoder_hidden_states) query = attn.head_to_batch_dim(query) key = attn.head_to_batch_dim(key) value = attn.head_to_batch_dim(value) attention_probs = attn.get_attention_scores(query, key, attention_mask) if weights is not None: if weights.shape[0] != 1: weights = weights.repeat_interleave(attn.heads, dim=0) attention_probs = attention_probs * weights[:, None] attention_probs = attention_probs / attention_probs.sum(dim=-1, keepdim=True) hidden_states = torch.bmm(attention_probs, value) hidden_states = attn.batch_to_head_dim(hidden_states) # linear proj if isinstance(attn.processor, LoRAAttnProcessor): hidden_states = attn.to_out[0](hidden_states) + lora_scale * attn.processor.to_out_lora(hidden_states) else: hidden_states = attn.to_out[0](hidden_states) # dropout hidden_states = attn.to_out[1](hidden_states) return hidden_states class FabricPipeline(DiffusionPipeline): r""" Pipeline for text-to-image generation using Stable Diffusion and conditioning the results using feedback images. This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods implemented for all pipelines (downloading, saving, running on a particular device, etc.). Args: vae ([`AutoencoderKL`]): Variational Auto-Encoder (VAE) Model to encode and decode images to and from latent representations. text_encoder ([`~transformers.CLIPTextModel`]): Frozen text-encoder ([clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14)). tokenizer ([`~transformers.CLIPTokenizer`]): A `CLIPTokenizer` to tokenize text. unet ([`UNet2DConditionModel`]): A `UNet2DConditionModel` to denoise the encoded image latents. scheduler ([`EulerAncestralDiscreteScheduler`]): A scheduler to be used in combination with `unet` to denoise the encoded image latents. Can be one of [`DDIMScheduler`], [`LMSDiscreteScheduler`], or [`PNDMScheduler`]. safety_checker ([`StableDiffusionSafetyChecker`]): Classification module that estimates whether generated images could be considered offensive or harmful. Please refer to the [model card](https://huggingface.co/runwayml/stable-diffusion-v1-5) for more details about a model's potential harms. """ def __init__( self, vae: AutoencoderKL, text_encoder: CLIPTextModel, tokenizer: CLIPTokenizer, unet: UNet2DConditionModel, scheduler: KarrasDiffusionSchedulers, requires_safety_checker: bool = True, ): super().__init__() is_unet_version_less_0_9_0 = hasattr(unet.config, "_diffusers_version") and version.parse( version.parse(unet.config._diffusers_version).base_version ) < version.parse("0.9.0.dev0") is_unet_sample_size_less_64 = hasattr(unet.config, "sample_size") and unet.config.sample_size < 64 if is_unet_version_less_0_9_0 and is_unet_sample_size_less_64: deprecation_message = ( "The configuration file of the unet has set the default `sample_size` to smaller than" " 64 which seems highly unlikely. If your checkpoint is a fine-tuned version of any of the" " following: \n- CompVis/stable-diffusion-v1-4 \n- CompVis/stable-diffusion-v1-3 \n-" " CompVis/stable-diffusion-v1-2 \n- CompVis/stable-diffusion-v1-1 \n- runwayml/stable-diffusion-v1-5" " \n- runwayml/stable-diffusion-inpainting \n you should change 'sample_size' to 64 in the" " configuration file. Please make sure to update the config accordingly as leaving `sample_size=32`" " in the config might lead to incorrect results in future versions. If you have downloaded this" " checkpoint from the Hugging Face Hub, it would be very nice if you could open a Pull request for" " the `unet/config.json` file" ) deprecate("sample_size<64", "1.0.0", deprecation_message, standard_warn=False) new_config = dict(unet.config) new_config["sample_size"] = 64 unet._internal_dict = FrozenDict(new_config) self.register_modules( unet=unet, vae=vae, text_encoder=text_encoder, tokenizer=tokenizer, scheduler=scheduler, ) self.vae_scale_factor = 2 ** (len(self.vae.config.block_out_channels) - 1) self.image_processor = VaeImageProcessor(vae_scale_factor=self.vae_scale_factor) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline._encode_prompt def _encode_prompt( self, prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt=None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, ): r""" Encodes the prompt into text encoder hidden states. Args: prompt (`str` or `List[str]`, *optional*): prompt to be encoded device: (`torch.device`): torch device num_images_per_prompt (`int`): number of images that should be generated per prompt do_classifier_free_guidance (`bool`): whether to use classifier free guidance or not negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. lora_scale (`float`, *optional*): A lora scale that will be applied to all LoRA layers of the text encoder if LoRA layers are loaded. """ # set lora scale so that monkey patched LoRA # function of text encoder can correctly access it if lora_scale is not None and isinstance(self, LoraLoaderMixin): self._lora_scale = lora_scale if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if prompt_embeds is None: # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): prompt = self.maybe_convert_prompt(prompt, self.tokenizer) text_inputs = self.tokenizer( prompt, padding="max_length", max_length=self.tokenizer.model_max_length, truncation=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = self.tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal( text_input_ids, untruncated_ids ): removed_text = self.tokenizer.batch_decode( untruncated_ids[:, self.tokenizer.model_max_length - 1 : -1] ) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {self.tokenizer.model_max_length} tokens: {removed_text}" ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = text_inputs.attention_mask.to(device) else: attention_mask = None prompt_embeds = self.text_encoder( text_input_ids.to(device), attention_mask=attention_mask, ) prompt_embeds = prompt_embeds[0] if self.text_encoder is not None: prompt_embeds_dtype = self.text_encoder.dtype elif self.unet is not None: prompt_embeds_dtype = self.unet.dtype else: prompt_embeds_dtype = prompt_embeds.dtype prompt_embeds = prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) bs_embed, seq_len, _ = prompt_embeds.shape # duplicate text embeddings for each generation per prompt, using mps friendly method prompt_embeds = prompt_embeds.repeat(1, num_images_per_prompt, 1) prompt_embeds = prompt_embeds.view(bs_embed * num_images_per_prompt, seq_len, -1) # get unconditional embeddings for classifier free guidance if do_classifier_free_guidance and negative_prompt_embeds is None: uncond_tokens: List[str] if negative_prompt is None: uncond_tokens = [""] * batch_size elif prompt is not None and type(prompt) is not type(negative_prompt): raise TypeError( f"`negative_prompt` should be the same type to `prompt`, but got {type(negative_prompt)} !=" f" {type(prompt)}." ) elif isinstance(negative_prompt, str): uncond_tokens = [negative_prompt] elif batch_size != len(negative_prompt): raise ValueError( f"`negative_prompt`: {negative_prompt} has batch size {len(negative_prompt)}, but `prompt`:" f" {prompt} has batch size {batch_size}. Please make sure that passed `negative_prompt` matches" " the batch size of `prompt`." ) else: uncond_tokens = negative_prompt # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): uncond_tokens = self.maybe_convert_prompt(uncond_tokens, self.tokenizer) max_length = prompt_embeds.shape[1] uncond_input = self.tokenizer( uncond_tokens, padding="max_length", max_length=max_length, truncation=True, return_tensors="pt", ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = uncond_input.attention_mask.to(device) else: attention_mask = None negative_prompt_embeds = self.text_encoder( uncond_input.input_ids.to(device), attention_mask=attention_mask, ) negative_prompt_embeds = negative_prompt_embeds[0] if do_classifier_free_guidance: # duplicate unconditional embeddings for each generation per prompt, using mps friendly method seq_len = negative_prompt_embeds.shape[1] negative_prompt_embeds = negative_prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) negative_prompt_embeds = negative_prompt_embeds.repeat(1, num_images_per_prompt, 1) negative_prompt_embeds = negative_prompt_embeds.view(batch_size * num_images_per_prompt, seq_len, -1) # For classifier free guidance, we need to do two forward passes. # Here we concatenate the unconditional and text embeddings into a single batch # to avoid doing two forward passes prompt_embeds = torch.cat([negative_prompt_embeds, prompt_embeds]) return prompt_embeds def get_unet_hidden_states(self, z_all, t, prompt_embd): cached_hidden_states = [] for module in self.unet.modules(): if isinstance(module, BasicTransformerBlock): def new_forward(self, hidden_states, *args, **kwargs): cached_hidden_states.append(hidden_states.clone().detach().cpu()) return self.old_forward(hidden_states, *args, **kwargs) module.attn1.old_forward = module.attn1.forward module.attn1.forward = new_forward.__get__(module.attn1) # run forward pass to cache hidden states, output can be discarded _ = self.unet(z_all, t, encoder_hidden_states=prompt_embd) # restore original forward pass for module in self.unet.modules(): if isinstance(module, BasicTransformerBlock): module.attn1.forward = module.attn1.old_forward del module.attn1.old_forward return cached_hidden_states def unet_forward_with_cached_hidden_states( self, z_all, t, prompt_embd, cached_pos_hiddens: Optional[List[torch.Tensor]] = None, cached_neg_hiddens: Optional[List[torch.Tensor]] = None, pos_weights=(0.8, 0.8), neg_weights=(0.5, 0.5), ): if cached_pos_hiddens is None and cached_neg_hiddens is None: return self.unet(z_all, t, encoder_hidden_states=prompt_embd) local_pos_weights = torch.linspace(*pos_weights, steps=len(self.unet.down_blocks) + 1)[:-1].tolist() local_neg_weights = torch.linspace(*neg_weights, steps=len(self.unet.down_blocks) + 1)[:-1].tolist() for block, pos_weight, neg_weight in zip( self.unet.down_blocks + [self.unet.mid_block] + self.unet.up_blocks, local_pos_weights + [pos_weights[1]] + local_pos_weights[::-1], local_neg_weights + [neg_weights[1]] + local_neg_weights[::-1], ): for module in block.modules(): if isinstance(module, BasicTransformerBlock): def new_forward( self, hidden_states, pos_weight=pos_weight, neg_weight=neg_weight, **kwargs, ): cond_hiddens, uncond_hiddens = hidden_states.chunk(2, dim=0) batch_size, d_model = cond_hiddens.shape[:2] device, dtype = hidden_states.device, hidden_states.dtype weights = torch.ones(batch_size, d_model, device=device, dtype=dtype) out_pos = self.old_forward(hidden_states) out_neg = self.old_forward(hidden_states) if cached_pos_hiddens is not None: cached_pos_hs = cached_pos_hiddens.pop(0).to(hidden_states.device) cond_pos_hs = torch.cat([cond_hiddens, cached_pos_hs], dim=1) pos_weights = weights.clone().repeat(1, 1 + cached_pos_hs.shape[1] // d_model) pos_weights[:, d_model:] = pos_weight attn_with_weights = FabricCrossAttnProcessor() out_pos = attn_with_weights( self, cond_hiddens, encoder_hidden_states=cond_pos_hs, weights=pos_weights, ) else: out_pos = self.old_forward(cond_hiddens) if cached_neg_hiddens is not None: cached_neg_hs = cached_neg_hiddens.pop(0).to(hidden_states.device) uncond_neg_hs = torch.cat([uncond_hiddens, cached_neg_hs], dim=1) neg_weights = weights.clone().repeat(1, 1 + cached_neg_hs.shape[1] // d_model) neg_weights[:, d_model:] = neg_weight attn_with_weights = FabricCrossAttnProcessor() out_neg = attn_with_weights( self, uncond_hiddens, encoder_hidden_states=uncond_neg_hs, weights=neg_weights, ) else: out_neg = self.old_forward(uncond_hiddens) out = torch.cat([out_pos, out_neg], dim=0) return out module.attn1.old_forward = module.attn1.forward module.attn1.forward = new_forward.__get__(module.attn1) out = self.unet(z_all, t, encoder_hidden_states=prompt_embd) # restore original forward pass for module in self.unet.modules(): if isinstance(module, BasicTransformerBlock): module.attn1.forward = module.attn1.old_forward del module.attn1.old_forward return out def preprocess_feedback_images(self, images, vae, dim, device, dtype, generator) -> torch.tensor: images_t = [self.image_to_tensor(img, dim, dtype) for img in images] images_t = torch.stack(images_t).to(device) latents = vae.config.scaling_factor * vae.encode(images_t).latent_dist.sample(generator) return torch.cat([latents], dim=0) def check_inputs( self, prompt, negative_prompt=None, liked=None, disliked=None, height=None, width=None, ): if prompt is None: raise ValueError("Provide `prompt`. Cannot leave both `prompt` undefined.") elif prompt is not None and (not isinstance(prompt, str) and not isinstance(prompt, list)): raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") if negative_prompt is not None and ( not isinstance(negative_prompt, str) and not isinstance(negative_prompt, list) ): raise ValueError(f"`negative_prompt` has to be of type `str` or `list` but is {type(negative_prompt)}") if liked is not None and not isinstance(liked, list): raise ValueError(f"`liked` has to be of type `list` but is {type(liked)}") if disliked is not None and not isinstance(disliked, list): raise ValueError(f"`disliked` has to be of type `list` but is {type(disliked)}") if height is not None and not isinstance(height, int): raise ValueError(f"`height` has to be of type `int` but is {type(height)}") if width is not None and not isinstance(width, int): raise ValueError(f"`width` has to be of type `int` but is {type(width)}") @torch.no_grad() @replace_example_docstring(EXAMPLE_DOC_STRING) def __call__( self, prompt: Optional[Union[str, List[str]]] = "", negative_prompt: Optional[Union[str, List[str]]] = "lowres, bad anatomy, bad hands, cropped, worst quality", liked: Optional[Union[List[str], List[Image.Image]]] = [], disliked: Optional[Union[List[str], List[Image.Image]]] = [], generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, height: int = 512, width: int = 512, return_dict: bool = True, num_images: int = 4, guidance_scale: float = 7.0, num_inference_steps: int = 20, output_type: Optional[str] = "pil", feedback_start_ratio: float = 0.33, feedback_end_ratio: float = 0.66, min_weight: float = 0.05, max_weight: float = 0.8, neg_scale: float = 0.5, pos_bottleneck_scale: float = 1.0, neg_bottleneck_scale: float = 1.0, latents: Optional[torch.FloatTensor] = None, ): r""" The call function to the pipeline for generation. Generate a trajectory of images with binary feedback. The feedback can be given as a list of liked and disliked images. Args: prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide image generation. If not defined, you need to pass `prompt_embeds` instead. negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide what to not include in image generation. If not defined, you need to pass `negative_prompt_embeds` instead. Ignored when not using guidance (`guidance_scale < 1`). liked (`List[Image.Image]` or `List[str]`, *optional*): Encourages images with liked features. disliked (`List[Image.Image]` or `List[str]`, *optional*): Discourages images with disliked features. generator (`torch.Generator` or `List[torch.Generator]` or `int`, *optional*): A [`torch.Generator`](https://pytorch.org/docs/stable/generated/torch.Generator.html) or an `int` to make generation deterministic. height (`int`, *optional*, defaults to 512): Height of the generated image. width (`int`, *optional*, defaults to 512): Width of the generated image. num_images (`int`, *optional*, defaults to 4): The number of images to generate per prompt. guidance_scale (`float`, *optional*, defaults to 7.0): A higher guidance scale value encourages the model to generate images closely linked to the text `prompt` at the expense of lower image quality. Guidance scale is enabled when `guidance_scale > 1`. num_inference_steps (`int`, *optional*, defaults to 20): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generated image. Choose between `PIL.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] instead of a plain tuple. feedback_start_ratio (`float`, *optional*, defaults to `.33`): Start point for providing feedback (between 0 and 1). feedback_end_ratio (`float`, *optional*, defaults to `.66`): End point for providing feedback (between 0 and 1). min_weight (`float`, *optional*, defaults to `.05`): Minimum weight for feedback. max_weight (`float`, *optional*, defults tp `1.0`): Maximum weight for feedback. neg_scale (`float`, *optional*, defaults to `.5`): Scale factor for negative feedback. Examples: Returns: [`~pipelines.fabric.FabricPipelineOutput`] or `tuple`: If `return_dict` is `True`, [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] is returned, otherwise a `tuple` is returned where the first element is a list with the generated images and the second element is a list of `bool`s indicating whether the corresponding generated image contains "not-safe-for-work" (nsfw) content. """ self.check_inputs(prompt, negative_prompt, liked, disliked) device = self._execution_device dtype = self.unet.dtype if isinstance(prompt, str) and prompt is not None: batch_size = 1 elif isinstance(prompt, list) and prompt is not None: batch_size = len(prompt) else: raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") if isinstance(negative_prompt, str): negative_prompt = negative_prompt elif isinstance(negative_prompt, list): negative_prompt = negative_prompt else: assert len(negative_prompt) == batch_size shape = ( batch_size * num_images, self.unet.config.in_channels, height // self.vae_scale_factor, width // self.vae_scale_factor, ) latent_noise = randn_tensor( shape, device=device, dtype=dtype, generator=generator, ) positive_latents = ( self.preprocess_feedback_images(liked, self.vae, (height, width), device, dtype, generator) if liked and len(liked) > 0 else torch.tensor( [], device=device, dtype=dtype, ) ) negative_latents = ( self.preprocess_feedback_images(disliked, self.vae, (height, width), device, dtype, generator) if disliked and len(disliked) > 0 else torch.tensor( [], device=device, dtype=dtype, ) ) do_classifier_free_guidance = guidance_scale > 0.1 (prompt_neg_embs, prompt_pos_embs) = self._encode_prompt( prompt, device, num_images, do_classifier_free_guidance, negative_prompt, ).split([num_images * batch_size, num_images * batch_size]) batched_prompt_embd = torch.cat([prompt_pos_embs, prompt_neg_embs], dim=0) null_tokens = self.tokenizer( [""], return_tensors="pt", max_length=self.tokenizer.model_max_length, padding="max_length", truncation=True, ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = null_tokens.attention_mask.to(device) else: attention_mask = None null_prompt_emb = self.text_encoder( input_ids=null_tokens.input_ids.to(device), attention_mask=attention_mask, ).last_hidden_state null_prompt_emb = null_prompt_emb.to(device=device, dtype=dtype) self.scheduler.set_timesteps(num_inference_steps, device=device) timesteps = self.scheduler.timesteps latent_noise = latent_noise * self.scheduler.init_noise_sigma num_warmup_steps = len(timesteps) - num_inference_steps * self.scheduler.order ref_start_idx = round(len(timesteps) * feedback_start_ratio) ref_end_idx = round(len(timesteps) * feedback_end_ratio) with self.progress_bar(total=num_inference_steps) as pbar: for i, t in enumerate(timesteps): sigma = self.scheduler.sigma_t[t] if hasattr(self.scheduler, "sigma_t") else 0 if hasattr(self.scheduler, "sigmas"): sigma = self.scheduler.sigmas[i] alpha_hat = 1 / (sigma**2 + 1) z_single = self.scheduler.scale_model_input(latent_noise, t) z_all = torch.cat([z_single] * 2, dim=0) z_ref = torch.cat([positive_latents, negative_latents], dim=0) if i >= ref_start_idx and i <= ref_end_idx: weight_factor = max_weight else: weight_factor = min_weight pos_ws = (weight_factor, weight_factor * pos_bottleneck_scale) neg_ws = (weight_factor * neg_scale, weight_factor * neg_scale * neg_bottleneck_scale) if z_ref.size(0) > 0 and weight_factor > 0: noise = torch.randn_like(z_ref) if isinstance(self.scheduler, EulerAncestralDiscreteScheduler): z_ref_noised = (alpha_hat**0.5 * z_ref + (1 - alpha_hat) ** 0.5 * noise).type(dtype) else: z_ref_noised = self.scheduler.add_noise(z_ref, noise, t) ref_prompt_embd = torch.cat( [null_prompt_emb] * (len(positive_latents) + len(negative_latents)), dim=0 ) cached_hidden_states = self.get_unet_hidden_states(z_ref_noised, t, ref_prompt_embd) n_pos, n_neg = positive_latents.shape[0], negative_latents.shape[0] cached_pos_hs, cached_neg_hs = [], [] for hs in cached_hidden_states: cached_pos, cached_neg = hs.split([n_pos, n_neg], dim=0) cached_pos = cached_pos.view(1, -1, *cached_pos.shape[2:]).expand(num_images, -1, -1) cached_neg = cached_neg.view(1, -1, *cached_neg.shape[2:]).expand(num_images, -1, -1) cached_pos_hs.append(cached_pos) cached_neg_hs.append(cached_neg) if n_pos == 0: cached_pos_hs = None if n_neg == 0: cached_neg_hs = None else: cached_pos_hs, cached_neg_hs = None, None unet_out = self.unet_forward_with_cached_hidden_states( z_all, t, prompt_embd=batched_prompt_embd, cached_pos_hiddens=cached_pos_hs, cached_neg_hiddens=cached_neg_hs, pos_weights=pos_ws, neg_weights=neg_ws, )[0] noise_cond, noise_uncond = unet_out.chunk(2) guidance = noise_cond - noise_uncond noise_pred = noise_uncond + guidance_scale * guidance latent_noise = self.scheduler.step(noise_pred, t, latent_noise)[0] if i == len(timesteps) - 1 or ((i + 1) > num_warmup_steps and (i + 1) % self.scheduler.order == 0): pbar.update() y = self.vae.decode(latent_noise / self.vae.config.scaling_factor, return_dict=False)[0] imgs = self.image_processor.postprocess( y, output_type=output_type, ) if not return_dict: return imgs return StableDiffusionPipelineOutput(imgs, False) def image_to_tensor(self, image: Union[str, Image.Image], dim: tuple, dtype): """ Convert latent PIL image to a torch tensor for further processing. """ if isinstance(image, str): image = Image.open(image) if not image.mode == "RGB": image = image.convert("RGB") image = self.image_processor.preprocess(image, height=dim[0], width=dim[1])[0] return image.type(dtype)
diffusers/examples/community/pipeline_fabric.py/0
{ "file_path": "diffusers/examples/community/pipeline_fabric.py", "repo_id": "diffusers", "token_count": 16488 }
100
from typing import Callable, List, Optional, Union import PIL.Image import torch from transformers import ( CLIPImageProcessor, CLIPSegForImageSegmentation, CLIPSegProcessor, CLIPTextModel, CLIPTokenizer, ) from diffusers import DiffusionPipeline from diffusers.configuration_utils import FrozenDict from diffusers.models import AutoencoderKL, UNet2DConditionModel from diffusers.pipelines.stable_diffusion import StableDiffusionInpaintPipeline from diffusers.pipelines.stable_diffusion.safety_checker import StableDiffusionSafetyChecker from diffusers.schedulers import DDIMScheduler, LMSDiscreteScheduler, PNDMScheduler from diffusers.utils import deprecate, is_accelerate_available, logging logger = logging.get_logger(__name__) # pylint: disable=invalid-name class TextInpainting(DiffusionPipeline): r""" Pipeline for text based inpainting using Stable Diffusion. Uses CLIPSeg to get a mask from the given text, then calls the Inpainting pipeline with the generated mask This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods the library implements for all the pipelines (such as downloading or saving, running on a particular device, etc.) Args: segmentation_model ([`CLIPSegForImageSegmentation`]): CLIPSeg Model to generate mask from the given text. Please refer to the [model card]() for details. segmentation_processor ([`CLIPSegProcessor`]): CLIPSeg processor to get image, text features to translate prompt to English, if necessary. Please refer to the [model card](https://huggingface.co/docs/transformers/model_doc/clipseg) for details. vae ([`AutoencoderKL`]): Variational Auto-Encoder (VAE) Model to encode and decode images to and from latent representations. text_encoder ([`CLIPTextModel`]): Frozen text-encoder. Stable Diffusion uses the text portion of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip#transformers.CLIPTextModel), specifically the [clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14) variant. tokenizer (`CLIPTokenizer`): Tokenizer of class [CLIPTokenizer](https://huggingface.co/docs/transformers/v4.21.0/en/model_doc/clip#transformers.CLIPTokenizer). unet ([`UNet2DConditionModel`]): Conditional U-Net architecture to denoise the encoded image latents. scheduler ([`SchedulerMixin`]): A scheduler to be used in combination with `unet` to denoise the encoded image latens. Can be one of [`DDIMScheduler`], [`LMSDiscreteScheduler`], or [`PNDMScheduler`]. safety_checker ([`StableDiffusionSafetyChecker`]): Classification module that estimates whether generated images could be considered offensive or harmful. Please, refer to the [model card](https://huggingface.co/runwayml/stable-diffusion-v1-5) for details. feature_extractor ([`CLIPImageProcessor`]): Model that extracts features from generated images to be used as inputs for the `safety_checker`. """ def __init__( self, segmentation_model: CLIPSegForImageSegmentation, segmentation_processor: CLIPSegProcessor, vae: AutoencoderKL, text_encoder: CLIPTextModel, tokenizer: CLIPTokenizer, unet: UNet2DConditionModel, scheduler: Union[DDIMScheduler, PNDMScheduler, LMSDiscreteScheduler], safety_checker: StableDiffusionSafetyChecker, feature_extractor: CLIPImageProcessor, ): super().__init__() if hasattr(scheduler.config, "steps_offset") and scheduler.config.steps_offset != 1: deprecation_message = ( f"The configuration file of this scheduler: {scheduler} is outdated. `steps_offset`" f" should be set to 1 instead of {scheduler.config.steps_offset}. Please make sure " "to update the config accordingly as leaving `steps_offset` might led to incorrect results" " in future versions. If you have downloaded this checkpoint from the Hugging Face Hub," " it would be very nice if you could open a Pull request for the `scheduler/scheduler_config.json`" " file" ) deprecate("steps_offset!=1", "1.0.0", deprecation_message, standard_warn=False) new_config = dict(scheduler.config) new_config["steps_offset"] = 1 scheduler._internal_dict = FrozenDict(new_config) if hasattr(scheduler.config, "skip_prk_steps") and scheduler.config.skip_prk_steps is False: deprecation_message = ( f"The configuration file of this scheduler: {scheduler} has not set the configuration" " `skip_prk_steps`. `skip_prk_steps` should be set to True in the configuration file. Please make" " sure to update the config accordingly as not setting `skip_prk_steps` in the config might lead to" " incorrect results in future versions. If you have downloaded this checkpoint from the Hugging Face" " Hub, it would be very nice if you could open a Pull request for the" " `scheduler/scheduler_config.json` file" ) deprecate("skip_prk_steps not set", "1.0.0", deprecation_message, standard_warn=False) new_config = dict(scheduler.config) new_config["skip_prk_steps"] = True scheduler._internal_dict = FrozenDict(new_config) if safety_checker is None: logger.warning( f"You have disabled the safety checker for {self.__class__} by passing `safety_checker=None`. Ensure" " that you abide to the conditions of the Stable Diffusion license and do not expose unfiltered" " results in services or applications open to the public. Both the diffusers team and Hugging Face" " strongly recommend to keep the safety filter enabled in all public facing circumstances, disabling" " it only for use-cases that involve analyzing network behavior or auditing its results. For more" " information, please have a look at https://github.com/huggingface/diffusers/pull/254 ." ) self.register_modules( segmentation_model=segmentation_model, segmentation_processor=segmentation_processor, vae=vae, text_encoder=text_encoder, tokenizer=tokenizer, unet=unet, scheduler=scheduler, safety_checker=safety_checker, feature_extractor=feature_extractor, ) def enable_attention_slicing(self, slice_size: Optional[Union[str, int]] = "auto"): r""" Enable sliced attention computation. When this option is enabled, the attention module will split the input tensor in slices, to compute attention in several steps. This is useful to save some memory in exchange for a small speed decrease. Args: slice_size (`str` or `int`, *optional*, defaults to `"auto"`): When `"auto"`, halves the input to the attention heads, so attention will be computed in two steps. If a number is provided, uses as many slices as `attention_head_dim // slice_size`. In this case, `attention_head_dim` must be a multiple of `slice_size`. """ if slice_size == "auto": # half the attention head size is usually a good trade-off between # speed and memory slice_size = self.unet.config.attention_head_dim // 2 self.unet.set_attention_slice(slice_size) def disable_attention_slicing(self): r""" Disable sliced attention computation. If `enable_attention_slicing` was previously invoked, this method will go back to computing attention in one step. """ # set slice_size = `None` to disable `attention slicing` self.enable_attention_slicing(None) def enable_sequential_cpu_offload(self): r""" Offloads all models to CPU using accelerate, significantly reducing memory usage. When called, unet, text_encoder, vae and safety checker have their state dicts saved to CPU and then are moved to a `torch.device('meta') and loaded to GPU only when their specific submodule has its `forward` method called. """ if is_accelerate_available(): from accelerate import cpu_offload else: raise ImportError("Please install accelerate via `pip install accelerate`") device = torch.device("cuda") for cpu_offloaded_model in [self.unet, self.text_encoder, self.vae, self.safety_checker]: if cpu_offloaded_model is not None: cpu_offload(cpu_offloaded_model, device) @property # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline._execution_device def _execution_device(self): r""" Returns the device on which the pipeline's models will be executed. After calling `pipeline.enable_sequential_cpu_offload()` the execution device can only be inferred from Accelerate's module hooks. """ if self.device != torch.device("meta") or not hasattr(self.unet, "_hf_hook"): return self.device for module in self.unet.modules(): if ( hasattr(module, "_hf_hook") and hasattr(module._hf_hook, "execution_device") and module._hf_hook.execution_device is not None ): return torch.device(module._hf_hook.execution_device) return self.device @torch.no_grad() def __call__( self, prompt: Union[str, List[str]], image: Union[torch.FloatTensor, PIL.Image.Image], text: str, height: int = 512, width: int = 512, num_inference_steps: int = 50, guidance_scale: float = 7.5, negative_prompt: Optional[Union[str, List[str]]] = None, num_images_per_prompt: Optional[int] = 1, eta: float = 0.0, generator: Optional[torch.Generator] = None, latents: Optional[torch.FloatTensor] = None, output_type: Optional[str] = "pil", return_dict: bool = True, callback: Optional[Callable[[int, int, torch.FloatTensor], None]] = None, callback_steps: int = 1, **kwargs, ): r""" Function invoked when calling the pipeline for generation. Args: prompt (`str` or `List[str]`): The prompt or prompts to guide the image generation. image (`PIL.Image.Image`): `Image`, or tensor representing an image batch which will be inpainted, *i.e.* parts of the image will be masked out with `mask_image` and repainted according to `prompt`. text (`str``): The text to use to generate the mask. height (`int`, *optional*, defaults to 512): The height in pixels of the generated image. width (`int`, *optional*, defaults to 512): The width in pixels of the generated image. num_inference_steps (`int`, *optional*, defaults to 50): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. guidance_scale (`float`, *optional*, defaults to 7.5): Guidance scale as defined in [Classifier-Free Diffusion Guidance](https://arxiv.org/abs/2207.12598). `guidance_scale` is defined as `w` of equation 2. of [Imagen Paper](https://arxiv.org/pdf/2205.11487.pdf). Guidance scale is enabled by setting `guidance_scale > 1`. Higher guidance scale encourages to generate images that are closely linked to the text `prompt`, usually at the expense of lower image quality. negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). num_images_per_prompt (`int`, *optional*, defaults to 1): The number of images to generate per prompt. eta (`float`, *optional*, defaults to 0.0): Corresponds to parameter eta (ฮท) in the DDIM paper: https://arxiv.org/abs/2010.02502. Only applies to [`schedulers.DDIMScheduler`], will be ignored for others. generator (`torch.Generator`, *optional*): A [torch generator](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents, sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor will ge generated by sampling using the supplied random `generator`. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generate image. Choose between [PIL](https://pillow.readthedocs.io/en/stable/): `PIL.Image.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] instead of a plain tuple. callback (`Callable`, *optional*): A function that will be called every `callback_steps` steps during inference. The function will be called with the following arguments: `callback(step: int, timestep: int, latents: torch.FloatTensor)`. callback_steps (`int`, *optional*, defaults to 1): The frequency at which the `callback` function will be called. If not specified, the callback will be called at every step. Returns: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] or `tuple`: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] if `return_dict` is True, otherwise a `tuple. When returning a tuple, the first element is a list with the generated images, and the second element is a list of `bool`s denoting whether the corresponding generated image likely represents "not-safe-for-work" (nsfw) content, according to the `safety_checker`. """ # We use the input text to generate the mask inputs = self.segmentation_processor( text=[text], images=[image], padding="max_length", return_tensors="pt" ).to(self.device) outputs = self.segmentation_model(**inputs) mask = torch.sigmoid(outputs.logits).cpu().detach().unsqueeze(-1).numpy() mask_pil = self.numpy_to_pil(mask)[0].resize(image.size) # Run inpainting pipeline with the generated mask inpainting_pipeline = StableDiffusionInpaintPipeline( vae=self.vae, text_encoder=self.text_encoder, tokenizer=self.tokenizer, unet=self.unet, scheduler=self.scheduler, safety_checker=self.safety_checker, feature_extractor=self.feature_extractor, ) return inpainting_pipeline( prompt=prompt, image=image, mask_image=mask_pil, height=height, width=width, num_inference_steps=num_inference_steps, guidance_scale=guidance_scale, negative_prompt=negative_prompt, num_images_per_prompt=num_images_per_prompt, eta=eta, generator=generator, latents=latents, output_type=output_type, return_dict=return_dict, callback=callback, callback_steps=callback_steps, )
diffusers/examples/community/text_inpainting.py/0
{ "file_path": "diffusers/examples/community/text_inpainting.py", "repo_id": "diffusers", "token_count": 6667 }
101
# ControlNet training example for Stable Diffusion XL (SDXL) The `train_controlnet_sdxl.py` script shows how to implement the ControlNet training procedure and adapt it for [Stable Diffusion XL](https://huggingface.co/papers/2307.01952). ## Running locally with PyTorch ### Installing the dependencies Before running the scripts, make sure to install the library's training dependencies: **Important** To make sure you can successfully run the latest versions of the example scripts, we highly recommend **installing from source** and keeping the install up to date as we update the example scripts frequently and install some example-specific requirements. To do this, execute the following steps in a new virtual environment: ```bash git clone https://github.com/huggingface/diffusers cd diffusers pip install -e . ``` Then cd in the `examples/controlnet` folder and run ```bash pip install -r requirements_sdxl.txt ``` And initialize an [๐Ÿค—Accelerate](https://github.com/huggingface/accelerate/) environment with: ```bash accelerate config ``` Or for a default accelerate configuration without answering questions about your environment ```bash accelerate config default ``` Or if your environment doesn't support an interactive shell (e.g., a notebook) ```python from accelerate.utils import write_basic_config write_basic_config() ``` When running `accelerate config`, if we specify torch compile mode to True there can be dramatic speedups. ## Circle filling dataset The original dataset is hosted in the [ControlNet repo](https://huggingface.co/lllyasviel/ControlNet/blob/main/training/fill50k.zip). We re-uploaded it to be compatible with `datasets` [here](https://huggingface.co/datasets/fusing/fill50k). Note that `datasets` handles dataloading within the training script. ## Training Our training examples use two test conditioning images. They can be downloaded by running ```sh wget https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/diffusers/controlnet_training/conditioning_image_1.png wget https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/diffusers/controlnet_training/conditioning_image_2.png ``` Then run `huggingface-cli login` to log into your Hugging Face account. This is needed to be able to push the trained ControlNet parameters to Hugging Face Hub. ```bash export MODEL_DIR="stabilityai/stable-diffusion-xl-base-1.0" export OUTPUT_DIR="path to save model" accelerate launch train_controlnet_sdxl.py \ --pretrained_model_name_or_path=$MODEL_DIR \ --output_dir=$OUTPUT_DIR \ --dataset_name=fusing/fill50k \ --mixed_precision="fp16" \ --resolution=1024 \ --learning_rate=1e-5 \ --max_train_steps=15000 \ --validation_image "./conditioning_image_1.png" "./conditioning_image_2.png" \ --validation_prompt "red circle with blue background" "cyan circle with brown floral background" \ --validation_steps=100 \ --train_batch_size=1 \ --gradient_accumulation_steps=4 \ --report_to="wandb" \ --seed=42 \ --push_to_hub ``` To better track our training experiments, we're using the following flags in the command above: * `report_to="wandb` will ensure the training runs are tracked on Weights and Biases. To use it, be sure to install `wandb` with `pip install wandb`. * `validation_image`, `validation_prompt`, and `validation_steps` to allow the script to do a few validation inference runs. This allows us to qualitatively check if the training is progressing as expected. Our experiments were conducted on a single 40GB A100 GPU. ### Inference Once training is done, we can perform inference like so: ```python from diffusers import StableDiffusionXLControlNetPipeline, ControlNetModel, UniPCMultistepScheduler from diffusers.utils import load_image import torch base_model_path = "stabilityai/stable-diffusion-xl-base-1.0" controlnet_path = "path to controlnet" controlnet = ControlNetModel.from_pretrained(controlnet_path, torch_dtype=torch.float16) pipe = StableDiffusionXLControlNetPipeline.from_pretrained( base_model_path, controlnet=controlnet, torch_dtype=torch.float16 ) # speed up diffusion process with faster scheduler and memory optimization pipe.scheduler = UniPCMultistepScheduler.from_config(pipe.scheduler.config) # remove following line if xformers is not installed or when using Torch 2.0. pipe.enable_xformers_memory_efficient_attention() # memory optimization. pipe.enable_model_cpu_offload() control_image = load_image("./conditioning_image_1.png") prompt = "pale golden rod circle with old lace background" # generate image generator = torch.manual_seed(0) image = pipe( prompt, num_inference_steps=20, generator=generator, image=control_image ).images[0] image.save("./output.png") ``` ## Notes ### Specifying a better VAE SDXL's VAE is known to suffer from numerical instability issues. This is why we also expose a CLI argument namely `--pretrained_vae_model_name_or_path` that lets you specify the location of a better VAE (such as [this one](https://huggingface.co/madebyollin/sdxl-vae-fp16-fix)).
diffusers/examples/controlnet/README_sdxl.md/0
{ "file_path": "diffusers/examples/controlnet/README_sdxl.md", "repo_id": "diffusers", "token_count": 1519 }
102
#!/usr/bin/env python # coding=utf-8 # Copyright 2023 Harutatsu Akiyama and The HuggingFace Inc. team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import argparse import logging import math import os import shutil import warnings from pathlib import Path from urllib.parse import urlparse import accelerate import datasets import numpy as np import PIL import torch import torch.nn as nn import torch.nn.functional as F import torch.utils.checkpoint import transformers from accelerate import Accelerator from accelerate.logging import get_logger from accelerate.utils import ProjectConfiguration, set_seed from datasets import load_dataset from huggingface_hub import create_repo, upload_folder from packaging import version from PIL import Image from torchvision import transforms from tqdm.auto import tqdm from transformers import AutoTokenizer, PretrainedConfig import diffusers from diffusers import AutoencoderKL, DDPMScheduler, UNet2DConditionModel from diffusers.optimization import get_scheduler from diffusers.pipelines.stable_diffusion_xl.pipeline_stable_diffusion_xl_instruct_pix2pix import ( StableDiffusionXLInstructPix2PixPipeline, ) from diffusers.training_utils import EMAModel from diffusers.utils import check_min_version, deprecate, is_wandb_available, load_image from diffusers.utils.import_utils import is_xformers_available from diffusers.utils.torch_utils import is_compiled_module if is_wandb_available(): import wandb # Will error if the minimal version of diffusers is not installed. Remove at your own risks. check_min_version("0.26.0.dev0") logger = get_logger(__name__, log_level="INFO") DATASET_NAME_MAPPING = { "fusing/instructpix2pix-1000-samples": ("file_name", "edited_image", "edit_prompt"), } WANDB_TABLE_COL_NAMES = ["file_name", "edited_image", "edit_prompt"] TORCH_DTYPE_MAPPING = {"fp32": torch.float32, "fp16": torch.float16, "bf16": torch.bfloat16} def log_validation( pipeline, args, accelerator, generator, global_step, is_final_validation=False, ): logger.info( f"Running validation... \n Generating {args.num_validation_images} images with prompt:" f" {args.validation_prompt}." ) pipeline = pipeline.to(accelerator.device) pipeline.set_progress_bar_config(disable=True) val_save_dir = os.path.join(args.output_dir, "validation_images") if not os.path.exists(val_save_dir): os.makedirs(val_save_dir) original_image = ( lambda image_url_or_path: load_image(image_url_or_path) if urlparse(image_url_or_path).scheme else Image.open(image_url_or_path).convert("RGB") )(args.val_image_url_or_path) with torch.autocast(str(accelerator.device).replace(":0", ""), enabled=accelerator.mixed_precision == "fp16"): edited_images = [] # Run inference for val_img_idx in range(args.num_validation_images): a_val_img = pipeline( args.validation_prompt, image=original_image, num_inference_steps=20, image_guidance_scale=1.5, guidance_scale=7, generator=generator, ).images[0] edited_images.append(a_val_img) # Save validation images a_val_img.save(os.path.join(val_save_dir, f"step_{global_step}_val_img_{val_img_idx}.png")) for tracker in accelerator.trackers: if tracker.name == "wandb": wandb_table = wandb.Table(columns=WANDB_TABLE_COL_NAMES) for edited_image in edited_images: wandb_table.add_data(wandb.Image(original_image), wandb.Image(edited_image), args.validation_prompt) logger_name = "test" if is_final_validation else "validation" tracker.log({logger_name: wandb_table}) def import_model_class_from_model_name_or_path( pretrained_model_name_or_path: str, revision: str, subfolder: str = "text_encoder" ): text_encoder_config = PretrainedConfig.from_pretrained( pretrained_model_name_or_path, subfolder=subfolder, revision=revision ) model_class = text_encoder_config.architectures[0] if model_class == "CLIPTextModel": from transformers import CLIPTextModel return CLIPTextModel elif model_class == "CLIPTextModelWithProjection": from transformers import CLIPTextModelWithProjection return CLIPTextModelWithProjection else: raise ValueError(f"{model_class} is not supported.") def parse_args(): parser = argparse.ArgumentParser(description="Script to train Stable Diffusion XL for InstructPix2Pix.") parser.add_argument( "--pretrained_model_name_or_path", type=str, default=None, required=True, help="Path to pretrained model or model identifier from huggingface.co/models.", ) parser.add_argument( "--pretrained_vae_model_name_or_path", type=str, default=None, help="Path to an improved VAE to stabilize training. For more details check out: https://github.com/huggingface/diffusers/pull/4038.", ) parser.add_argument( "--vae_precision", type=str, choices=["fp32", "fp16", "bf16"], default="fp32", help=( "The vanilla SDXL 1.0 VAE can cause NaNs due to large activation values. Some custom models might already have a solution" " to this problem, and this flag allows you to use mixed precision to stabilize training." ), ) parser.add_argument( "--revision", type=str, default=None, required=False, help="Revision of pretrained model identifier from huggingface.co/models.", ) parser.add_argument( "--variant", type=str, default=None, help="Variant of the model files of the pretrained model identifier from huggingface.co/models, 'e.g.' fp16", ) parser.add_argument( "--dataset_name", type=str, default=None, help=( "The name of the Dataset (from the HuggingFace hub) to train on (could be your own, possibly private," " dataset). It can also be a path pointing to a local copy of a dataset in your filesystem," " or to a folder containing files that ๐Ÿค— Datasets can understand." ), ) parser.add_argument( "--dataset_config_name", type=str, default=None, help="The config of the Dataset, leave as None if there's only one config.", ) parser.add_argument( "--train_data_dir", type=str, default=None, help=( "A folder containing the training data. Folder contents must follow the structure described in" " https://huggingface.co/docs/datasets/image_dataset#imagefolder. In particular, a `metadata.jsonl` file" " must exist to provide the captions for the images. Ignored if `dataset_name` is specified." ), ) parser.add_argument( "--original_image_column", type=str, default="input_image", help="The column of the dataset containing the original image on which edits where made.", ) parser.add_argument( "--edited_image_column", type=str, default="edited_image", help="The column of the dataset containing the edited image.", ) parser.add_argument( "--edit_prompt_column", type=str, default="edit_prompt", help="The column of the dataset containing the edit instruction.", ) parser.add_argument( "--val_image_url_or_path", type=str, default=None, help="URL to the original image that you would like to edit (used during inference for debugging purposes).", ) parser.add_argument( "--validation_prompt", type=str, default=None, help="A prompt that is sampled during training for inference." ) parser.add_argument( "--num_validation_images", type=int, default=4, help="Number of images that should be generated during validation with `validation_prompt`.", ) parser.add_argument( "--validation_steps", type=int, default=100, help=( "Run fine-tuning validation every X steps. The validation process consists of running the prompt" " `args.validation_prompt` multiple times: `args.num_validation_images`." ), ) parser.add_argument( "--max_train_samples", type=int, default=None, help=( "For debugging purposes or quicker training, truncate the number of training examples to this " "value if set." ), ) parser.add_argument( "--output_dir", type=str, default="instruct-pix2pix-model", help="The output directory where the model predictions and checkpoints will be written.", ) parser.add_argument( "--cache_dir", type=str, default=None, help="The directory where the downloaded models and datasets will be stored.", ) parser.add_argument("--seed", type=int, default=None, help="A seed for reproducible training.") parser.add_argument( "--resolution", type=int, default=256, help=( "The resolution for input images, all the images in the train/validation dataset will be resized to this resolution." ), ) parser.add_argument( "--crops_coords_top_left_h", type=int, default=0, help=("Coordinate for (the height) to be included in the crop coordinate embeddings needed by SDXL UNet."), ) parser.add_argument( "--crops_coords_top_left_w", type=int, default=0, help=("Coordinate for (the height) to be included in the crop coordinate embeddings needed by SDXL UNet."), ) parser.add_argument( "--center_crop", default=False, action="store_true", help=( "Whether to center crop the input images to the resolution. If not set, the images will be randomly" " cropped. The images will be resized to the resolution first before cropping." ), ) parser.add_argument( "--random_flip", action="store_true", help="whether to randomly flip images horizontally", ) parser.add_argument( "--train_batch_size", type=int, default=16, help="Batch size (per device) for the training dataloader." ) parser.add_argument("--num_train_epochs", type=int, default=100) parser.add_argument( "--max_train_steps", type=int, default=None, help="Total number of training steps to perform. If provided, overrides num_train_epochs.", ) parser.add_argument( "--gradient_accumulation_steps", type=int, default=1, help="Number of updates steps to accumulate before performing a backward/update pass.", ) parser.add_argument( "--gradient_checkpointing", action="store_true", help="Whether or not to use gradient checkpointing to save memory at the expense of slower backward pass.", ) parser.add_argument( "--learning_rate", type=float, default=1e-4, help="Initial learning rate (after the potential warmup period) to use.", ) parser.add_argument( "--scale_lr", action="store_true", default=False, help="Scale the learning rate by the number of GPUs, gradient accumulation steps, and batch size.", ) parser.add_argument( "--lr_scheduler", type=str, default="constant", help=( 'The scheduler type to use. Choose between ["linear", "cosine", "cosine_with_restarts", "polynomial",' ' "constant", "constant_with_warmup"]' ), ) parser.add_argument( "--lr_warmup_steps", type=int, default=500, help="Number of steps for the warmup in the lr scheduler." ) parser.add_argument( "--conditioning_dropout_prob", type=float, default=None, help="Conditioning dropout probability. Drops out the conditionings (image and edit prompt) used in training InstructPix2Pix. See section 3.2.1 in the paper: https://arxiv.org/abs/2211.09800.", ) parser.add_argument( "--use_8bit_adam", action="store_true", help="Whether or not to use 8-bit Adam from bitsandbytes." ) parser.add_argument( "--allow_tf32", action="store_true", help=( "Whether or not to allow TF32 on Ampere GPUs. Can be used to speed up training. For more information, see" " https://pytorch.org/docs/stable/notes/cuda.html#tensorfloat-32-tf32-on-ampere-devices" ), ) parser.add_argument("--use_ema", action="store_true", help="Whether to use EMA model.") parser.add_argument( "--non_ema_revision", type=str, default=None, required=False, help=( "Revision of pretrained non-ema model identifier. Must be a branch, tag or git identifier of the local or" " remote repository specified with --pretrained_model_name_or_path." ), ) parser.add_argument( "--dataloader_num_workers", type=int, default=0, help=( "Number of subprocesses to use for data loading. 0 means that the data will be loaded in the main process." ), ) parser.add_argument("--adam_beta1", type=float, default=0.9, help="The beta1 parameter for the Adam optimizer.") parser.add_argument("--adam_beta2", type=float, default=0.999, help="The beta2 parameter for the Adam optimizer.") parser.add_argument("--adam_weight_decay", type=float, default=1e-2, help="Weight decay to use.") parser.add_argument("--adam_epsilon", type=float, default=1e-08, help="Epsilon value for the Adam optimizer") parser.add_argument("--max_grad_norm", default=1.0, type=float, help="Max gradient norm.") parser.add_argument("--push_to_hub", action="store_true", help="Whether or not to push the model to the Hub.") parser.add_argument("--hub_token", type=str, default=None, help="The token to use to push to the Model Hub.") parser.add_argument( "--hub_model_id", type=str, default=None, help="The name of the repository to keep in sync with the local `output_dir`.", ) parser.add_argument( "--logging_dir", type=str, default="logs", help=( "[TensorBoard](https://www.tensorflow.org/tensorboard) log directory. Will default to" " *output_dir/runs/**CURRENT_DATETIME_HOSTNAME***." ), ) parser.add_argument( "--mixed_precision", type=str, default=None, choices=["no", "fp16", "bf16"], help=( "Whether to use mixed precision. Choose between fp16 and bf16 (bfloat16). Bf16 requires PyTorch >=" " 1.10.and an Nvidia Ampere GPU. Default to the value of accelerate config of the current system or the" " flag passed with the `accelerate.launch` command. Use this argument to override the accelerate config." ), ) parser.add_argument( "--report_to", type=str, default="tensorboard", help=( 'The integration to report the results and logs to. Supported platforms are `"tensorboard"`' ' (default), `"wandb"` and `"comet_ml"`. Use `"all"` to report to all integrations.' ), ) parser.add_argument("--local_rank", type=int, default=-1, help="For distributed training: local_rank") parser.add_argument( "--checkpointing_steps", type=int, default=500, help=( "Save a checkpoint of the training state every X updates. These checkpoints are only suitable for resuming" " training using `--resume_from_checkpoint`." ), ) parser.add_argument( "--checkpoints_total_limit", type=int, default=None, help=("Max number of checkpoints to store."), ) parser.add_argument( "--resume_from_checkpoint", type=str, default=None, help=( "Whether training should be resumed from a previous checkpoint. Use a path saved by" ' `--checkpointing_steps`, or `"latest"` to automatically select the last available checkpoint.' ), ) parser.add_argument( "--enable_xformers_memory_efficient_attention", action="store_true", help="Whether or not to use xformers." ) args = parser.parse_args() env_local_rank = int(os.environ.get("LOCAL_RANK", -1)) if env_local_rank != -1 and env_local_rank != args.local_rank: args.local_rank = env_local_rank # Sanity checks if args.dataset_name is None and args.train_data_dir is None: raise ValueError("Need either a dataset name or a training folder.") # default to using the same revision for the non-ema model if not specified if args.non_ema_revision is None: args.non_ema_revision = args.revision return args def convert_to_np(image, resolution): if isinstance(image, str): image = PIL.Image.open(image) image = image.convert("RGB").resize((resolution, resolution)) return np.array(image).transpose(2, 0, 1) def main(): args = parse_args() if args.non_ema_revision is not None: deprecate( "non_ema_revision!=None", "0.15.0", message=( "Downloading 'non_ema' weights from revision branches of the Hub is deprecated. Please make sure to" " use `--variant=non_ema` instead." ), ) logging_dir = os.path.join(args.output_dir, args.logging_dir) accelerator_project_config = ProjectConfiguration(project_dir=args.output_dir, logging_dir=logging_dir) accelerator = Accelerator( gradient_accumulation_steps=args.gradient_accumulation_steps, mixed_precision=args.mixed_precision, log_with=args.report_to, project_config=accelerator_project_config, ) generator = torch.Generator(device=accelerator.device).manual_seed(args.seed) # Make one log on every process with the configuration for debugging. logging.basicConfig( format="%(asctime)s - %(levelname)s - %(name)s - %(message)s", datefmt="%m/%d/%Y %H:%M:%S", level=logging.INFO, ) logger.info(accelerator.state, main_process_only=False) if accelerator.is_local_main_process: datasets.utils.logging.set_verbosity_warning() transformers.utils.logging.set_verbosity_warning() diffusers.utils.logging.set_verbosity_info() else: datasets.utils.logging.set_verbosity_error() transformers.utils.logging.set_verbosity_error() diffusers.utils.logging.set_verbosity_error() # If passed along, set the training seed now. if args.seed is not None: set_seed(args.seed) # Handle the repository creation if accelerator.is_main_process: if args.output_dir is not None: os.makedirs(args.output_dir, exist_ok=True) if args.push_to_hub: repo_id = create_repo( repo_id=args.hub_model_id or Path(args.output_dir).name, exist_ok=True, token=args.hub_token ).repo_id vae_path = ( args.pretrained_model_name_or_path if args.pretrained_vae_model_name_or_path is None else args.pretrained_vae_model_name_or_path ) vae = AutoencoderKL.from_pretrained( vae_path, subfolder="vae" if args.pretrained_vae_model_name_or_path is None else None, revision=args.revision, variant=args.variant, ) unet = UNet2DConditionModel.from_pretrained( args.pretrained_model_name_or_path, subfolder="unet", revision=args.revision, variant=args.variant ) # InstructPix2Pix uses an additional image for conditioning. To accommodate that, # it uses 8 channels (instead of 4) in the first (conv) layer of the UNet. This UNet is # then fine-tuned on the custom InstructPix2Pix dataset. This modified UNet is initialized # from the pre-trained checkpoints. For the extra channels added to the first layer, they are # initialized to zero. logger.info("Initializing the XL InstructPix2Pix UNet from the pretrained UNet.") in_channels = 8 out_channels = unet.conv_in.out_channels unet.register_to_config(in_channels=in_channels) with torch.no_grad(): new_conv_in = nn.Conv2d( in_channels, out_channels, unet.conv_in.kernel_size, unet.conv_in.stride, unet.conv_in.padding ) new_conv_in.weight.zero_() new_conv_in.weight[:, :4, :, :].copy_(unet.conv_in.weight) unet.conv_in = new_conv_in # Create EMA for the unet. if args.use_ema: ema_unet = EMAModel(unet.parameters(), model_cls=UNet2DConditionModel, model_config=unet.config) if args.enable_xformers_memory_efficient_attention: if is_xformers_available(): import xformers xformers_version = version.parse(xformers.__version__) if xformers_version == version.parse("0.0.16"): logger.warn( "xFormers 0.0.16 cannot be used for training in some GPUs. If you observe problems during training, please update xFormers to at least 0.0.17. See https://huggingface.co/docs/diffusers/main/en/optimization/xformers for more details." ) unet.enable_xformers_memory_efficient_attention() else: raise ValueError("xformers is not available. Make sure it is installed correctly") def unwrap_model(model): model = accelerator.unwrap_model(model) model = model._orig_mod if is_compiled_module(model) else model return model # `accelerate` 0.16.0 will have better support for customized saving if version.parse(accelerate.__version__) >= version.parse("0.16.0"): # create custom saving & loading hooks so that `accelerator.save_state(...)` serializes in a nice format def save_model_hook(models, weights, output_dir): if accelerator.is_main_process: if args.use_ema: ema_unet.save_pretrained(os.path.join(output_dir, "unet_ema")) for i, model in enumerate(models): model.save_pretrained(os.path.join(output_dir, "unet")) # make sure to pop weight so that corresponding model is not saved again weights.pop() def load_model_hook(models, input_dir): if args.use_ema: load_model = EMAModel.from_pretrained(os.path.join(input_dir, "unet_ema"), UNet2DConditionModel) ema_unet.load_state_dict(load_model.state_dict()) ema_unet.to(accelerator.device) del load_model for i in range(len(models)): # pop models so that they are not loaded again model = models.pop() # load diffusers style into model load_model = UNet2DConditionModel.from_pretrained(input_dir, subfolder="unet") model.register_to_config(**load_model.config) model.load_state_dict(load_model.state_dict()) del load_model accelerator.register_save_state_pre_hook(save_model_hook) accelerator.register_load_state_pre_hook(load_model_hook) if args.gradient_checkpointing: unet.enable_gradient_checkpointing() # Enable TF32 for faster training on Ampere GPUs, # cf https://pytorch.org/docs/stable/notes/cuda.html#tensorfloat-32-tf32-on-ampere-devices if args.allow_tf32: torch.backends.cuda.matmul.allow_tf32 = True if args.scale_lr: args.learning_rate = ( args.learning_rate * args.gradient_accumulation_steps * args.train_batch_size * accelerator.num_processes ) # Initialize the optimizer if args.use_8bit_adam: try: import bitsandbytes as bnb except ImportError: raise ImportError( "Please install bitsandbytes to use 8-bit Adam. You can do so by running `pip install bitsandbytes`" ) optimizer_cls = bnb.optim.AdamW8bit else: optimizer_cls = torch.optim.AdamW optimizer = optimizer_cls( unet.parameters(), lr=args.learning_rate, betas=(args.adam_beta1, args.adam_beta2), weight_decay=args.adam_weight_decay, eps=args.adam_epsilon, ) # Get the datasets: you can either provide your own training and evaluation files (see below) # or specify a Dataset from the hub (the dataset will be downloaded automatically from the datasets Hub). # In distributed training, the load_dataset function guarantees that only one local process can concurrently # download the dataset. if args.dataset_name is not None: # Downloading and loading a dataset from the hub. dataset = load_dataset( args.dataset_name, args.dataset_config_name, cache_dir=args.cache_dir, ) else: data_files = {} if args.train_data_dir is not None: data_files["train"] = os.path.join(args.train_data_dir, "**") dataset = load_dataset( "imagefolder", data_files=data_files, cache_dir=args.cache_dir, ) # See more about loading custom images at # https://huggingface.co/docs/datasets/main/en/image_load#imagefolder # Preprocessing the datasets. # We need to tokenize inputs and targets. column_names = dataset["train"].column_names # 6. Get the column names for input/target. dataset_columns = DATASET_NAME_MAPPING.get(args.dataset_name, None) if args.original_image_column is None: original_image_column = dataset_columns[0] if dataset_columns is not None else column_names[0] else: original_image_column = args.original_image_column if original_image_column not in column_names: raise ValueError( f"--original_image_column' value '{args.original_image_column}' needs to be one of: {', '.join(column_names)}" ) if args.edit_prompt_column is None: edit_prompt_column = dataset_columns[1] if dataset_columns is not None else column_names[1] else: edit_prompt_column = args.edit_prompt_column if edit_prompt_column not in column_names: raise ValueError( f"--edit_prompt_column' value '{args.edit_prompt_column}' needs to be one of: {', '.join(column_names)}" ) if args.edited_image_column is None: edited_image_column = dataset_columns[2] if dataset_columns is not None else column_names[2] else: edited_image_column = args.edited_image_column if edited_image_column not in column_names: raise ValueError( f"--edited_image_column' value '{args.edited_image_column}' needs to be one of: {', '.join(column_names)}" ) # For mixed precision training we cast the text_encoder and vae weights to half-precision # as these models are only used for inference, keeping weights in full precision is not required. weight_dtype = torch.float32 if accelerator.mixed_precision == "fp16": weight_dtype = torch.float16 warnings.warn(f"weight_dtype {weight_dtype} may cause nan during vae encoding", UserWarning) elif accelerator.mixed_precision == "bf16": weight_dtype = torch.bfloat16 warnings.warn(f"weight_dtype {weight_dtype} may cause nan during vae encoding", UserWarning) # Preprocessing the datasets. # We need to tokenize input captions and transform the images. def tokenize_captions(captions, tokenizer): inputs = tokenizer( captions, max_length=tokenizer.model_max_length, padding="max_length", truncation=True, return_tensors="pt", ) return inputs.input_ids # Preprocessing the datasets. train_transforms = transforms.Compose( [ transforms.CenterCrop(args.resolution) if args.center_crop else transforms.RandomCrop(args.resolution), transforms.RandomHorizontalFlip() if args.random_flip else transforms.Lambda(lambda x: x), ] ) def preprocess_images(examples): original_images = np.concatenate( [convert_to_np(image, args.resolution) for image in examples[original_image_column]] ) edited_images = np.concatenate( [convert_to_np(image, args.resolution) for image in examples[edited_image_column]] ) # We need to ensure that the original and the edited images undergo the same # augmentation transforms. images = np.concatenate([original_images, edited_images]) images = torch.tensor(images) images = 2 * (images / 255) - 1 return train_transforms(images) # Load scheduler, tokenizer and models. tokenizer_1 = AutoTokenizer.from_pretrained( args.pretrained_model_name_or_path, subfolder="tokenizer", revision=args.revision, use_fast=False, ) tokenizer_2 = AutoTokenizer.from_pretrained( args.pretrained_model_name_or_path, subfolder="tokenizer_2", revision=args.revision, use_fast=False, ) text_encoder_cls_1 = import_model_class_from_model_name_or_path(args.pretrained_model_name_or_path, args.revision) text_encoder_cls_2 = import_model_class_from_model_name_or_path( args.pretrained_model_name_or_path, args.revision, subfolder="text_encoder_2" ) # Load scheduler and models noise_scheduler = DDPMScheduler.from_pretrained(args.pretrained_model_name_or_path, subfolder="scheduler") text_encoder_1 = text_encoder_cls_1.from_pretrained( args.pretrained_model_name_or_path, subfolder="text_encoder", revision=args.revision, variant=args.variant ) text_encoder_2 = text_encoder_cls_2.from_pretrained( args.pretrained_model_name_or_path, subfolder="text_encoder_2", revision=args.revision, variant=args.variant ) # We ALWAYS pre-compute the additional condition embeddings needed for SDXL # UNet as the model is already big and it uses two text encoders. text_encoder_1.to(accelerator.device, dtype=weight_dtype) text_encoder_2.to(accelerator.device, dtype=weight_dtype) tokenizers = [tokenizer_1, tokenizer_2] text_encoders = [text_encoder_1, text_encoder_2] # Freeze vae and text_encoders vae.requires_grad_(False) text_encoder_1.requires_grad_(False) text_encoder_2.requires_grad_(False) # Set UNet to trainable. unet.train() # Adapted from pipelines.StableDiffusionXLPipeline.encode_prompt def encode_prompt(text_encoders, tokenizers, prompt): prompt_embeds_list = [] for tokenizer, text_encoder in zip(tokenizers, text_encoders): text_inputs = tokenizer( prompt, padding="max_length", max_length=tokenizer.model_max_length, truncation=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal( text_input_ids, untruncated_ids ): removed_text = tokenizer.batch_decode(untruncated_ids[:, tokenizer.model_max_length - 1 : -1]) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {tokenizer.model_max_length} tokens: {removed_text}" ) prompt_embeds = text_encoder( text_input_ids.to(text_encoder.device), output_hidden_states=True, ) # We are only ALWAYS interested in the pooled output of the final text encoder pooled_prompt_embeds = prompt_embeds[0] prompt_embeds = prompt_embeds.hidden_states[-2] bs_embed, seq_len, _ = prompt_embeds.shape prompt_embeds = prompt_embeds.view(bs_embed, seq_len, -1) prompt_embeds_list.append(prompt_embeds) prompt_embeds = torch.concat(prompt_embeds_list, dim=-1) pooled_prompt_embeds = pooled_prompt_embeds.view(bs_embed, -1) return prompt_embeds, pooled_prompt_embeds # Adapted from pipelines.StableDiffusionXLPipeline.encode_prompt def encode_prompts(text_encoders, tokenizers, prompts): prompt_embeds_all = [] pooled_prompt_embeds_all = [] for prompt in prompts: prompt_embeds, pooled_prompt_embeds = encode_prompt(text_encoders, tokenizers, prompt) prompt_embeds_all.append(prompt_embeds) pooled_prompt_embeds_all.append(pooled_prompt_embeds) return torch.stack(prompt_embeds_all), torch.stack(pooled_prompt_embeds_all) # Adapted from examples.dreambooth.train_dreambooth_lora_sdxl # Here, we compute not just the text embeddings but also the additional embeddings # needed for the SD XL UNet to operate. def compute_embeddings_for_prompts(prompts, text_encoders, tokenizers): with torch.no_grad(): prompt_embeds_all, pooled_prompt_embeds_all = encode_prompts(text_encoders, tokenizers, prompts) add_text_embeds_all = pooled_prompt_embeds_all prompt_embeds_all = prompt_embeds_all.to(accelerator.device) add_text_embeds_all = add_text_embeds_all.to(accelerator.device) return prompt_embeds_all, add_text_embeds_all # Get null conditioning def compute_null_conditioning(): null_conditioning_list = [] for a_tokenizer, a_text_encoder in zip(tokenizers, text_encoders): null_conditioning_list.append( a_text_encoder( tokenize_captions([""], tokenizer=a_tokenizer).to(accelerator.device), output_hidden_states=True, ).hidden_states[-2] ) return torch.concat(null_conditioning_list, dim=-1) null_conditioning = compute_null_conditioning() def compute_time_ids(): crops_coords_top_left = (args.crops_coords_top_left_h, args.crops_coords_top_left_w) original_size = target_size = (args.resolution, args.resolution) add_time_ids = list(original_size + crops_coords_top_left + target_size) add_time_ids = torch.tensor([add_time_ids], dtype=weight_dtype) return add_time_ids.to(accelerator.device).repeat(args.train_batch_size, 1) add_time_ids = compute_time_ids() def preprocess_train(examples): # Preprocess images. preprocessed_images = preprocess_images(examples) # Since the original and edited images were concatenated before # applying the transformations, we need to separate them and reshape # them accordingly. original_images, edited_images = preprocessed_images.chunk(2) original_images = original_images.reshape(-1, 3, args.resolution, args.resolution) edited_images = edited_images.reshape(-1, 3, args.resolution, args.resolution) # Collate the preprocessed images into the `examples`. examples["original_pixel_values"] = original_images examples["edited_pixel_values"] = edited_images # Preprocess the captions. captions = list(examples[edit_prompt_column]) prompt_embeds_all, add_text_embeds_all = compute_embeddings_for_prompts(captions, text_encoders, tokenizers) examples["prompt_embeds"] = prompt_embeds_all examples["add_text_embeds"] = add_text_embeds_all return examples with accelerator.main_process_first(): if args.max_train_samples is not None: dataset["train"] = dataset["train"].shuffle(seed=args.seed).select(range(args.max_train_samples)) # Set the training transforms train_dataset = dataset["train"].with_transform(preprocess_train) def collate_fn(examples): original_pixel_values = torch.stack([example["original_pixel_values"] for example in examples]) original_pixel_values = original_pixel_values.to(memory_format=torch.contiguous_format).float() edited_pixel_values = torch.stack([example["edited_pixel_values"] for example in examples]) edited_pixel_values = edited_pixel_values.to(memory_format=torch.contiguous_format).float() prompt_embeds = torch.concat([example["prompt_embeds"] for example in examples], dim=0) add_text_embeds = torch.concat([example["add_text_embeds"] for example in examples], dim=0) return { "original_pixel_values": original_pixel_values, "edited_pixel_values": edited_pixel_values, "prompt_embeds": prompt_embeds, "add_text_embeds": add_text_embeds, } # DataLoaders creation: train_dataloader = torch.utils.data.DataLoader( train_dataset, shuffle=True, collate_fn=collate_fn, batch_size=args.train_batch_size, num_workers=args.dataloader_num_workers, ) # Scheduler and math around the number of training steps. overrode_max_train_steps = False num_update_steps_per_epoch = math.ceil(len(train_dataloader) / args.gradient_accumulation_steps) if args.max_train_steps is None: args.max_train_steps = args.num_train_epochs * num_update_steps_per_epoch overrode_max_train_steps = True lr_scheduler = get_scheduler( args.lr_scheduler, optimizer=optimizer, num_warmup_steps=args.lr_warmup_steps * args.gradient_accumulation_steps, num_training_steps=args.max_train_steps * args.gradient_accumulation_steps, ) # Prepare everything with our `accelerator`. unet, optimizer, train_dataloader, lr_scheduler = accelerator.prepare( unet, optimizer, train_dataloader, lr_scheduler ) if args.use_ema: ema_unet.to(accelerator.device) # Move vae, unet and text_encoder to device and cast to weight_dtype # The VAE is in float32 to avoid NaN losses. if args.pretrained_vae_model_name_or_path is not None: vae.to(accelerator.device, dtype=weight_dtype) else: vae.to(accelerator.device, dtype=TORCH_DTYPE_MAPPING[args.vae_precision]) # We need to recalculate our total training steps as the size of the training dataloader may have changed. num_update_steps_per_epoch = math.ceil(len(train_dataloader) / args.gradient_accumulation_steps) if overrode_max_train_steps: args.max_train_steps = args.num_train_epochs * num_update_steps_per_epoch # Afterwards we recalculate our number of training epochs args.num_train_epochs = math.ceil(args.max_train_steps / num_update_steps_per_epoch) # We need to initialize the trackers we use, and also store our configuration. # The trackers initializes automatically on the main process. if accelerator.is_main_process: accelerator.init_trackers("instruct-pix2pix-xl", config=vars(args)) # Train! total_batch_size = args.train_batch_size * accelerator.num_processes * args.gradient_accumulation_steps logger.info("***** Running training *****") logger.info(f" Num examples = {len(train_dataset)}") logger.info(f" Num Epochs = {args.num_train_epochs}") logger.info(f" Instantaneous batch size per device = {args.train_batch_size}") logger.info(f" Total train batch size (w. parallel, distributed & accumulation) = {total_batch_size}") logger.info(f" Gradient Accumulation steps = {args.gradient_accumulation_steps}") logger.info(f" Total optimization steps = {args.max_train_steps}") global_step = 0 first_epoch = 0 # Potentially load in the weights and states from a previous save if args.resume_from_checkpoint: if args.resume_from_checkpoint != "latest": path = os.path.basename(args.resume_from_checkpoint) else: # Get the most recent checkpoint dirs = os.listdir(args.output_dir) dirs = [d for d in dirs if d.startswith("checkpoint")] dirs = sorted(dirs, key=lambda x: int(x.split("-")[1])) path = dirs[-1] if len(dirs) > 0 else None if path is None: accelerator.print( f"Checkpoint '{args.resume_from_checkpoint}' does not exist. Starting a new training run." ) args.resume_from_checkpoint = None initial_global_step = 0 else: accelerator.print(f"Resuming from checkpoint {path}") accelerator.load_state(os.path.join(args.output_dir, path)) global_step = int(path.split("-")[1]) initial_global_step = global_step first_epoch = global_step // num_update_steps_per_epoch else: initial_global_step = 0 progress_bar = tqdm( range(0, args.max_train_steps), initial=initial_global_step, desc="Steps", # Only show the progress bar once on each machine. disable=not accelerator.is_local_main_process, ) for epoch in range(first_epoch, args.num_train_epochs): train_loss = 0.0 for step, batch in enumerate(train_dataloader): with accelerator.accumulate(unet): # We want to learn the denoising process w.r.t the edited images which # are conditioned on the original image (which was edited) and the edit instruction. # So, first, convert images to latent space. if args.pretrained_vae_model_name_or_path is not None: edited_pixel_values = batch["edited_pixel_values"].to(dtype=weight_dtype) else: edited_pixel_values = batch["edited_pixel_values"] latents = vae.encode(edited_pixel_values).latent_dist.sample() latents = latents * vae.config.scaling_factor if args.pretrained_vae_model_name_or_path is None: latents = latents.to(weight_dtype) # Sample noise that we'll add to the latents noise = torch.randn_like(latents) bsz = latents.shape[0] # Sample a random timestep for each image timesteps = torch.randint(0, noise_scheduler.config.num_train_timesteps, (bsz,), device=latents.device) timesteps = timesteps.long() # Add noise to the latents according to the noise magnitude at each timestep # (this is the forward diffusion process) noisy_latents = noise_scheduler.add_noise(latents, noise, timesteps) # SDXL additional inputs encoder_hidden_states = batch["prompt_embeds"] add_text_embeds = batch["add_text_embeds"] # Get the additional image embedding for conditioning. # Instead of getting a diagonal Gaussian here, we simply take the mode. if args.pretrained_vae_model_name_or_path is not None: original_pixel_values = batch["original_pixel_values"].to(dtype=weight_dtype) else: original_pixel_values = batch["original_pixel_values"] original_image_embeds = vae.encode(original_pixel_values).latent_dist.sample() if args.pretrained_vae_model_name_or_path is None: original_image_embeds = original_image_embeds.to(weight_dtype) # Conditioning dropout to support classifier-free guidance during inference. For more details # check out the section 3.2.1 of the original paper https://arxiv.org/abs/2211.09800. if args.conditioning_dropout_prob is not None: random_p = torch.rand(bsz, device=latents.device, generator=generator) # Sample masks for the edit prompts. prompt_mask = random_p < 2 * args.conditioning_dropout_prob prompt_mask = prompt_mask.reshape(bsz, 1, 1) # Final text conditioning. encoder_hidden_states = torch.where(prompt_mask, null_conditioning, encoder_hidden_states) # Sample masks for the original images. image_mask_dtype = original_image_embeds.dtype image_mask = 1 - ( (random_p >= args.conditioning_dropout_prob).to(image_mask_dtype) * (random_p < 3 * args.conditioning_dropout_prob).to(image_mask_dtype) ) image_mask = image_mask.reshape(bsz, 1, 1, 1) # Final image conditioning. original_image_embeds = image_mask * original_image_embeds # Concatenate the `original_image_embeds` with the `noisy_latents`. concatenated_noisy_latents = torch.cat([noisy_latents, original_image_embeds], dim=1) # Get the target for loss depending on the prediction type if noise_scheduler.config.prediction_type == "epsilon": target = noise elif noise_scheduler.config.prediction_type == "v_prediction": target = noise_scheduler.get_velocity(latents, noise, timesteps) else: raise ValueError(f"Unknown prediction type {noise_scheduler.config.prediction_type}") # Predict the noise residual and compute loss added_cond_kwargs = {"text_embeds": add_text_embeds, "time_ids": add_time_ids} model_pred = unet( concatenated_noisy_latents, timesteps, encoder_hidden_states, added_cond_kwargs=added_cond_kwargs, return_dict=False, )[0] loss = F.mse_loss(model_pred.float(), target.float(), reduction="mean") # Gather the losses across all processes for logging (if we use distributed training). avg_loss = accelerator.gather(loss.repeat(args.train_batch_size)).mean() train_loss += avg_loss.item() / args.gradient_accumulation_steps # Backpropagate accelerator.backward(loss) if accelerator.sync_gradients: accelerator.clip_grad_norm_(unet.parameters(), args.max_grad_norm) optimizer.step() lr_scheduler.step() optimizer.zero_grad() # Checks if the accelerator has performed an optimization step behind the scenes if accelerator.sync_gradients: if args.use_ema: ema_unet.step(unet.parameters()) progress_bar.update(1) global_step += 1 accelerator.log({"train_loss": train_loss}, step=global_step) train_loss = 0.0 if global_step % args.checkpointing_steps == 0: if accelerator.is_main_process: # _before_ saving state, check if this save would set us over the `checkpoints_total_limit` if args.checkpoints_total_limit is not None: checkpoints = os.listdir(args.output_dir) checkpoints = [d for d in checkpoints if d.startswith("checkpoint")] checkpoints = sorted(checkpoints, key=lambda x: int(x.split("-")[1])) # before we save the new checkpoint, we need to have at _most_ `checkpoints_total_limit - 1` checkpoints if len(checkpoints) >= args.checkpoints_total_limit: num_to_remove = len(checkpoints) - args.checkpoints_total_limit + 1 removing_checkpoints = checkpoints[0:num_to_remove] logger.info( f"{len(checkpoints)} checkpoints already exist, removing {len(removing_checkpoints)} checkpoints" ) logger.info(f"removing checkpoints: {', '.join(removing_checkpoints)}") for removing_checkpoint in removing_checkpoints: removing_checkpoint = os.path.join(args.output_dir, removing_checkpoint) shutil.rmtree(removing_checkpoint) save_path = os.path.join(args.output_dir, f"checkpoint-{global_step}") accelerator.save_state(save_path) logger.info(f"Saved state to {save_path}") logs = {"step_loss": loss.detach().item(), "lr": lr_scheduler.get_last_lr()[0]} progress_bar.set_postfix(**logs) ### BEGIN: Perform validation every `validation_epochs` steps if global_step % args.validation_steps == 0: if (args.val_image_url_or_path is not None) and (args.validation_prompt is not None): # create pipeline if args.use_ema: # Store the UNet parameters temporarily and load the EMA parameters to perform inference. ema_unet.store(unet.parameters()) ema_unet.copy_to(unet.parameters()) # The models need unwrapping because for compatibility in distributed training mode. pipeline = StableDiffusionXLInstructPix2PixPipeline.from_pretrained( args.pretrained_model_name_or_path, unet=unwrap_model(unet), text_encoder=text_encoder_1, text_encoder_2=text_encoder_2, tokenizer=tokenizer_1, tokenizer_2=tokenizer_2, vae=vae, revision=args.revision, variant=args.variant, torch_dtype=weight_dtype, ) log_validation( pipeline, args, accelerator, generator, global_step, is_final_validation=False, ) if args.use_ema: # Switch back to the original UNet parameters. ema_unet.restore(unet.parameters()) del pipeline torch.cuda.empty_cache() ### END: Perform validation every `validation_epochs` steps if global_step >= args.max_train_steps: break # Create the pipeline using the trained modules and save it. accelerator.wait_for_everyone() if accelerator.is_main_process: if args.use_ema: ema_unet.copy_to(unet.parameters()) pipeline = StableDiffusionXLInstructPix2PixPipeline.from_pretrained( args.pretrained_model_name_or_path, text_encoder=text_encoder_1, text_encoder_2=text_encoder_2, tokenizer=tokenizer_1, tokenizer_2=tokenizer_2, vae=vae, unet=unwrap_model(unet), revision=args.revision, variant=args.variant, ) pipeline.save_pretrained(args.output_dir) if args.push_to_hub: upload_folder( repo_id=repo_id, folder_path=args.output_dir, commit_message="End of training", ignore_patterns=["step_*", "epoch_*"], ) if (args.val_image_url_or_path is not None) and (args.validation_prompt is not None): log_validation( pipeline, args, accelerator, generator, global_step, is_final_validation=True, ) accelerator.end_training() if __name__ == "__main__": main()
diffusers/examples/instruct_pix2pix/train_instruct_pix2pix_sdxl.py/0
{ "file_path": "diffusers/examples/instruct_pix2pix/train_instruct_pix2pix_sdxl.py", "repo_id": "diffusers", "token_count": 23213 }
103
#!/usr/bin/env python # coding=utf-8 # Copyright 2023 The HuggingFace Inc. team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and """Script to train a consistency model from scratch via (improved) consistency training.""" import argparse import gc import logging import math import os import shutil from datetime import timedelta from pathlib import Path import accelerate import datasets import numpy as np import torch from accelerate import Accelerator, InitProcessGroupKwargs from accelerate.logging import get_logger from accelerate.utils import ProjectConfiguration, set_seed from datasets import load_dataset from huggingface_hub import create_repo, upload_folder from packaging import version from torchvision import transforms from tqdm.auto import tqdm import diffusers from diffusers import ( CMStochasticIterativeScheduler, ConsistencyModelPipeline, UNet2DModel, ) from diffusers.optimization import get_scheduler from diffusers.training_utils import EMAModel, resolve_interpolation_mode from diffusers.utils import is_tensorboard_available, is_wandb_available from diffusers.utils.import_utils import is_xformers_available from diffusers.utils.torch_utils import is_compiled_module if is_wandb_available(): import wandb logger = get_logger(__name__, log_level="INFO") def _extract_into_tensor(arr, timesteps, broadcast_shape): """ Extract values from a 1-D numpy array for a batch of indices. :param arr: the 1-D numpy array. :param timesteps: a tensor of indices into the array to extract. :param broadcast_shape: a larger shape of K dimensions with the batch dimension equal to the length of timesteps. :return: a tensor of shape [batch_size, 1, ...] where the shape has K dims. """ if not isinstance(arr, torch.Tensor): arr = torch.from_numpy(arr) res = arr[timesteps].float().to(timesteps.device) while len(res.shape) < len(broadcast_shape): res = res[..., None] return res.expand(broadcast_shape) def append_dims(x, target_dims): """Appends dimensions to the end of a tensor until it has target_dims dimensions.""" dims_to_append = target_dims - x.ndim if dims_to_append < 0: raise ValueError(f"input has {x.ndim} dims but target_dims is {target_dims}, which is less") return x[(...,) + (None,) * dims_to_append] def extract_into_tensor(a, t, x_shape): b, *_ = t.shape out = a.gather(-1, t) return out.reshape(b, *((1,) * (len(x_shape) - 1))) def get_discretization_steps(global_step: int, max_train_steps: int, s_0: int = 10, s_1: int = 1280, constant=False): """ Calculates the current discretization steps at global step k using the discretization curriculum N(k). """ if constant: return s_0 + 1 k_prime = math.floor(max_train_steps / (math.log2(math.floor(s_1 / s_0)) + 1)) num_discretization_steps = min(s_0 * 2 ** math.floor(global_step / k_prime), s_1) + 1 return num_discretization_steps def get_skip_steps(global_step, initial_skip: int = 1): # Currently only support constant skip curriculum. return initial_skip def get_karras_sigmas( num_discretization_steps: int, sigma_min: float = 0.002, sigma_max: float = 80.0, rho: float = 7.0, dtype=torch.float32, ): """ Calculates the Karras sigmas timestep discretization of [sigma_min, sigma_max]. """ ramp = np.linspace(0, 1, num_discretization_steps) min_inv_rho = sigma_min ** (1 / rho) max_inv_rho = sigma_max ** (1 / rho) sigmas = (max_inv_rho + ramp * (min_inv_rho - max_inv_rho)) ** rho # Make sure sigmas are in increasing rather than decreasing order (see section 2 of the iCT paper) sigmas = sigmas[::-1].copy() sigmas = torch.from_numpy(sigmas).to(dtype=dtype) return sigmas def get_discretized_lognormal_weights(noise_levels: torch.FloatTensor, p_mean: float = -1.1, p_std: float = 2.0): """ Calculates the unnormalized weights for a 1D array of noise level sigma_i based on the discretized lognormal" " distribution used in the iCT paper (given in Equation 10). """ upper_prob = torch.special.erf((torch.log(noise_levels[1:]) - p_mean) / (math.sqrt(2) * p_std)) lower_prob = torch.special.erf((torch.log(noise_levels[:-1]) - p_mean) / (math.sqrt(2) * p_std)) weights = upper_prob - lower_prob return weights def get_loss_weighting_schedule(noise_levels: torch.FloatTensor): """ Calculates the loss weighting schedule lambda given a set of noise levels. """ return 1.0 / (noise_levels[1:] - noise_levels[:-1]) def add_noise(original_samples: torch.FloatTensor, noise: torch.FloatTensor, timesteps: torch.FloatTensor): # Make sure timesteps (Karras sigmas) have the same device and dtype as original_samples sigmas = timesteps.to(device=original_samples.device, dtype=original_samples.dtype) while len(sigmas.shape) < len(original_samples.shape): sigmas = sigmas.unsqueeze(-1) noisy_samples = original_samples + noise * sigmas return noisy_samples def get_noise_preconditioning(sigmas, noise_precond_type: str = "cm"): """ Calculates the noise preconditioning function c_noise, which is used to transform the raw Karras sigmas into the timestep input for the U-Net. """ if noise_precond_type == "none": return sigmas elif noise_precond_type == "edm": return 0.25 * torch.log(sigmas) elif noise_precond_type == "cm": return 1000 * 0.25 * torch.log(sigmas + 1e-44) else: raise ValueError( f"Noise preconditioning type {noise_precond_type} is not current supported. Currently supported noise" f" preconditioning types are `none` (which uses the sigmas as is), `edm`, and `cm`." ) def get_input_preconditioning(sigmas, sigma_data=0.5, input_precond_type: str = "cm"): """ Calculates the input preconditioning factor c_in, which is used to scale the U-Net image input. """ if input_precond_type == "none": return 1 elif input_precond_type == "cm": return 1.0 / (sigmas**2 + sigma_data**2) else: raise ValueError( f"Input preconditioning type {input_precond_type} is not current supported. Currently supported input" f" preconditioning types are `none` (which uses a scaling factor of 1.0) and `cm`." ) def scalings_for_boundary_conditions(timestep, sigma_data=0.5, timestep_scaling=1.0): scaled_timestep = timestep_scaling * timestep c_skip = sigma_data**2 / (scaled_timestep**2 + sigma_data**2) c_out = scaled_timestep / (scaled_timestep**2 + sigma_data**2) ** 0.5 return c_skip, c_out def log_validation(unet, scheduler, args, accelerator, weight_dtype, step, name="teacher"): logger.info("Running validation... ") unet = accelerator.unwrap_model(unet) pipeline = ConsistencyModelPipeline( unet=unet, scheduler=scheduler, ) pipeline = pipeline.to(device=accelerator.device) pipeline.set_progress_bar_config(disable=True) if args.enable_xformers_memory_efficient_attention: pipeline.enable_xformers_memory_efficient_attention() if args.seed is None: generator = None else: generator = torch.Generator(device=accelerator.device).manual_seed(args.seed) class_labels = [None] if args.class_conditional: if args.num_classes is not None: class_labels = list(range(args.num_classes)) else: logger.warn( "The model is class-conditional but the number of classes is not set. The generated images will be" " unconditional rather than class-conditional." ) image_logs = [] for class_label in class_labels: images = [] with torch.autocast("cuda"): images = pipeline( num_inference_steps=1, batch_size=args.eval_batch_size, class_labels=[class_label] * args.eval_batch_size, generator=generator, ).images log = {"images": images} if args.class_conditional and class_label is not None: log["class_label"] = str(class_label) else: log["class_label"] = "images" image_logs.append(log) for tracker in accelerator.trackers: if tracker.name == "tensorboard": for log in image_logs: images = log["images"] class_label = log["class_label"] formatted_images = [] for image in images: formatted_images.append(np.asarray(image)) formatted_images = np.stack(formatted_images) tracker.writer.add_images(class_label, formatted_images, step, dataformats="NHWC") elif tracker.name == "wandb": formatted_images = [] for log in image_logs: images = log["images"] class_label = log["class_label"] for image in images: image = wandb.Image(image, caption=class_label) formatted_images.append(image) tracker.log({f"validation/{name}": formatted_images}) else: logger.warn(f"image logging not implemented for {tracker.name}") del pipeline gc.collect() torch.cuda.empty_cache() return image_logs def parse_args(): parser = argparse.ArgumentParser(description="Simple example of a training script.") # ------------Model Arguments----------- parser.add_argument( "--model_config_name_or_path", type=str, default=None, help="The config of the UNet model to train, leave as None to use standard DDPM configuration.", ) parser.add_argument( "--pretrained_model_name_or_path", type=str, default=None, help=( "If initializing the weights from a pretrained model, the path to the pretrained model or model identifier" " from huggingface.co/models." ), ) parser.add_argument( "--revision", type=str, default=None, required=False, help="Revision of pretrained model identifier from huggingface.co/models.", ) parser.add_argument( "--variant", type=str, default=None, help=( "Variant of the model files of the pretrained model identifier from huggingface.co/models, e.g. `fp16`," " `non_ema`, etc.", ), ) # ------------Dataset Arguments----------- parser.add_argument( "--train_data_dir", type=str, default=None, help=( "A folder containing the training data. Folder contents must follow the structure described in" " https://huggingface.co/docs/datasets/image_dataset#imagefolder. In particular, a `metadata.jsonl` file" " must exist to provide the captions for the images. Ignored if `dataset_name` is specified." ), ) parser.add_argument( "--dataset_name", type=str, default=None, help=( "The name of the Dataset (from the HuggingFace hub) to train on (could be your own, possibly private," " dataset). It can also be a path pointing to a local copy of a dataset in your filesystem," " or to a folder containing files that HF Datasets can understand." ), ) parser.add_argument( "--dataset_config_name", type=str, default=None, help="The config of the Dataset, leave as None if there's only one config.", ) parser.add_argument( "--dataset_image_column_name", type=str, default="image", help="The name of the image column in the dataset to use for training.", ) parser.add_argument( "--dataset_class_label_column_name", type=str, default="label", help="If doing class-conditional training, the name of the class label column in the dataset to use.", ) # ------------Image Processing Arguments----------- parser.add_argument( "--resolution", type=int, default=64, help=( "The resolution for input images, all the images in the train/validation dataset will be resized to this" " resolution" ), ) parser.add_argument( "--interpolation_type", type=str, default="bilinear", help=( "The interpolation function used when resizing images to the desired resolution. Choose between `bilinear`," " `bicubic`, `box`, `nearest`, `nearest_exact`, `hamming`, and `lanczos`." ), ) parser.add_argument( "--center_crop", default=False, action="store_true", help=( "Whether to center crop the input images to the resolution. If not set, the images will be randomly" " cropped. The images will be resized to the resolution first before cropping." ), ) parser.add_argument( "--random_flip", default=False, action="store_true", help="whether to randomly flip images horizontally", ) parser.add_argument( "--class_conditional", action="store_true", help=( "Whether to train a class-conditional model. If set, the class labels will be taken from the `label`" " column of the provided dataset." ), ) parser.add_argument( "--num_classes", type=int, default=None, help="The number of classes in the training data, if training a class-conditional model.", ) parser.add_argument( "--class_embed_type", type=str, default=None, help=( "The class embedding type to use. Choose from `None`, `identity`, and `timestep`. If `class_conditional`" " and `num_classes` and set, but `class_embed_type` is `None`, a embedding matrix will be used." ), ) # ------------Dataloader Arguments----------- parser.add_argument( "--dataloader_num_workers", type=int, default=0, help=( "The number of subprocesses to use for data loading. 0 means that the data will be loaded in the main" " process." ), ) # ------------Training Arguments----------- # ----General Training Arguments---- parser.add_argument( "--output_dir", type=str, default="ddpm-model-64", help="The output directory where the model predictions and checkpoints will be written.", ) parser.add_argument("--overwrite_output_dir", action="store_true") parser.add_argument( "--cache_dir", type=str, default=None, help="The directory where the downloaded models and datasets will be stored.", ) parser.add_argument("--seed", type=int, default=None, help="A seed for reproducible training.") # ----Batch Size and Training Length---- parser.add_argument( "--train_batch_size", type=int, default=16, help="Batch size (per device) for the training dataloader." ) parser.add_argument("--num_train_epochs", type=int, default=100) parser.add_argument( "--max_train_steps", type=int, default=None, help="Total number of training steps to perform. If provided, overrides num_train_epochs.", ) parser.add_argument( "--max_train_samples", type=int, default=None, help=( "For debugging purposes or quicker training, truncate the number of training examples to this " "value if set." ), ) # ----Learning Rate---- parser.add_argument( "--learning_rate", type=float, default=1e-4, help="Initial learning rate (after the potential warmup period) to use.", ) parser.add_argument( "--scale_lr", action="store_true", default=False, help="Scale the learning rate by the number of GPUs, gradient accumulation steps, and batch size.", ) parser.add_argument( "--lr_scheduler", type=str, default="cosine", help=( 'The scheduler type to use. Choose between ["linear", "cosine", "cosine_with_restarts", "polynomial",' ' "constant", "constant_with_warmup"]' ), ) parser.add_argument( "--lr_warmup_steps", type=int, default=500, help="Number of steps for the warmup in the lr scheduler." ) # ----Optimizer (Adam) Arguments---- parser.add_argument( "--optimizer_type", type=str, default="adamw", help=( "The optimizer algorithm to use for training. Choose between `radam` and `adamw`. The iCT paper uses" " RAdam." ), ) parser.add_argument( "--use_8bit_adam", action="store_true", help="Whether or not to use 8-bit Adam from bitsandbytes." ) parser.add_argument("--adam_beta1", type=float, default=0.95, help="The beta1 parameter for the Adam optimizer.") parser.add_argument("--adam_beta2", type=float, default=0.999, help="The beta2 parameter for the Adam optimizer.") parser.add_argument( "--adam_weight_decay", type=float, default=1e-6, help="Weight decay magnitude for the Adam optimizer." ) parser.add_argument("--adam_epsilon", type=float, default=1e-08, help="Epsilon value for the Adam optimizer.") parser.add_argument("--max_grad_norm", default=1.0, type=float, help="Max gradient norm.") # ----Consistency Training (CT) Specific Arguments---- parser.add_argument( "--prediction_type", type=str, default="sample", choices=["sample"], help="Whether the model should predict the 'epsilon'/noise error or directly the reconstructed image 'x0'.", ) parser.add_argument("--ddpm_num_steps", type=int, default=1000) parser.add_argument("--ddpm_num_inference_steps", type=int, default=1000) parser.add_argument("--ddpm_beta_schedule", type=str, default="linear") parser.add_argument( "--sigma_min", type=float, default=0.002, help=( "The lower boundary for the timestep discretization, which should be set to a small positive value close" " to zero to avoid numerical issues when solving the PF-ODE backwards in time." ), ) parser.add_argument( "--sigma_max", type=float, default=80.0, help=( "The upper boundary for the timestep discretization, which also determines the variance of the Gaussian" " prior." ), ) parser.add_argument( "--rho", type=float, default=7.0, help="The rho parameter for the Karras sigmas timestep dicretization.", ) parser.add_argument( "--huber_c", type=float, default=None, help=( "The Pseudo-Huber loss parameter c. If not set, this will default to the value recommended in the Improved" " Consistency Training (iCT) paper of 0.00054 * sqrt(d), where d is the data dimensionality." ), ) parser.add_argument( "--discretization_s_0", type=int, default=10, help=( "The s_0 parameter in the discretization curriculum N(k). This controls the number of training steps after" " which the number of discretization steps N will be doubled." ), ) parser.add_argument( "--discretization_s_1", type=int, default=1280, help=( "The s_1 parameter in the discretization curriculum N(k). This controls the upper limit to the number of" " discretization steps used. Increasing this value will reduce the bias at the cost of higher variance." ), ) parser.add_argument( "--constant_discretization_steps", action="store_true", help=( "Whether to set the discretization curriculum N(k) to be the constant value `discretization_s_0 + 1`. This" " is useful for testing when `max_number_steps` is small, when `k_prime` would otherwise be 0, causing" " a divide-by-zero error." ), ) parser.add_argument( "--p_mean", type=float, default=-1.1, help=( "The mean parameter P_mean for the (discretized) lognormal noise schedule, which controls the probability" " of sampling a (discrete) noise level sigma_i." ), ) parser.add_argument( "--p_std", type=float, default=2.0, help=( "The standard deviation parameter P_std for the (discretized) noise schedule, which controls the" " probability of sampling a (discrete) noise level sigma_i." ), ) parser.add_argument( "--noise_precond_type", type=str, default="cm", help=( "The noise preconditioning function to use for transforming the raw Karras sigmas into the timestep" " argument of the U-Net. Choose between `none` (the identity function), `edm`, and `cm`." ), ) parser.add_argument( "--input_precond_type", type=str, default="cm", help=( "The input preconditioning function to use for scaling the image input of the U-Net. Choose between `none`" " (a scaling factor of 1) and `cm`." ), ) parser.add_argument( "--skip_steps", type=int, default=1, help=( "The gap in indices between the student and teacher noise levels. In the iCT paper this is always set to" " 1, but theoretically this could be greater than 1 and/or altered according to a curriculum throughout" " training, much like the number of discretization steps is." ), ) parser.add_argument( "--cast_teacher", action="store_true", help="Whether to cast the teacher U-Net model to `weight_dtype` or leave it in full precision.", ) # ----Exponential Moving Average (EMA) Arguments---- parser.add_argument( "--use_ema", action="store_true", help="Whether to use Exponential Moving Average for the final model weights.", ) parser.add_argument( "--ema_min_decay", type=float, default=None, help=( "The minimum decay magnitude for EMA. If not set, this will default to the value of `ema_max_decay`," " resulting in a constant EMA decay rate." ), ) parser.add_argument( "--ema_max_decay", type=float, default=0.99993, help=( "The maximum decay magnitude for EMA. Setting `ema_min_decay` equal to this value will result in a" " constant decay rate." ), ) parser.add_argument( "--use_ema_warmup", action="store_true", help="Whether to use EMA warmup.", ) parser.add_argument("--ema_inv_gamma", type=float, default=1.0, help="The inverse gamma value for the EMA decay.") parser.add_argument("--ema_power", type=float, default=3 / 4, help="The power value for the EMA decay.") # ----Training Optimization Arguments---- parser.add_argument( "--mixed_precision", type=str, default="no", choices=["no", "fp16", "bf16"], help=( "Whether to use mixed precision. Choose" "between fp16 and bf16 (bfloat16). Bf16 requires PyTorch >= 1.10." "and an Nvidia Ampere GPU." ), ) parser.add_argument( "--allow_tf32", action="store_true", help=( "Whether or not to allow TF32 on Ampere GPUs. Can be used to speed up training. For more information, see" " https://pytorch.org/docs/stable/notes/cuda.html#tensorfloat-32-tf32-on-ampere-devices" ), ) parser.add_argument( "--gradient_checkpointing", action="store_true", help="Whether or not to use gradient checkpointing to save memory at the expense of slower backward pass.", ) parser.add_argument( "--gradient_accumulation_steps", type=int, default=1, help="Number of updates steps to accumulate before performing a backward/update pass.", ) parser.add_argument( "--enable_xformers_memory_efficient_attention", action="store_true", help="Whether or not to use xformers." ) # ----Distributed Training Arguments---- parser.add_argument("--local_rank", type=int, default=-1, help="For distributed training: local_rank") # ------------Validation Arguments----------- parser.add_argument( "--validation_steps", type=int, default=200, help="Run validation every X steps.", ) parser.add_argument( "--eval_batch_size", type=int, default=16, help=( "The number of images to generate for evaluation. Note that if `class_conditional` and `num_classes` is" " set the effective number of images generated per evaluation step is `eval_batch_size * num_classes`." ), ) parser.add_argument("--save_images_epochs", type=int, default=10, help="How often to save images during training.") # ------------Validation Arguments----------- parser.add_argument( "--checkpointing_steps", type=int, default=500, help=( "Save a checkpoint of the training state every X updates. These checkpoints are only suitable for resuming" " training using `--resume_from_checkpoint`." ), ) parser.add_argument( "--checkpoints_total_limit", type=int, default=None, help=("Max number of checkpoints to store."), ) parser.add_argument( "--resume_from_checkpoint", type=str, default=None, help=( "Whether training should be resumed from a previous checkpoint. Use a path saved by" ' `--checkpointing_steps`, or `"latest"` to automatically select the last available checkpoint.' ), ) parser.add_argument( "--save_model_epochs", type=int, default=10, help="How often to save the model during training." ) # ------------Logging Arguments----------- parser.add_argument( "--report_to", type=str, default="tensorboard", help=( 'The integration to report the results and logs to. Supported platforms are `"tensorboard"`' ' (default), `"wandb"` and `"comet_ml"`. Use `"all"` to report to all integrations.' ), ) parser.add_argument( "--logging_dir", type=str, default="logs", help=( "[TensorBoard](https://www.tensorflow.org/tensorboard) log directory. Will default to" " *output_dir/runs/**CURRENT_DATETIME_HOSTNAME***." ), ) # ------------HuggingFace Hub Arguments----------- parser.add_argument("--push_to_hub", action="store_true", help="Whether or not to push the model to the Hub.") parser.add_argument("--hub_token", type=str, default=None, help="The token to use to push to the Model Hub.") parser.add_argument( "--hub_model_id", type=str, default=None, help="The name of the repository to keep in sync with the local `output_dir`.", ) parser.add_argument( "--hub_private_repo", action="store_true", help="Whether or not to create a private repository." ) # ------------Accelerate Arguments----------- parser.add_argument( "--tracker_project_name", type=str, default="consistency-training", help=( "The `project_name` argument passed to Accelerator.init_trackers for" " more information see https://huggingface.co/docs/accelerate/v0.17.0/en/package_reference/accelerator#accelerate.Accelerator" ), ) args = parser.parse_args() env_local_rank = int(os.environ.get("LOCAL_RANK", -1)) if env_local_rank != -1 and env_local_rank != args.local_rank: args.local_rank = env_local_rank if args.dataset_name is None and args.train_data_dir is None: raise ValueError("You must specify either a dataset name from the hub or a train data directory.") return args def main(args): logging_dir = os.path.join(args.output_dir, args.logging_dir) accelerator_project_config = ProjectConfiguration(project_dir=args.output_dir, logging_dir=logging_dir) kwargs = InitProcessGroupKwargs(timeout=timedelta(seconds=7200)) # a big number for high resolution or big dataset accelerator = Accelerator( gradient_accumulation_steps=args.gradient_accumulation_steps, mixed_precision=args.mixed_precision, log_with=args.report_to, project_config=accelerator_project_config, kwargs_handlers=[kwargs], ) if args.report_to == "tensorboard": if not is_tensorboard_available(): raise ImportError("Make sure to install tensorboard if you want to use it for logging during training.") elif args.report_to == "wandb": if not is_wandb_available(): raise ImportError("Make sure to install wandb if you want to use it for logging during training.") # Make one log on every process with the configuration for debugging. logging.basicConfig( format="%(asctime)s - %(levelname)s - %(name)s - %(message)s", datefmt="%m/%d/%Y %H:%M:%S", level=logging.INFO, ) logger.info(accelerator.state, main_process_only=False) if accelerator.is_local_main_process: datasets.utils.logging.set_verbosity_warning() diffusers.utils.logging.set_verbosity_info() else: datasets.utils.logging.set_verbosity_error() diffusers.utils.logging.set_verbosity_error() # If passed along, set the training seed now. if args.seed is not None: set_seed(args.seed) # Handle the repository creation if accelerator.is_main_process: if args.output_dir is not None: os.makedirs(args.output_dir, exist_ok=True) if args.push_to_hub: repo_id = create_repo( repo_id=args.hub_model_id or Path(args.output_dir).name, exist_ok=True, token=args.hub_token ).repo_id # 1. Initialize the noise scheduler. initial_discretization_steps = get_discretization_steps( 0, args.max_train_steps, s_0=args.discretization_s_0, s_1=args.discretization_s_1, constant=args.constant_discretization_steps, ) noise_scheduler = CMStochasticIterativeScheduler( num_train_timesteps=initial_discretization_steps, sigma_min=args.sigma_min, sigma_max=args.sigma_max, rho=args.rho, ) # 2. Initialize the student U-Net model. if args.pretrained_model_name_or_path is not None: logger.info(f"Loading pretrained U-Net weights from {args.pretrained_model_name_or_path}... ") unet = UNet2DModel.from_pretrained( args.pretrained_model_name_or_path, subfolder="unet", revision=args.revision, variant=args.variant ) elif args.model_config_name_or_path is None: # TODO: use default architectures from iCT paper if not args.class_conditional and (args.num_classes is not None or args.class_embed_type is not None): logger.warn( f"`--class_conditional` is set to `False` but `--num_classes` is set to {args.num_classes} and" f" `--class_embed_type` is set to {args.class_embed_type}. These values will be overridden to `None`." ) args.num_classes = None args.class_embed_type = None elif args.class_conditional and args.num_classes is None and args.class_embed_type is None: logger.warn( "`--class_conditional` is set to `True` but neither `--num_classes` nor `--class_embed_type` is set." "`class_conditional` will be overridden to `False`." ) args.class_conditional = False unet = UNet2DModel( sample_size=args.resolution, in_channels=3, out_channels=3, layers_per_block=2, block_out_channels=(128, 128, 256, 256, 512, 512), down_block_types=( "DownBlock2D", "DownBlock2D", "DownBlock2D", "DownBlock2D", "AttnDownBlock2D", "DownBlock2D", ), up_block_types=( "UpBlock2D", "AttnUpBlock2D", "UpBlock2D", "UpBlock2D", "UpBlock2D", "UpBlock2D", ), class_embed_type=args.class_embed_type, num_class_embeds=args.num_classes, ) else: config = UNet2DModel.load_config(args.model_config_name_or_path) unet = UNet2DModel.from_config(config) unet.train() # Create EMA for the student U-Net model. if args.use_ema: if args.ema_min_decay is None: args.ema_min_decay = args.ema_max_decay ema_unet = EMAModel( unet.parameters(), decay=args.ema_max_decay, min_decay=args.ema_min_decay, use_ema_warmup=args.use_ema_warmup, inv_gamma=args.ema_inv_gamma, power=args.ema_power, model_cls=UNet2DModel, model_config=unet.config, ) # 3. Initialize the teacher U-Net model from the student U-Net model. # Note that following the improved Consistency Training paper, the teacher U-Net is not updated via EMA (e.g. the # EMA decay rate is 0.) teacher_unet = UNet2DModel.from_config(unet.config) teacher_unet.load_state_dict(unet.state_dict()) teacher_unet.train() teacher_unet.requires_grad_(False) # 4. Handle mixed precision and device placement weight_dtype = torch.float32 if accelerator.mixed_precision == "fp16": weight_dtype = torch.float16 args.mixed_precision = accelerator.mixed_precision elif accelerator.mixed_precision == "bf16": weight_dtype = torch.bfloat16 args.mixed_precision = accelerator.mixed_precision # Cast teacher_unet to weight_dtype if cast_teacher is set. if args.cast_teacher: teacher_dtype = weight_dtype else: teacher_dtype = torch.float32 teacher_unet.to(accelerator.device) if args.use_ema: ema_unet.to(accelerator.device) # 5. Handle saving and loading of checkpoints. # `accelerate` 0.16.0 will have better support for customized saving if version.parse(accelerate.__version__) >= version.parse("0.16.0"): # create custom saving & loading hooks so that `accelerator.save_state(...)` serializes in a nice format def save_model_hook(models, weights, output_dir): if accelerator.is_main_process: teacher_unet.save_pretrained(os.path.join(output_dir, "unet_teacher")) if args.use_ema: ema_unet.save_pretrained(os.path.join(output_dir, "unet_ema")) for i, model in enumerate(models): model.save_pretrained(os.path.join(output_dir, "unet")) # make sure to pop weight so that corresponding model is not saved again weights.pop() def load_model_hook(models, input_dir): load_model = UNet2DModel.from_pretrained(os.path.join(input_dir, "unet_teacher")) teacher_unet.load_state_dict(load_model.state_dict()) teacher_unet.to(accelerator.device) del load_model if args.use_ema: load_model = EMAModel.from_pretrained(os.path.join(input_dir, "unet_ema"), UNet2DModel) ema_unet.load_state_dict(load_model.state_dict()) ema_unet.to(accelerator.device) del load_model for i in range(len(models)): # pop models so that they are not loaded again model = models.pop() # load diffusers style into model load_model = UNet2DModel.from_pretrained(input_dir, subfolder="unet") model.register_to_config(**load_model.config) model.load_state_dict(load_model.state_dict()) del load_model accelerator.register_save_state_pre_hook(save_model_hook) accelerator.register_load_state_pre_hook(load_model_hook) # 6. Enable optimizations if args.enable_xformers_memory_efficient_attention: if is_xformers_available(): import xformers xformers_version = version.parse(xformers.__version__) if xformers_version == version.parse("0.0.16"): logger.warn( "xFormers 0.0.16 cannot be used for training in some GPUs. If you observe problems during training, please update xFormers to at least 0.0.17. See https://huggingface.co/docs/diffusers/main/en/optimization/xformers for more details." ) unet.enable_xformers_memory_efficient_attention() teacher_unet.enable_xformers_memory_efficient_attention() if args.use_ema: ema_unet.enable_xformers_memory_efficient_attention() else: raise ValueError("xformers is not available. Make sure it is installed correctly") # Enable TF32 for faster training on Ampere GPUs, # cf https://pytorch.org/docs/stable/notes/cuda.html#tensorfloat-32-tf32-on-ampere-devices if args.allow_tf32: torch.backends.cuda.matmul.allow_tf32 = True if args.gradient_checkpointing: unet.enable_gradient_checkpointing() if args.optimizer_type == "radam": optimizer_class = torch.optim.RAdam elif args.optimizer_type == "adamw": # Use 8-bit Adam for lower memory usage or to fine-tune the model for 16GB GPUs if args.use_8bit_adam: try: import bitsandbytes as bnb except ImportError: raise ImportError( "To use 8-bit Adam, please install the bitsandbytes library: `pip install bitsandbytes`." ) optimizer_class = bnb.optim.AdamW8bit else: optimizer_class = torch.optim.AdamW else: raise ValueError( f"Optimizer type {args.optimizer_type} is not supported. Currently supported optimizer types are `radam`" f" and `adamw`." ) # 7. Initialize the optimizer optimizer = optimizer_class( unet.parameters(), lr=args.learning_rate, betas=(args.adam_beta1, args.adam_beta2), weight_decay=args.adam_weight_decay, eps=args.adam_epsilon, ) # 8. Dataset creation and data preprocessing # Get the datasets: you can either provide your own training and evaluation files (see below) # or specify a Dataset from the hub (the dataset will be downloaded automatically from the datasets Hub). # In distributed training, the load_dataset function guarantees that only one local process can concurrently # download the dataset. if args.dataset_name is not None: dataset = load_dataset( args.dataset_name, args.dataset_config_name, cache_dir=args.cache_dir, split="train", ) else: dataset = load_dataset("imagefolder", data_dir=args.train_data_dir, cache_dir=args.cache_dir, split="train") # See more about loading custom images at # https://huggingface.co/docs/datasets/v2.4.0/en/image_load#imagefolder # Preprocessing the datasets and DataLoaders creation. interpolation_mode = resolve_interpolation_mode(args.interpolation_type) augmentations = transforms.Compose( [ transforms.Resize(args.resolution, interpolation=interpolation_mode), transforms.CenterCrop(args.resolution) if args.center_crop else transforms.RandomCrop(args.resolution), transforms.RandomHorizontalFlip() if args.random_flip else transforms.Lambda(lambda x: x), transforms.ToTensor(), transforms.Normalize([0.5], [0.5]), ] ) def transform_images(examples): images = [augmentations(image.convert("RGB")) for image in examples[args.dataset_image_column_name]] batch_dict = {"images": images} if args.class_conditional: batch_dict["class_labels"] = examples[args.dataset_class_label_column_name] return batch_dict logger.info(f"Dataset size: {len(dataset)}") dataset.set_transform(transform_images) train_dataloader = torch.utils.data.DataLoader( dataset, batch_size=args.train_batch_size, shuffle=True, num_workers=args.dataloader_num_workers ) # 9. Initialize the learning rate scheduler # Scheduler and math around the number of training steps. overrode_max_train_steps = False num_update_steps_per_epoch = math.ceil(len(train_dataloader) / args.gradient_accumulation_steps) if args.max_train_steps is None: args.max_train_steps = args.num_train_epochs * num_update_steps_per_epoch overrode_max_train_steps = True lr_scheduler = get_scheduler( args.lr_scheduler, optimizer=optimizer, num_warmup_steps=args.lr_warmup_steps, num_training_steps=args.max_train_steps, ) # 10. Prepare for training # Prepare everything with our `accelerator`. unet, optimizer, train_dataloader, lr_scheduler = accelerator.prepare( unet, optimizer, train_dataloader, lr_scheduler ) def recalculate_num_discretization_step_values(discretization_steps, skip_steps): """ Recalculates all quantities depending on the number of discretization steps N. """ noise_scheduler = CMStochasticIterativeScheduler( num_train_timesteps=discretization_steps, sigma_min=args.sigma_min, sigma_max=args.sigma_max, rho=args.rho, ) current_timesteps = get_karras_sigmas(discretization_steps, args.sigma_min, args.sigma_max, args.rho) valid_teacher_timesteps_plus_one = current_timesteps[: len(current_timesteps) - skip_steps + 1] # timestep_weights are the unnormalized probabilities of sampling the timestep/noise level at each index timestep_weights = get_discretized_lognormal_weights( valid_teacher_timesteps_plus_one, p_mean=args.p_mean, p_std=args.p_std ) # timestep_loss_weights is the timestep-dependent loss weighting schedule lambda(sigma_i) timestep_loss_weights = get_loss_weighting_schedule(valid_teacher_timesteps_plus_one) current_timesteps = current_timesteps.to(accelerator.device) timestep_weights = timestep_weights.to(accelerator.device) timestep_loss_weights = timestep_loss_weights.to(accelerator.device) return noise_scheduler, current_timesteps, timestep_weights, timestep_loss_weights # We need to recalculate our total training steps as the size of the training dataloader may have changed. num_update_steps_per_epoch = math.ceil(len(train_dataloader) / args.gradient_accumulation_steps) if overrode_max_train_steps: args.max_train_steps = args.num_train_epochs * num_update_steps_per_epoch # Afterwards we recalculate our number of training epochs args.num_train_epochs = math.ceil(args.max_train_steps / num_update_steps_per_epoch) # We need to initialize the trackers we use, and also store our configuration. # The trackers initializes automatically on the main process. if accelerator.is_main_process: tracker_config = dict(vars(args)) accelerator.init_trackers(args.tracker_project_name, config=tracker_config) # Function for unwraping if torch.compile() was used in accelerate. def unwrap_model(model): model = accelerator.unwrap_model(model) model = model._orig_mod if is_compiled_module(model) else model return model total_batch_size = args.train_batch_size * accelerator.num_processes * args.gradient_accumulation_steps logger.info("***** Running training *****") logger.info(f" Num examples = {len(dataset)}") logger.info(f" Num Epochs = {args.num_train_epochs}") logger.info(f" Instantaneous batch size per device = {args.train_batch_size}") logger.info(f" Total train batch size (w. parallel, distributed & accumulation) = {total_batch_size}") logger.info(f" Gradient Accumulation steps = {args.gradient_accumulation_steps}") logger.info(f" Total optimization steps = {args.max_train_steps}") global_step = 0 first_epoch = 0 # Potentially load in the weights and states from a previous save if args.resume_from_checkpoint: if args.resume_from_checkpoint != "latest": path = os.path.basename(args.resume_from_checkpoint) else: # Get the most recent checkpoint dirs = os.listdir(args.output_dir) dirs = [d for d in dirs if d.startswith("checkpoint")] dirs = sorted(dirs, key=lambda x: int(x.split("-")[1])) path = dirs[-1] if len(dirs) > 0 else None if path is None: accelerator.print( f"Checkpoint '{args.resume_from_checkpoint}' does not exist. Starting a new training run." ) args.resume_from_checkpoint = None initial_global_step = 0 else: accelerator.print(f"Resuming from checkpoint {path}") accelerator.load_state(os.path.join(args.output_dir, path)) global_step = int(path.split("-")[1]) initial_global_step = global_step first_epoch = global_step // num_update_steps_per_epoch else: initial_global_step = 0 # Resolve the c parameter for the Pseudo-Huber loss if args.huber_c is None: args.huber_c = 0.00054 * args.resolution * math.sqrt(unet.config.in_channels) # Get current number of discretization steps N according to our discretization curriculum current_discretization_steps = get_discretization_steps( initial_global_step, args.max_train_steps, s_0=args.discretization_s_0, s_1=args.discretization_s_1, constant=args.constant_discretization_steps, ) current_skip_steps = get_skip_steps(initial_global_step, initial_skip=args.skip_steps) if current_skip_steps >= current_discretization_steps: raise ValueError( f"The current skip steps is {current_skip_steps}, but should be smaller than the current number of" f" discretization steps {current_discretization_steps}" ) # Recalculate all quantities depending on the number of discretization steps N ( noise_scheduler, current_timesteps, timestep_weights, timestep_loss_weights, ) = recalculate_num_discretization_step_values(current_discretization_steps, current_skip_steps) progress_bar = tqdm( range(0, args.max_train_steps), initial=initial_global_step, desc="Steps", # Only show the progress bar once on each machine. disable=not accelerator.is_local_main_process, ) # 11. Train! for epoch in range(first_epoch, args.num_train_epochs): unet.train() for step, batch in enumerate(train_dataloader): # 1. Get batch of images from dataloader (sample x ~ p_data(x)) clean_images = batch["images"].to(weight_dtype) if args.class_conditional: class_labels = batch["class_labels"] else: class_labels = None bsz = clean_images.shape[0] # 2. Sample a random timestep for each image according to the noise schedule. # Sample random indices i ~ p(i), where p(i) is the dicretized lognormal distribution in the iCT paper # NOTE: timestep_indices should be in the range [0, len(current_timesteps) - k - 1] inclusive timestep_indices = torch.multinomial(timestep_weights, bsz, replacement=True).long() teacher_timesteps = current_timesteps[timestep_indices] student_timesteps = current_timesteps[timestep_indices + current_skip_steps] # 3. Sample noise and add it to the clean images for both teacher and student unets # Sample noise z ~ N(0, I) that we'll add to the images noise = torch.randn(clean_images.shape, dtype=weight_dtype, device=clean_images.device) # Add noise to the clean images according to the noise magnitude at each timestep # (this is the forward diffusion process) teacher_noisy_images = add_noise(clean_images, noise, teacher_timesteps) student_noisy_images = add_noise(clean_images, noise, student_timesteps) # 4. Calculate preconditioning and scalings for boundary conditions for the consistency model. teacher_rescaled_timesteps = get_noise_preconditioning(teacher_timesteps, args.noise_precond_type) student_rescaled_timesteps = get_noise_preconditioning(student_timesteps, args.noise_precond_type) c_in_teacher = get_input_preconditioning(teacher_timesteps, input_precond_type=args.input_precond_type) c_in_student = get_input_preconditioning(student_timesteps, input_precond_type=args.input_precond_type) c_skip_teacher, c_out_teacher = scalings_for_boundary_conditions(teacher_timesteps) c_skip_student, c_out_student = scalings_for_boundary_conditions(student_timesteps) c_skip_teacher, c_out_teacher, c_in_teacher = [ append_dims(x, clean_images.ndim) for x in [c_skip_teacher, c_out_teacher, c_in_teacher] ] c_skip_student, c_out_student, c_in_student = [ append_dims(x, clean_images.ndim) for x in [c_skip_student, c_out_student, c_in_student] ] with accelerator.accumulate(unet): # 5. Get the student unet denoising prediction on the student timesteps # Get rng state now to ensure that dropout is synced between the student and teacher models. dropout_state = torch.get_rng_state() student_model_output = unet( c_in_student * student_noisy_images, student_rescaled_timesteps, class_labels=class_labels ).sample # NOTE: currently only support prediction_type == sample, so no need to convert model_output student_denoise_output = c_skip_student * student_noisy_images + c_out_student * student_model_output # 6. Get the teacher unet denoising prediction on the teacher timesteps with torch.no_grad(), torch.autocast("cuda", dtype=teacher_dtype): torch.set_rng_state(dropout_state) teacher_model_output = teacher_unet( c_in_teacher * teacher_noisy_images, teacher_rescaled_timesteps, class_labels=class_labels ).sample # NOTE: currently only support prediction_type == sample, so no need to convert model_output teacher_denoise_output = ( c_skip_teacher * teacher_noisy_images + c_out_teacher * teacher_model_output ) # 7. Calculate the weighted Pseudo-Huber loss if args.prediction_type == "sample": # Note that the loss weights should be those at the (teacher) timestep indices. lambda_t = _extract_into_tensor( timestep_loss_weights, timestep_indices, (bsz,) + (1,) * (clean_images.ndim - 1) ) loss = lambda_t * ( torch.sqrt( (student_denoise_output.float() - teacher_denoise_output.float()) ** 2 + args.huber_c**2 ) - args.huber_c ) loss = loss.mean() else: raise ValueError( f"Unsupported prediction type: {args.prediction_type}. Currently, only `sample` is supported." ) # 8. Backpropagate on the consistency training loss accelerator.backward(loss) if accelerator.sync_gradients: accelerator.clip_grad_norm_(unet.parameters(), args.max_grad_norm) optimizer.step() lr_scheduler.step() optimizer.zero_grad() # Checks if the accelerator has performed an optimization step behind the scenes if accelerator.sync_gradients: # 9. Update teacher_unet and ema_unet parameters using unet's parameters. teacher_unet.load_state_dict(unet.state_dict()) if args.use_ema: ema_unet.step(unet.parameters()) progress_bar.update(1) global_step += 1 if accelerator.is_main_process: # 10. Recalculate quantities depending on the global step, if necessary. new_discretization_steps = get_discretization_steps( global_step, args.max_train_steps, s_0=args.discretization_s_0, s_1=args.discretization_s_1, constant=args.constant_discretization_steps, ) current_skip_steps = get_skip_steps(global_step, initial_skip=args.skip_steps) if current_skip_steps >= new_discretization_steps: raise ValueError( f"The current skip steps is {current_skip_steps}, but should be smaller than the current" f" number of discretization steps {new_discretization_steps}." ) if new_discretization_steps != current_discretization_steps: ( noise_scheduler, current_timesteps, timestep_weights, timestep_loss_weights, ) = recalculate_num_discretization_step_values(new_discretization_steps, current_skip_steps) current_discretization_steps = new_discretization_steps if global_step % args.checkpointing_steps == 0: # _before_ saving state, check if this save would set us over the `checkpoints_total_limit` if args.checkpoints_total_limit is not None: checkpoints = os.listdir(args.output_dir) checkpoints = [d for d in checkpoints if d.startswith("checkpoint")] checkpoints = sorted(checkpoints, key=lambda x: int(x.split("-")[1])) # before we save the new checkpoint, we need to have at _most_ `checkpoints_total_limit - 1` checkpoints if len(checkpoints) >= args.checkpoints_total_limit: num_to_remove = len(checkpoints) - args.checkpoints_total_limit + 1 removing_checkpoints = checkpoints[0:num_to_remove] logger.info( f"{len(checkpoints)} checkpoints already exist, removing {len(removing_checkpoints)} checkpoints" ) logger.info(f"removing checkpoints: {', '.join(removing_checkpoints)}") for removing_checkpoint in removing_checkpoints: removing_checkpoint = os.path.join(args.output_dir, removing_checkpoint) shutil.rmtree(removing_checkpoint) save_path = os.path.join(args.output_dir, f"checkpoint-{global_step}") accelerator.save_state(save_path) logger.info(f"Saved state to {save_path}") if global_step % args.validation_steps == 0: # NOTE: since we do not use EMA for the teacher model, the teacher parameters and student # parameters are the same at this point in time log_validation(unet, noise_scheduler, args, accelerator, weight_dtype, global_step, "teacher") # teacher_unet.to(dtype=teacher_dtype) if args.use_ema: # Store the student unet weights and load the EMA weights. ema_unet.store(unet.parameters()) ema_unet.copy_to(unet.parameters()) log_validation( unet, noise_scheduler, args, accelerator, weight_dtype, global_step, "ema_student", ) # Restore student unet weights ema_unet.restore(unet.parameters()) logs = {"loss": loss.detach().item(), "lr": lr_scheduler.get_last_lr()[0], "step": global_step} if args.use_ema: logs["ema_decay"] = ema_unet.cur_decay_value progress_bar.set_postfix(**logs) accelerator.log(logs, step=global_step) if global_step >= args.max_train_steps: break # progress_bar.close() accelerator.wait_for_everyone() if accelerator.is_main_process: unet = unwrap_model(unet) pipeline = ConsistencyModelPipeline(unet=unet, scheduler=noise_scheduler) pipeline.save_pretrained(args.output_dir) # If using EMA, save EMA weights as well. if args.use_ema: ema_unet.copy_to(unet.parameters()) unet.save_pretrained(os.path.join(args.output_dir, "ema_unet")) if args.push_to_hub: upload_folder( repo_id=repo_id, folder_path=args.output_dir, commit_message="End of training", ignore_patterns=["step_*", "epoch_*"], ) accelerator.end_training() if __name__ == "__main__": args = parse_args() main(args)
diffusers/examples/research_projects/consistency_training/train_cm_ct_unconditional.py/0
{ "file_path": "diffusers/examples/research_projects/consistency_training/train_cm_ct_unconditional.py", "repo_id": "diffusers", "token_count": 26171 }
104
import torch.nn as nn from torchvision.models import efficientnet_v2_l, efficientnet_v2_s from diffusers.configuration_utils import ConfigMixin, register_to_config from diffusers.models.modeling_utils import ModelMixin class EfficientNetEncoder(ModelMixin, ConfigMixin): @register_to_config def __init__(self, c_latent=16, c_cond=1280, effnet="efficientnet_v2_s"): super().__init__() if effnet == "efficientnet_v2_s": self.backbone = efficientnet_v2_s(weights="DEFAULT").features else: self.backbone = efficientnet_v2_l(weights="DEFAULT").features self.mapper = nn.Sequential( nn.Conv2d(c_cond, c_latent, kernel_size=1, bias=False), nn.BatchNorm2d(c_latent), # then normalize them to have mean 0 and std 1 ) def forward(self, x): return self.mapper(self.backbone(x))
diffusers/examples/wuerstchen/text_to_image/modeling_efficient_net_encoder.py/0
{ "file_path": "diffusers/examples/wuerstchen/text_to_image/modeling_efficient_net_encoder.py", "repo_id": "diffusers", "token_count": 374 }
105
import argparse import json import torch from diffusers import AutoencoderKL, DDPMPipeline, DDPMScheduler, UNet2DModel, VQModel def shave_segments(path, n_shave_prefix_segments=1): """ Removes segments. Positive values shave the first segments, negative shave the last segments. """ if n_shave_prefix_segments >= 0: return ".".join(path.split(".")[n_shave_prefix_segments:]) else: return ".".join(path.split(".")[:n_shave_prefix_segments]) def renew_resnet_paths(old_list, n_shave_prefix_segments=0): mapping = [] for old_item in old_list: new_item = old_item new_item = new_item.replace("block.", "resnets.") new_item = new_item.replace("conv_shorcut", "conv1") new_item = new_item.replace("in_shortcut", "conv_shortcut") new_item = new_item.replace("temb_proj", "time_emb_proj") new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping def renew_attention_paths(old_list, n_shave_prefix_segments=0, in_mid=False): mapping = [] for old_item in old_list: new_item = old_item # In `model.mid`, the layer is called `attn`. if not in_mid: new_item = new_item.replace("attn", "attentions") new_item = new_item.replace(".k.", ".key.") new_item = new_item.replace(".v.", ".value.") new_item = new_item.replace(".q.", ".query.") new_item = new_item.replace("proj_out", "proj_attn") new_item = new_item.replace("norm", "group_norm") new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping def assign_to_checkpoint( paths, checkpoint, old_checkpoint, attention_paths_to_split=None, additional_replacements=None, config=None ): assert isinstance(paths, list), "Paths should be a list of dicts containing 'old' and 'new' keys." if attention_paths_to_split is not None: if config is None: raise ValueError("Please specify the config if setting 'attention_paths_to_split' to 'True'.") for path, path_map in attention_paths_to_split.items(): old_tensor = old_checkpoint[path] channels = old_tensor.shape[0] // 3 target_shape = (-1, channels) if len(old_tensor.shape) == 3 else (-1) num_heads = old_tensor.shape[0] // config.get("num_head_channels", 1) // 3 old_tensor = old_tensor.reshape((num_heads, 3 * channels // num_heads) + old_tensor.shape[1:]) query, key, value = old_tensor.split(channels // num_heads, dim=1) checkpoint[path_map["query"]] = query.reshape(target_shape).squeeze() checkpoint[path_map["key"]] = key.reshape(target_shape).squeeze() checkpoint[path_map["value"]] = value.reshape(target_shape).squeeze() for path in paths: new_path = path["new"] if attention_paths_to_split is not None and new_path in attention_paths_to_split: continue new_path = new_path.replace("down.", "down_blocks.") new_path = new_path.replace("up.", "up_blocks.") if additional_replacements is not None: for replacement in additional_replacements: new_path = new_path.replace(replacement["old"], replacement["new"]) if "attentions" in new_path: checkpoint[new_path] = old_checkpoint[path["old"]].squeeze() else: checkpoint[new_path] = old_checkpoint[path["old"]] def convert_ddpm_checkpoint(checkpoint, config): """ Takes a state dict and a config, and returns a converted checkpoint. """ new_checkpoint = {} new_checkpoint["time_embedding.linear_1.weight"] = checkpoint["temb.dense.0.weight"] new_checkpoint["time_embedding.linear_1.bias"] = checkpoint["temb.dense.0.bias"] new_checkpoint["time_embedding.linear_2.weight"] = checkpoint["temb.dense.1.weight"] new_checkpoint["time_embedding.linear_2.bias"] = checkpoint["temb.dense.1.bias"] new_checkpoint["conv_norm_out.weight"] = checkpoint["norm_out.weight"] new_checkpoint["conv_norm_out.bias"] = checkpoint["norm_out.bias"] new_checkpoint["conv_in.weight"] = checkpoint["conv_in.weight"] new_checkpoint["conv_in.bias"] = checkpoint["conv_in.bias"] new_checkpoint["conv_out.weight"] = checkpoint["conv_out.weight"] new_checkpoint["conv_out.bias"] = checkpoint["conv_out.bias"] num_down_blocks = len({".".join(layer.split(".")[:2]) for layer in checkpoint if "down" in layer}) down_blocks = { layer_id: [key for key in checkpoint if f"down.{layer_id}" in key] for layer_id in range(num_down_blocks) } num_up_blocks = len({".".join(layer.split(".")[:2]) for layer in checkpoint if "up" in layer}) up_blocks = {layer_id: [key for key in checkpoint if f"up.{layer_id}" in key] for layer_id in range(num_up_blocks)} for i in range(num_down_blocks): block_id = (i - 1) // (config["layers_per_block"] + 1) if any("downsample" in layer for layer in down_blocks[i]): new_checkpoint[f"down_blocks.{i}.downsamplers.0.conv.weight"] = checkpoint[ f"down.{i}.downsample.op.weight" ] new_checkpoint[f"down_blocks.{i}.downsamplers.0.conv.bias"] = checkpoint[f"down.{i}.downsample.op.bias"] # new_checkpoint[f'down_blocks.{i}.downsamplers.0.op.weight'] = checkpoint[f'down.{i}.downsample.conv.weight'] # new_checkpoint[f'down_blocks.{i}.downsamplers.0.op.bias'] = checkpoint[f'down.{i}.downsample.conv.bias'] if any("block" in layer for layer in down_blocks[i]): num_blocks = len( {".".join(shave_segments(layer, 2).split(".")[:2]) for layer in down_blocks[i] if "block" in layer} ) blocks = { layer_id: [key for key in down_blocks[i] if f"block.{layer_id}" in key] for layer_id in range(num_blocks) } if num_blocks > 0: for j in range(config["layers_per_block"]): paths = renew_resnet_paths(blocks[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint) if any("attn" in layer for layer in down_blocks[i]): num_attn = len( {".".join(shave_segments(layer, 2).split(".")[:2]) for layer in down_blocks[i] if "attn" in layer} ) attns = { layer_id: [key for key in down_blocks[i] if f"attn.{layer_id}" in key] for layer_id in range(num_blocks) } if num_attn > 0: for j in range(config["layers_per_block"]): paths = renew_attention_paths(attns[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint, config=config) mid_block_1_layers = [key for key in checkpoint if "mid.block_1" in key] mid_block_2_layers = [key for key in checkpoint if "mid.block_2" in key] mid_attn_1_layers = [key for key in checkpoint if "mid.attn_1" in key] # Mid new 2 paths = renew_resnet_paths(mid_block_1_layers) assign_to_checkpoint( paths, new_checkpoint, checkpoint, additional_replacements=[{"old": "mid.", "new": "mid_new_2."}, {"old": "block_1", "new": "resnets.0"}], ) paths = renew_resnet_paths(mid_block_2_layers) assign_to_checkpoint( paths, new_checkpoint, checkpoint, additional_replacements=[{"old": "mid.", "new": "mid_new_2."}, {"old": "block_2", "new": "resnets.1"}], ) paths = renew_attention_paths(mid_attn_1_layers, in_mid=True) assign_to_checkpoint( paths, new_checkpoint, checkpoint, additional_replacements=[{"old": "mid.", "new": "mid_new_2."}, {"old": "attn_1", "new": "attentions.0"}], ) for i in range(num_up_blocks): block_id = num_up_blocks - 1 - i if any("upsample" in layer for layer in up_blocks[i]): new_checkpoint[f"up_blocks.{block_id}.upsamplers.0.conv.weight"] = checkpoint[ f"up.{i}.upsample.conv.weight" ] new_checkpoint[f"up_blocks.{block_id}.upsamplers.0.conv.bias"] = checkpoint[f"up.{i}.upsample.conv.bias"] if any("block" in layer for layer in up_blocks[i]): num_blocks = len( {".".join(shave_segments(layer, 2).split(".")[:2]) for layer in up_blocks[i] if "block" in layer} ) blocks = { layer_id: [key for key in up_blocks[i] if f"block.{layer_id}" in key] for layer_id in range(num_blocks) } if num_blocks > 0: for j in range(config["layers_per_block"] + 1): replace_indices = {"old": f"up_blocks.{i}", "new": f"up_blocks.{block_id}"} paths = renew_resnet_paths(blocks[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint, additional_replacements=[replace_indices]) if any("attn" in layer for layer in up_blocks[i]): num_attn = len( {".".join(shave_segments(layer, 2).split(".")[:2]) for layer in up_blocks[i] if "attn" in layer} ) attns = { layer_id: [key for key in up_blocks[i] if f"attn.{layer_id}" in key] for layer_id in range(num_blocks) } if num_attn > 0: for j in range(config["layers_per_block"] + 1): replace_indices = {"old": f"up_blocks.{i}", "new": f"up_blocks.{block_id}"} paths = renew_attention_paths(attns[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint, additional_replacements=[replace_indices]) new_checkpoint = {k.replace("mid_new_2", "mid_block"): v for k, v in new_checkpoint.items()} return new_checkpoint def convert_vq_autoenc_checkpoint(checkpoint, config): """ Takes a state dict and a config, and returns a converted checkpoint. """ new_checkpoint = {} new_checkpoint["encoder.conv_norm_out.weight"] = checkpoint["encoder.norm_out.weight"] new_checkpoint["encoder.conv_norm_out.bias"] = checkpoint["encoder.norm_out.bias"] new_checkpoint["encoder.conv_in.weight"] = checkpoint["encoder.conv_in.weight"] new_checkpoint["encoder.conv_in.bias"] = checkpoint["encoder.conv_in.bias"] new_checkpoint["encoder.conv_out.weight"] = checkpoint["encoder.conv_out.weight"] new_checkpoint["encoder.conv_out.bias"] = checkpoint["encoder.conv_out.bias"] new_checkpoint["decoder.conv_norm_out.weight"] = checkpoint["decoder.norm_out.weight"] new_checkpoint["decoder.conv_norm_out.bias"] = checkpoint["decoder.norm_out.bias"] new_checkpoint["decoder.conv_in.weight"] = checkpoint["decoder.conv_in.weight"] new_checkpoint["decoder.conv_in.bias"] = checkpoint["decoder.conv_in.bias"] new_checkpoint["decoder.conv_out.weight"] = checkpoint["decoder.conv_out.weight"] new_checkpoint["decoder.conv_out.bias"] = checkpoint["decoder.conv_out.bias"] num_down_blocks = len({".".join(layer.split(".")[:3]) for layer in checkpoint if "down" in layer}) down_blocks = { layer_id: [key for key in checkpoint if f"down.{layer_id}" in key] for layer_id in range(num_down_blocks) } num_up_blocks = len({".".join(layer.split(".")[:3]) for layer in checkpoint if "up" in layer}) up_blocks = {layer_id: [key for key in checkpoint if f"up.{layer_id}" in key] for layer_id in range(num_up_blocks)} for i in range(num_down_blocks): block_id = (i - 1) // (config["layers_per_block"] + 1) if any("downsample" in layer for layer in down_blocks[i]): new_checkpoint[f"encoder.down_blocks.{i}.downsamplers.0.conv.weight"] = checkpoint[ f"encoder.down.{i}.downsample.conv.weight" ] new_checkpoint[f"encoder.down_blocks.{i}.downsamplers.0.conv.bias"] = checkpoint[ f"encoder.down.{i}.downsample.conv.bias" ] if any("block" in layer for layer in down_blocks[i]): num_blocks = len( {".".join(shave_segments(layer, 3).split(".")[:3]) for layer in down_blocks[i] if "block" in layer} ) blocks = { layer_id: [key for key in down_blocks[i] if f"block.{layer_id}" in key] for layer_id in range(num_blocks) } if num_blocks > 0: for j in range(config["layers_per_block"]): paths = renew_resnet_paths(blocks[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint) if any("attn" in layer for layer in down_blocks[i]): num_attn = len( {".".join(shave_segments(layer, 3).split(".")[:3]) for layer in down_blocks[i] if "attn" in layer} ) attns = { layer_id: [key for key in down_blocks[i] if f"attn.{layer_id}" in key] for layer_id in range(num_blocks) } if num_attn > 0: for j in range(config["layers_per_block"]): paths = renew_attention_paths(attns[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint, config=config) mid_block_1_layers = [key for key in checkpoint if "mid.block_1" in key] mid_block_2_layers = [key for key in checkpoint if "mid.block_2" in key] mid_attn_1_layers = [key for key in checkpoint if "mid.attn_1" in key] # Mid new 2 paths = renew_resnet_paths(mid_block_1_layers) assign_to_checkpoint( paths, new_checkpoint, checkpoint, additional_replacements=[{"old": "mid.", "new": "mid_new_2."}, {"old": "block_1", "new": "resnets.0"}], ) paths = renew_resnet_paths(mid_block_2_layers) assign_to_checkpoint( paths, new_checkpoint, checkpoint, additional_replacements=[{"old": "mid.", "new": "mid_new_2."}, {"old": "block_2", "new": "resnets.1"}], ) paths = renew_attention_paths(mid_attn_1_layers, in_mid=True) assign_to_checkpoint( paths, new_checkpoint, checkpoint, additional_replacements=[{"old": "mid.", "new": "mid_new_2."}, {"old": "attn_1", "new": "attentions.0"}], ) for i in range(num_up_blocks): block_id = num_up_blocks - 1 - i if any("upsample" in layer for layer in up_blocks[i]): new_checkpoint[f"decoder.up_blocks.{block_id}.upsamplers.0.conv.weight"] = checkpoint[ f"decoder.up.{i}.upsample.conv.weight" ] new_checkpoint[f"decoder.up_blocks.{block_id}.upsamplers.0.conv.bias"] = checkpoint[ f"decoder.up.{i}.upsample.conv.bias" ] if any("block" in layer for layer in up_blocks[i]): num_blocks = len( {".".join(shave_segments(layer, 3).split(".")[:3]) for layer in up_blocks[i] if "block" in layer} ) blocks = { layer_id: [key for key in up_blocks[i] if f"block.{layer_id}" in key] for layer_id in range(num_blocks) } if num_blocks > 0: for j in range(config["layers_per_block"] + 1): replace_indices = {"old": f"up_blocks.{i}", "new": f"up_blocks.{block_id}"} paths = renew_resnet_paths(blocks[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint, additional_replacements=[replace_indices]) if any("attn" in layer for layer in up_blocks[i]): num_attn = len( {".".join(shave_segments(layer, 3).split(".")[:3]) for layer in up_blocks[i] if "attn" in layer} ) attns = { layer_id: [key for key in up_blocks[i] if f"attn.{layer_id}" in key] for layer_id in range(num_blocks) } if num_attn > 0: for j in range(config["layers_per_block"] + 1): replace_indices = {"old": f"up_blocks.{i}", "new": f"up_blocks.{block_id}"} paths = renew_attention_paths(attns[j]) assign_to_checkpoint(paths, new_checkpoint, checkpoint, additional_replacements=[replace_indices]) new_checkpoint = {k.replace("mid_new_2", "mid_block"): v for k, v in new_checkpoint.items()} new_checkpoint["quant_conv.weight"] = checkpoint["quant_conv.weight"] new_checkpoint["quant_conv.bias"] = checkpoint["quant_conv.bias"] if "quantize.embedding.weight" in checkpoint: new_checkpoint["quantize.embedding.weight"] = checkpoint["quantize.embedding.weight"] new_checkpoint["post_quant_conv.weight"] = checkpoint["post_quant_conv.weight"] new_checkpoint["post_quant_conv.bias"] = checkpoint["post_quant_conv.bias"] return new_checkpoint if __name__ == "__main__": parser = argparse.ArgumentParser() parser.add_argument( "--checkpoint_path", default=None, type=str, required=True, help="Path to the checkpoint to convert." ) parser.add_argument( "--config_file", default=None, type=str, required=True, help="The config json file corresponding to the architecture.", ) parser.add_argument("--dump_path", default=None, type=str, required=True, help="Path to the output model.") args = parser.parse_args() checkpoint = torch.load(args.checkpoint_path) with open(args.config_file) as f: config = json.loads(f.read()) # unet case key_prefix_set = {key.split(".")[0] for key in checkpoint.keys()} if "encoder" in key_prefix_set and "decoder" in key_prefix_set: converted_checkpoint = convert_vq_autoenc_checkpoint(checkpoint, config) else: converted_checkpoint = convert_ddpm_checkpoint(checkpoint, config) if "ddpm" in config: del config["ddpm"] if config["_class_name"] == "VQModel": model = VQModel(**config) model.load_state_dict(converted_checkpoint) model.save_pretrained(args.dump_path) elif config["_class_name"] == "AutoencoderKL": model = AutoencoderKL(**config) model.load_state_dict(converted_checkpoint) model.save_pretrained(args.dump_path) else: model = UNet2DModel(**config) model.load_state_dict(converted_checkpoint) scheduler = DDPMScheduler.from_config("/".join(args.checkpoint_path.split("/")[:-1])) pipe = DDPMPipeline(unet=model, scheduler=scheduler) pipe.save_pretrained(args.dump_path)
diffusers/scripts/convert_ddpm_original_checkpoint_to_diffusers.py/0
{ "file_path": "diffusers/scripts/convert_ddpm_original_checkpoint_to_diffusers.py", "repo_id": "diffusers", "token_count": 8490 }
106
#!/usr/bin/env python3 import argparse import os import jax as jnp import numpy as onp import torch import torch.nn as nn from music_spectrogram_diffusion import inference from t5x import checkpoints from diffusers import DDPMScheduler, OnnxRuntimeModel, SpectrogramDiffusionPipeline from diffusers.pipelines.spectrogram_diffusion import SpectrogramContEncoder, SpectrogramNotesEncoder, T5FilmDecoder MODEL = "base_with_context" def load_notes_encoder(weights, model): model.token_embedder.weight = nn.Parameter(torch.FloatTensor(weights["token_embedder"]["embedding"])) model.position_encoding.weight = nn.Parameter( torch.FloatTensor(weights["Embed_0"]["embedding"]), requires_grad=False ) for lyr_num, lyr in enumerate(model.encoders): ly_weight = weights[f"layers_{lyr_num}"] lyr.layer[0].layer_norm.weight = nn.Parameter( torch.FloatTensor(ly_weight["pre_attention_layer_norm"]["scale"]) ) attention_weights = ly_weight["attention"] lyr.layer[0].SelfAttention.q.weight = nn.Parameter(torch.FloatTensor(attention_weights["query"]["kernel"].T)) lyr.layer[0].SelfAttention.k.weight = nn.Parameter(torch.FloatTensor(attention_weights["key"]["kernel"].T)) lyr.layer[0].SelfAttention.v.weight = nn.Parameter(torch.FloatTensor(attention_weights["value"]["kernel"].T)) lyr.layer[0].SelfAttention.o.weight = nn.Parameter(torch.FloatTensor(attention_weights["out"]["kernel"].T)) lyr.layer[1].layer_norm.weight = nn.Parameter(torch.FloatTensor(ly_weight["pre_mlp_layer_norm"]["scale"])) lyr.layer[1].DenseReluDense.wi_0.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wi_0"]["kernel"].T)) lyr.layer[1].DenseReluDense.wi_1.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wi_1"]["kernel"].T)) lyr.layer[1].DenseReluDense.wo.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wo"]["kernel"].T)) model.layer_norm.weight = nn.Parameter(torch.FloatTensor(weights["encoder_norm"]["scale"])) return model def load_continuous_encoder(weights, model): model.input_proj.weight = nn.Parameter(torch.FloatTensor(weights["input_proj"]["kernel"].T)) model.position_encoding.weight = nn.Parameter( torch.FloatTensor(weights["Embed_0"]["embedding"]), requires_grad=False ) for lyr_num, lyr in enumerate(model.encoders): ly_weight = weights[f"layers_{lyr_num}"] attention_weights = ly_weight["attention"] lyr.layer[0].SelfAttention.q.weight = nn.Parameter(torch.FloatTensor(attention_weights["query"]["kernel"].T)) lyr.layer[0].SelfAttention.k.weight = nn.Parameter(torch.FloatTensor(attention_weights["key"]["kernel"].T)) lyr.layer[0].SelfAttention.v.weight = nn.Parameter(torch.FloatTensor(attention_weights["value"]["kernel"].T)) lyr.layer[0].SelfAttention.o.weight = nn.Parameter(torch.FloatTensor(attention_weights["out"]["kernel"].T)) lyr.layer[0].layer_norm.weight = nn.Parameter( torch.FloatTensor(ly_weight["pre_attention_layer_norm"]["scale"]) ) lyr.layer[1].DenseReluDense.wi_0.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wi_0"]["kernel"].T)) lyr.layer[1].DenseReluDense.wi_1.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wi_1"]["kernel"].T)) lyr.layer[1].DenseReluDense.wo.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wo"]["kernel"].T)) lyr.layer[1].layer_norm.weight = nn.Parameter(torch.FloatTensor(ly_weight["pre_mlp_layer_norm"]["scale"])) model.layer_norm.weight = nn.Parameter(torch.FloatTensor(weights["encoder_norm"]["scale"])) return model def load_decoder(weights, model): model.conditioning_emb[0].weight = nn.Parameter(torch.FloatTensor(weights["time_emb_dense0"]["kernel"].T)) model.conditioning_emb[2].weight = nn.Parameter(torch.FloatTensor(weights["time_emb_dense1"]["kernel"].T)) model.position_encoding.weight = nn.Parameter( torch.FloatTensor(weights["Embed_0"]["embedding"]), requires_grad=False ) model.continuous_inputs_projection.weight = nn.Parameter( torch.FloatTensor(weights["continuous_inputs_projection"]["kernel"].T) ) for lyr_num, lyr in enumerate(model.decoders): ly_weight = weights[f"layers_{lyr_num}"] lyr.layer[0].layer_norm.weight = nn.Parameter( torch.FloatTensor(ly_weight["pre_self_attention_layer_norm"]["scale"]) ) lyr.layer[0].FiLMLayer.scale_bias.weight = nn.Parameter( torch.FloatTensor(ly_weight["FiLMLayer_0"]["DenseGeneral_0"]["kernel"].T) ) attention_weights = ly_weight["self_attention"] lyr.layer[0].attention.to_q.weight = nn.Parameter(torch.FloatTensor(attention_weights["query"]["kernel"].T)) lyr.layer[0].attention.to_k.weight = nn.Parameter(torch.FloatTensor(attention_weights["key"]["kernel"].T)) lyr.layer[0].attention.to_v.weight = nn.Parameter(torch.FloatTensor(attention_weights["value"]["kernel"].T)) lyr.layer[0].attention.to_out[0].weight = nn.Parameter(torch.FloatTensor(attention_weights["out"]["kernel"].T)) attention_weights = ly_weight["MultiHeadDotProductAttention_0"] lyr.layer[1].attention.to_q.weight = nn.Parameter(torch.FloatTensor(attention_weights["query"]["kernel"].T)) lyr.layer[1].attention.to_k.weight = nn.Parameter(torch.FloatTensor(attention_weights["key"]["kernel"].T)) lyr.layer[1].attention.to_v.weight = nn.Parameter(torch.FloatTensor(attention_weights["value"]["kernel"].T)) lyr.layer[1].attention.to_out[0].weight = nn.Parameter(torch.FloatTensor(attention_weights["out"]["kernel"].T)) lyr.layer[1].layer_norm.weight = nn.Parameter( torch.FloatTensor(ly_weight["pre_cross_attention_layer_norm"]["scale"]) ) lyr.layer[2].layer_norm.weight = nn.Parameter(torch.FloatTensor(ly_weight["pre_mlp_layer_norm"]["scale"])) lyr.layer[2].film.scale_bias.weight = nn.Parameter( torch.FloatTensor(ly_weight["FiLMLayer_1"]["DenseGeneral_0"]["kernel"].T) ) lyr.layer[2].DenseReluDense.wi_0.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wi_0"]["kernel"].T)) lyr.layer[2].DenseReluDense.wi_1.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wi_1"]["kernel"].T)) lyr.layer[2].DenseReluDense.wo.weight = nn.Parameter(torch.FloatTensor(ly_weight["mlp"]["wo"]["kernel"].T)) model.decoder_norm.weight = nn.Parameter(torch.FloatTensor(weights["decoder_norm"]["scale"])) model.spec_out.weight = nn.Parameter(torch.FloatTensor(weights["spec_out_dense"]["kernel"].T)) return model def main(args): t5_checkpoint = checkpoints.load_t5x_checkpoint(args.checkpoint_path) t5_checkpoint = jnp.tree_util.tree_map(onp.array, t5_checkpoint) gin_overrides = [ "from __gin__ import dynamic_registration", "from music_spectrogram_diffusion.models.diffusion import diffusion_utils", "diffusion_utils.ClassifierFreeGuidanceConfig.eval_condition_weight = 2.0", "diffusion_utils.DiffusionConfig.classifier_free_guidance = @diffusion_utils.ClassifierFreeGuidanceConfig()", ] gin_file = os.path.join(args.checkpoint_path, "..", "config.gin") gin_config = inference.parse_training_gin_file(gin_file, gin_overrides) synth_model = inference.InferenceModel(args.checkpoint_path, gin_config) scheduler = DDPMScheduler(beta_schedule="squaredcos_cap_v2", variance_type="fixed_large") notes_encoder = SpectrogramNotesEncoder( max_length=synth_model.sequence_length["inputs"], vocab_size=synth_model.model.module.config.vocab_size, d_model=synth_model.model.module.config.emb_dim, dropout_rate=synth_model.model.module.config.dropout_rate, num_layers=synth_model.model.module.config.num_encoder_layers, num_heads=synth_model.model.module.config.num_heads, d_kv=synth_model.model.module.config.head_dim, d_ff=synth_model.model.module.config.mlp_dim, feed_forward_proj="gated-gelu", ) continuous_encoder = SpectrogramContEncoder( input_dims=synth_model.audio_codec.n_dims, targets_context_length=synth_model.sequence_length["targets_context"], d_model=synth_model.model.module.config.emb_dim, dropout_rate=synth_model.model.module.config.dropout_rate, num_layers=synth_model.model.module.config.num_encoder_layers, num_heads=synth_model.model.module.config.num_heads, d_kv=synth_model.model.module.config.head_dim, d_ff=synth_model.model.module.config.mlp_dim, feed_forward_proj="gated-gelu", ) decoder = T5FilmDecoder( input_dims=synth_model.audio_codec.n_dims, targets_length=synth_model.sequence_length["targets_context"], max_decoder_noise_time=synth_model.model.module.config.max_decoder_noise_time, d_model=synth_model.model.module.config.emb_dim, num_layers=synth_model.model.module.config.num_decoder_layers, num_heads=synth_model.model.module.config.num_heads, d_kv=synth_model.model.module.config.head_dim, d_ff=synth_model.model.module.config.mlp_dim, dropout_rate=synth_model.model.module.config.dropout_rate, ) notes_encoder = load_notes_encoder(t5_checkpoint["target"]["token_encoder"], notes_encoder) continuous_encoder = load_continuous_encoder(t5_checkpoint["target"]["continuous_encoder"], continuous_encoder) decoder = load_decoder(t5_checkpoint["target"]["decoder"], decoder) melgan = OnnxRuntimeModel.from_pretrained("kashif/soundstream_mel_decoder") pipe = SpectrogramDiffusionPipeline( notes_encoder=notes_encoder, continuous_encoder=continuous_encoder, decoder=decoder, scheduler=scheduler, melgan=melgan, ) if args.save: pipe.save_pretrained(args.output_path) if __name__ == "__main__": parser = argparse.ArgumentParser() parser.add_argument("--output_path", default=None, type=str, required=True, help="Path to the converted model.") parser.add_argument( "--save", default=True, type=bool, required=False, help="Whether to save the converted model or not." ) parser.add_argument( "--checkpoint_path", default=f"{MODEL}/checkpoint_500000", type=str, required=False, help="Path to the original jax model checkpoint.", ) args = parser.parse_args() main(args)
diffusers/scripts/convert_music_spectrogram_to_diffusers.py/0
{ "file_path": "diffusers/scripts/convert_music_spectrogram_to_diffusers.py", "repo_id": "diffusers", "token_count": 4469 }
107
# Convert the original UniDiffuser checkpoints into diffusers equivalents. import argparse from argparse import Namespace import torch from transformers import ( CLIPImageProcessor, CLIPTextConfig, CLIPTextModel, CLIPTokenizer, CLIPVisionConfig, CLIPVisionModelWithProjection, GPT2Tokenizer, ) from diffusers import ( AutoencoderKL, DPMSolverMultistepScheduler, UniDiffuserModel, UniDiffuserPipeline, UniDiffuserTextDecoder, ) SCHEDULER_CONFIG = Namespace( **{ "beta_start": 0.00085, "beta_end": 0.012, "beta_schedule": "scaled_linear", "solver_order": 3, } ) # Copied from diffusers.pipelines.stable_diffusion.convert_from_ckpt.shave_segments def shave_segments(path, n_shave_prefix_segments=1): """ Removes segments. Positive values shave the first segments, negative shave the last segments. """ if n_shave_prefix_segments >= 0: return ".".join(path.split(".")[n_shave_prefix_segments:]) else: return ".".join(path.split(".")[:n_shave_prefix_segments]) # Copied from diffusers.pipelines.stable_diffusion.convert_from_ckpt.renew_vae_resnet_paths def renew_vae_resnet_paths(old_list, n_shave_prefix_segments=0): """ Updates paths inside resnets to the new naming scheme (local renaming) """ mapping = [] for old_item in old_list: new_item = old_item new_item = new_item.replace("nin_shortcut", "conv_shortcut") new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping # Copied from diffusers.pipelines.stable_diffusion.convert_from_ckpt.renew_vae_attention_paths def renew_vae_attention_paths(old_list, n_shave_prefix_segments=0): """ Updates paths inside attentions to the new naming scheme (local renaming) """ mapping = [] for old_item in old_list: new_item = old_item new_item = new_item.replace("norm.weight", "group_norm.weight") new_item = new_item.replace("norm.bias", "group_norm.bias") new_item = new_item.replace("q.weight", "to_q.weight") new_item = new_item.replace("q.bias", "to_q.bias") new_item = new_item.replace("k.weight", "to_k.weight") new_item = new_item.replace("k.bias", "to_k.bias") new_item = new_item.replace("v.weight", "to_v.weight") new_item = new_item.replace("v.bias", "to_v.bias") new_item = new_item.replace("proj_out.weight", "to_out.0.weight") new_item = new_item.replace("proj_out.bias", "to_out.0.bias") new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping # Copied from diffusers.pipelines.stable_diffusion.convert_from_ckpt.conv_attn_to_linear def conv_attn_to_linear(checkpoint): keys = list(checkpoint.keys()) attn_keys = ["query.weight", "key.weight", "value.weight"] for key in keys: if ".".join(key.split(".")[-2:]) in attn_keys: if checkpoint[key].ndim > 2: checkpoint[key] = checkpoint[key][:, :, 0, 0] elif "proj_attn.weight" in key: if checkpoint[key].ndim > 2: checkpoint[key] = checkpoint[key][:, :, 0] # Modified from diffusers.pipelines.stable_diffusion.convert_from_ckpt.assign_to_checkpoint # config.num_head_channels => num_head_channels def assign_to_checkpoint( paths, checkpoint, old_checkpoint, attention_paths_to_split=None, additional_replacements=None, num_head_channels=1, ): """ This does the final conversion step: take locally converted weights and apply a global renaming to them. It splits attention layers, and takes into account additional replacements that may arise. Assigns the weights to the new checkpoint. """ assert isinstance(paths, list), "Paths should be a list of dicts containing 'old' and 'new' keys." # Splits the attention layers into three variables. if attention_paths_to_split is not None: for path, path_map in attention_paths_to_split.items(): old_tensor = old_checkpoint[path] channels = old_tensor.shape[0] // 3 target_shape = (-1, channels) if len(old_tensor.shape) == 3 else (-1) num_heads = old_tensor.shape[0] // num_head_channels // 3 old_tensor = old_tensor.reshape((num_heads, 3 * channels // num_heads) + old_tensor.shape[1:]) query, key, value = old_tensor.split(channels // num_heads, dim=1) checkpoint[path_map["query"]] = query.reshape(target_shape) checkpoint[path_map["key"]] = key.reshape(target_shape) checkpoint[path_map["value"]] = value.reshape(target_shape) for path in paths: new_path = path["new"] # These have already been assigned if attention_paths_to_split is not None and new_path in attention_paths_to_split: continue # Global renaming happens here new_path = new_path.replace("middle_block.0", "mid_block.resnets.0") new_path = new_path.replace("middle_block.1", "mid_block.attentions.0") new_path = new_path.replace("middle_block.2", "mid_block.resnets.1") if additional_replacements is not None: for replacement in additional_replacements: new_path = new_path.replace(replacement["old"], replacement["new"]) # proj_attn.weight has to be converted from conv 1D to linear is_attn_weight = "proj_attn.weight" in new_path or ("attentions" in new_path and "to_" in new_path) shape = old_checkpoint[path["old"]].shape if is_attn_weight and len(shape) == 3: checkpoint[new_path] = old_checkpoint[path["old"]][:, :, 0] elif is_attn_weight and len(shape) == 4: checkpoint[new_path] = old_checkpoint[path["old"]][:, :, 0, 0] else: checkpoint[new_path] = old_checkpoint[path["old"]] def create_vae_diffusers_config(config_type): # Hardcoded for now if args.config_type == "test": vae_config = create_vae_diffusers_config_test() elif args.config_type == "big": vae_config = create_vae_diffusers_config_big() else: raise NotImplementedError( f"Config type {config_type} is not implemented, currently only config types" " 'test' and 'big' are available." ) return vae_config def create_unidiffuser_unet_config(config_type, version): # Hardcoded for now if args.config_type == "test": unet_config = create_unidiffuser_unet_config_test() elif args.config_type == "big": unet_config = create_unidiffuser_unet_config_big() else: raise NotImplementedError( f"Config type {config_type} is not implemented, currently only config types" " 'test' and 'big' are available." ) # Unidiffuser-v1 uses data type embeddings if version == 1: unet_config["use_data_type_embedding"] = True return unet_config def create_text_decoder_config(config_type): # Hardcoded for now if args.config_type == "test": text_decoder_config = create_text_decoder_config_test() elif args.config_type == "big": text_decoder_config = create_text_decoder_config_big() else: raise NotImplementedError( f"Config type {config_type} is not implemented, currently only config types" " 'test' and 'big' are available." ) return text_decoder_config # Hardcoded configs for test versions of the UniDiffuser models, corresponding to those in the fast default tests. def create_vae_diffusers_config_test(): vae_config = { "sample_size": 32, "in_channels": 3, "out_channels": 3, "down_block_types": ["DownEncoderBlock2D", "DownEncoderBlock2D"], "up_block_types": ["UpDecoderBlock2D", "UpDecoderBlock2D"], "block_out_channels": [32, 64], "latent_channels": 4, "layers_per_block": 1, } return vae_config def create_unidiffuser_unet_config_test(): unet_config = { "text_dim": 32, "clip_img_dim": 32, "num_text_tokens": 77, "num_attention_heads": 2, "attention_head_dim": 8, "in_channels": 4, "out_channels": 4, "num_layers": 2, "dropout": 0.0, "norm_num_groups": 32, "attention_bias": False, "sample_size": 16, "patch_size": 2, "activation_fn": "gelu", "num_embeds_ada_norm": 1000, "norm_type": "layer_norm", "block_type": "unidiffuser", "pre_layer_norm": False, "use_timestep_embedding": False, "norm_elementwise_affine": True, "use_patch_pos_embed": False, "ff_final_dropout": True, "use_data_type_embedding": False, } return unet_config def create_text_decoder_config_test(): text_decoder_config = { "prefix_length": 77, "prefix_inner_dim": 32, "prefix_hidden_dim": 32, "vocab_size": 1025, # 1024 + 1 for new EOS token "n_positions": 1024, "n_embd": 32, "n_layer": 5, "n_head": 4, "n_inner": 37, "activation_function": "gelu", "resid_pdrop": 0.1, "embd_pdrop": 0.1, "attn_pdrop": 0.1, "layer_norm_epsilon": 1e-5, "initializer_range": 0.02, } return text_decoder_config # Hardcoded configs for the UniDiffuser V1 model at https://huggingface.co/thu-ml/unidiffuser-v1 # See also https://github.com/thu-ml/unidiffuser/blob/main/configs/sample_unidiffuser_v1.py def create_vae_diffusers_config_big(): vae_config = { "sample_size": 256, "in_channels": 3, "out_channels": 3, "down_block_types": ["DownEncoderBlock2D", "DownEncoderBlock2D", "DownEncoderBlock2D", "DownEncoderBlock2D"], "up_block_types": ["UpDecoderBlock2D", "UpDecoderBlock2D", "UpDecoderBlock2D", "UpDecoderBlock2D"], "block_out_channels": [128, 256, 512, 512], "latent_channels": 4, "layers_per_block": 2, } return vae_config def create_unidiffuser_unet_config_big(): unet_config = { "text_dim": 64, "clip_img_dim": 512, "num_text_tokens": 77, "num_attention_heads": 24, "attention_head_dim": 64, "in_channels": 4, "out_channels": 4, "num_layers": 30, "dropout": 0.0, "norm_num_groups": 32, "attention_bias": False, "sample_size": 64, "patch_size": 2, "activation_fn": "gelu", "num_embeds_ada_norm": 1000, "norm_type": "layer_norm", "block_type": "unidiffuser", "pre_layer_norm": False, "use_timestep_embedding": False, "norm_elementwise_affine": True, "use_patch_pos_embed": False, "ff_final_dropout": True, "use_data_type_embedding": False, } return unet_config # From https://huggingface.co/gpt2/blob/main/config.json, the GPT2 checkpoint used by UniDiffuser def create_text_decoder_config_big(): text_decoder_config = { "prefix_length": 77, "prefix_inner_dim": 768, "prefix_hidden_dim": 64, "vocab_size": 50258, # 50257 + 1 for new EOS token "n_positions": 1024, "n_embd": 768, "n_layer": 12, "n_head": 12, "n_inner": 3072, "activation_function": "gelu", "resid_pdrop": 0.1, "embd_pdrop": 0.1, "attn_pdrop": 0.1, "layer_norm_epsilon": 1e-5, "initializer_range": 0.02, } return text_decoder_config # Based on diffusers.pipelines.stable_diffusion.convert_from_ckpt.convert_ldm_vae_checkpoint def convert_vae_to_diffusers(ckpt, diffusers_model, num_head_channels=1): """ Converts a UniDiffuser autoencoder_kl.pth checkpoint to a diffusers AutoencoderKL. """ # autoencoder_kl.pth ckpt is a torch state dict vae_state_dict = torch.load(ckpt, map_location="cpu") new_checkpoint = {} new_checkpoint["encoder.conv_in.weight"] = vae_state_dict["encoder.conv_in.weight"] new_checkpoint["encoder.conv_in.bias"] = vae_state_dict["encoder.conv_in.bias"] new_checkpoint["encoder.conv_out.weight"] = vae_state_dict["encoder.conv_out.weight"] new_checkpoint["encoder.conv_out.bias"] = vae_state_dict["encoder.conv_out.bias"] new_checkpoint["encoder.conv_norm_out.weight"] = vae_state_dict["encoder.norm_out.weight"] new_checkpoint["encoder.conv_norm_out.bias"] = vae_state_dict["encoder.norm_out.bias"] new_checkpoint["decoder.conv_in.weight"] = vae_state_dict["decoder.conv_in.weight"] new_checkpoint["decoder.conv_in.bias"] = vae_state_dict["decoder.conv_in.bias"] new_checkpoint["decoder.conv_out.weight"] = vae_state_dict["decoder.conv_out.weight"] new_checkpoint["decoder.conv_out.bias"] = vae_state_dict["decoder.conv_out.bias"] new_checkpoint["decoder.conv_norm_out.weight"] = vae_state_dict["decoder.norm_out.weight"] new_checkpoint["decoder.conv_norm_out.bias"] = vae_state_dict["decoder.norm_out.bias"] new_checkpoint["quant_conv.weight"] = vae_state_dict["quant_conv.weight"] new_checkpoint["quant_conv.bias"] = vae_state_dict["quant_conv.bias"] new_checkpoint["post_quant_conv.weight"] = vae_state_dict["post_quant_conv.weight"] new_checkpoint["post_quant_conv.bias"] = vae_state_dict["post_quant_conv.bias"] # Retrieves the keys for the encoder down blocks only num_down_blocks = len({".".join(layer.split(".")[:3]) for layer in vae_state_dict if "encoder.down" in layer}) down_blocks = { layer_id: [key for key in vae_state_dict if f"down.{layer_id}" in key] for layer_id in range(num_down_blocks) } # Retrieves the keys for the decoder up blocks only num_up_blocks = len({".".join(layer.split(".")[:3]) for layer in vae_state_dict if "decoder.up" in layer}) up_blocks = { layer_id: [key for key in vae_state_dict if f"up.{layer_id}" in key] for layer_id in range(num_up_blocks) } for i in range(num_down_blocks): resnets = [key for key in down_blocks[i] if f"down.{i}" in key and f"down.{i}.downsample" not in key] if f"encoder.down.{i}.downsample.conv.weight" in vae_state_dict: new_checkpoint[f"encoder.down_blocks.{i}.downsamplers.0.conv.weight"] = vae_state_dict.pop( f"encoder.down.{i}.downsample.conv.weight" ) new_checkpoint[f"encoder.down_blocks.{i}.downsamplers.0.conv.bias"] = vae_state_dict.pop( f"encoder.down.{i}.downsample.conv.bias" ) paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"down.{i}.block", "new": f"down_blocks.{i}.resnets"} assign_to_checkpoint( paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], num_head_channels=num_head_channels, # not used in vae ) mid_resnets = [key for key in vae_state_dict if "encoder.mid.block" in key] num_mid_res_blocks = 2 for i in range(1, num_mid_res_blocks + 1): resnets = [key for key in mid_resnets if f"encoder.mid.block_{i}" in key] paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"mid.block_{i}", "new": f"mid_block.resnets.{i - 1}"} assign_to_checkpoint( paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], num_head_channels=num_head_channels, # not used in vae ) mid_attentions = [key for key in vae_state_dict if "encoder.mid.attn" in key] paths = renew_vae_attention_paths(mid_attentions) meta_path = {"old": "mid.attn_1", "new": "mid_block.attentions.0"} assign_to_checkpoint( paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], num_head_channels=num_head_channels, # not used in vae ) conv_attn_to_linear(new_checkpoint) for i in range(num_up_blocks): block_id = num_up_blocks - 1 - i resnets = [ key for key in up_blocks[block_id] if f"up.{block_id}" in key and f"up.{block_id}.upsample" not in key ] if f"decoder.up.{block_id}.upsample.conv.weight" in vae_state_dict: new_checkpoint[f"decoder.up_blocks.{i}.upsamplers.0.conv.weight"] = vae_state_dict[ f"decoder.up.{block_id}.upsample.conv.weight" ] new_checkpoint[f"decoder.up_blocks.{i}.upsamplers.0.conv.bias"] = vae_state_dict[ f"decoder.up.{block_id}.upsample.conv.bias" ] paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"up.{block_id}.block", "new": f"up_blocks.{i}.resnets"} assign_to_checkpoint( paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], num_head_channels=num_head_channels, # not used in vae ) mid_resnets = [key for key in vae_state_dict if "decoder.mid.block" in key] num_mid_res_blocks = 2 for i in range(1, num_mid_res_blocks + 1): resnets = [key for key in mid_resnets if f"decoder.mid.block_{i}" in key] paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"mid.block_{i}", "new": f"mid_block.resnets.{i - 1}"} assign_to_checkpoint( paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], num_head_channels=num_head_channels, # not used in vae ) mid_attentions = [key for key in vae_state_dict if "decoder.mid.attn" in key] paths = renew_vae_attention_paths(mid_attentions) meta_path = {"old": "mid.attn_1", "new": "mid_block.attentions.0"} assign_to_checkpoint( paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], num_head_channels=num_head_channels, # not used in vae ) conv_attn_to_linear(new_checkpoint) missing_keys, unexpected_keys = diffusers_model.load_state_dict(new_checkpoint) for missing_key in missing_keys: print(f"Missing key: {missing_key}") for unexpected_key in unexpected_keys: print(f"Unexpected key: {unexpected_key}") return diffusers_model def convert_uvit_block_to_diffusers_block( uvit_state_dict, new_state_dict, block_prefix, new_prefix="transformer.transformer_", skip_connection=False, ): """ Maps the keys in a UniDiffuser transformer block (`Block`) to the keys in a diffusers transformer block (`UTransformerBlock`/`UniDiffuserBlock`). """ prefix = new_prefix + block_prefix if skip_connection: new_state_dict[prefix + ".skip.skip_linear.weight"] = uvit_state_dict[block_prefix + ".skip_linear.weight"] new_state_dict[prefix + ".skip.skip_linear.bias"] = uvit_state_dict[block_prefix + ".skip_linear.bias"] new_state_dict[prefix + ".skip.norm.weight"] = uvit_state_dict[block_prefix + ".norm1.weight"] new_state_dict[prefix + ".skip.norm.bias"] = uvit_state_dict[block_prefix + ".norm1.bias"] # Create the prefix string for out_blocks. prefix += ".block" # Split up attention qkv.weight into to_q.weight, to_k.weight, to_v.weight qkv = uvit_state_dict[block_prefix + ".attn.qkv.weight"] new_attn_keys = [".attn1.to_q.weight", ".attn1.to_k.weight", ".attn1.to_v.weight"] new_attn_keys = [prefix + key for key in new_attn_keys] shape = qkv.shape[0] // len(new_attn_keys) for i, attn_key in enumerate(new_attn_keys): new_state_dict[attn_key] = qkv[i * shape : (i + 1) * shape] new_state_dict[prefix + ".attn1.to_out.0.weight"] = uvit_state_dict[block_prefix + ".attn.proj.weight"] new_state_dict[prefix + ".attn1.to_out.0.bias"] = uvit_state_dict[block_prefix + ".attn.proj.bias"] new_state_dict[prefix + ".norm1.weight"] = uvit_state_dict[block_prefix + ".norm2.weight"] new_state_dict[prefix + ".norm1.bias"] = uvit_state_dict[block_prefix + ".norm2.bias"] new_state_dict[prefix + ".ff.net.0.proj.weight"] = uvit_state_dict[block_prefix + ".mlp.fc1.weight"] new_state_dict[prefix + ".ff.net.0.proj.bias"] = uvit_state_dict[block_prefix + ".mlp.fc1.bias"] new_state_dict[prefix + ".ff.net.2.weight"] = uvit_state_dict[block_prefix + ".mlp.fc2.weight"] new_state_dict[prefix + ".ff.net.2.bias"] = uvit_state_dict[block_prefix + ".mlp.fc2.bias"] new_state_dict[prefix + ".norm3.weight"] = uvit_state_dict[block_prefix + ".norm3.weight"] new_state_dict[prefix + ".norm3.bias"] = uvit_state_dict[block_prefix + ".norm3.bias"] return uvit_state_dict, new_state_dict def convert_uvit_to_diffusers(ckpt, diffusers_model): """ Converts a UniDiffuser uvit_v*.pth checkpoint to a diffusers UniDiffusersModel. """ # uvit_v*.pth ckpt is a torch state dict uvit_state_dict = torch.load(ckpt, map_location="cpu") new_state_dict = {} # Input layers new_state_dict["vae_img_in.proj.weight"] = uvit_state_dict["patch_embed.proj.weight"] new_state_dict["vae_img_in.proj.bias"] = uvit_state_dict["patch_embed.proj.bias"] new_state_dict["clip_img_in.weight"] = uvit_state_dict["clip_img_embed.weight"] new_state_dict["clip_img_in.bias"] = uvit_state_dict["clip_img_embed.bias"] new_state_dict["text_in.weight"] = uvit_state_dict["text_embed.weight"] new_state_dict["text_in.bias"] = uvit_state_dict["text_embed.bias"] new_state_dict["pos_embed"] = uvit_state_dict["pos_embed"] # Handle data type token embeddings for UniDiffuser-v1 if "token_embedding.weight" in uvit_state_dict and diffusers_model.use_data_type_embedding: new_state_dict["data_type_pos_embed_token"] = uvit_state_dict["pos_embed_token"] new_state_dict["data_type_token_embedding.weight"] = uvit_state_dict["token_embedding.weight"] # Also initialize the PatchEmbedding in UTransformer2DModel with the PatchEmbedding from the checkpoint. # This isn't used in the current implementation, so might want to remove. new_state_dict["transformer.pos_embed.proj.weight"] = uvit_state_dict["patch_embed.proj.weight"] new_state_dict["transformer.pos_embed.proj.bias"] = uvit_state_dict["patch_embed.proj.bias"] # Output layers new_state_dict["transformer.norm_out.weight"] = uvit_state_dict["norm.weight"] new_state_dict["transformer.norm_out.bias"] = uvit_state_dict["norm.bias"] new_state_dict["vae_img_out.weight"] = uvit_state_dict["decoder_pred.weight"] new_state_dict["vae_img_out.bias"] = uvit_state_dict["decoder_pred.bias"] new_state_dict["clip_img_out.weight"] = uvit_state_dict["clip_img_out.weight"] new_state_dict["clip_img_out.bias"] = uvit_state_dict["clip_img_out.bias"] new_state_dict["text_out.weight"] = uvit_state_dict["text_out.weight"] new_state_dict["text_out.bias"] = uvit_state_dict["text_out.bias"] # in_blocks in_blocks_prefixes = {".".join(layer.split(".")[:2]) for layer in uvit_state_dict if "in_blocks" in layer} for in_block_prefix in list(in_blocks_prefixes): convert_uvit_block_to_diffusers_block(uvit_state_dict, new_state_dict, in_block_prefix) # mid_block # Assume there's only one mid block convert_uvit_block_to_diffusers_block(uvit_state_dict, new_state_dict, "mid_block") # out_blocks out_blocks_prefixes = {".".join(layer.split(".")[:2]) for layer in uvit_state_dict if "out_blocks" in layer} for out_block_prefix in list(out_blocks_prefixes): convert_uvit_block_to_diffusers_block(uvit_state_dict, new_state_dict, out_block_prefix, skip_connection=True) missing_keys, unexpected_keys = diffusers_model.load_state_dict(new_state_dict) for missing_key in missing_keys: print(f"Missing key: {missing_key}") for unexpected_key in unexpected_keys: print(f"Unexpected key: {unexpected_key}") return diffusers_model def convert_caption_decoder_to_diffusers(ckpt, diffusers_model): """ Converts a UniDiffuser caption_decoder.pth checkpoint to a diffusers UniDiffuserTextDecoder. """ # caption_decoder.pth ckpt is a torch state dict checkpoint_state_dict = torch.load(ckpt, map_location="cpu") decoder_state_dict = {} # Remove the "module." prefix, if necessary caption_decoder_key = "module." for key in checkpoint_state_dict: if key.startswith(caption_decoder_key): decoder_state_dict[key.replace(caption_decoder_key, "")] = checkpoint_state_dict.get(key) else: decoder_state_dict[key] = checkpoint_state_dict.get(key) new_state_dict = {} # Encoder and Decoder new_state_dict["encode_prefix.weight"] = decoder_state_dict["encode_prefix.weight"] new_state_dict["encode_prefix.bias"] = decoder_state_dict["encode_prefix.bias"] new_state_dict["decode_prefix.weight"] = decoder_state_dict["decode_prefix.weight"] new_state_dict["decode_prefix.bias"] = decoder_state_dict["decode_prefix.bias"] # Internal GPT2LMHeadModel transformer model for key, val in decoder_state_dict.items(): if key.startswith("gpt"): suffix = key[len("gpt") :] new_state_dict["transformer" + suffix] = val missing_keys, unexpected_keys = diffusers_model.load_state_dict(new_state_dict) for missing_key in missing_keys: print(f"Missing key: {missing_key}") for unexpected_key in unexpected_keys: print(f"Unexpected key: {unexpected_key}") return diffusers_model if __name__ == "__main__": parser = argparse.ArgumentParser() parser.add_argument( "--caption_decoder_checkpoint_path", default=None, type=str, required=False, help="Path to caption decoder checkpoint to convert.", ) parser.add_argument( "--uvit_checkpoint_path", default=None, type=str, required=False, help="Path to U-ViT checkpoint to convert." ) parser.add_argument( "--vae_checkpoint_path", default=None, type=str, required=False, help="Path to VAE checkpoint to convert.", ) parser.add_argument( "--pipeline_output_path", default=None, type=str, required=True, help="Path to save the output pipeline to.", ) parser.add_argument( "--config_type", default="test", type=str, help=( "Config type to use. Should be 'test' to create small models for testing or 'big' to convert a full" " checkpoint." ), ) parser.add_argument( "--version", default=0, type=int, help="The UniDiffuser model type to convert to. Should be 0 for UniDiffuser-v0 and 1 for UniDiffuser-v1.", ) parser.add_argument( "--safe_serialization", action="store_true", help="Whether to use safetensors/safe seialization when saving the pipeline.", ) args = parser.parse_args() # Convert the VAE model. if args.vae_checkpoint_path is not None: vae_config = create_vae_diffusers_config(args.config_type) vae = AutoencoderKL(**vae_config) vae = convert_vae_to_diffusers(args.vae_checkpoint_path, vae) # Convert the U-ViT ("unet") model. if args.uvit_checkpoint_path is not None: unet_config = create_unidiffuser_unet_config(args.config_type, args.version) unet = UniDiffuserModel(**unet_config) unet = convert_uvit_to_diffusers(args.uvit_checkpoint_path, unet) # Convert the caption decoder ("text_decoder") model. if args.caption_decoder_checkpoint_path is not None: text_decoder_config = create_text_decoder_config(args.config_type) text_decoder = UniDiffuserTextDecoder(**text_decoder_config) text_decoder = convert_caption_decoder_to_diffusers(args.caption_decoder_checkpoint_path, text_decoder) # Scheduler is the same for both the test and big models. scheduler_config = SCHEDULER_CONFIG scheduler = DPMSolverMultistepScheduler( beta_start=scheduler_config.beta_start, beta_end=scheduler_config.beta_end, beta_schedule=scheduler_config.beta_schedule, solver_order=scheduler_config.solver_order, ) if args.config_type == "test": # Make a small random CLIPTextModel torch.manual_seed(0) clip_text_encoder_config = CLIPTextConfig( bos_token_id=0, eos_token_id=2, hidden_size=32, intermediate_size=37, layer_norm_eps=1e-05, num_attention_heads=4, num_hidden_layers=5, pad_token_id=1, vocab_size=1000, ) text_encoder = CLIPTextModel(clip_text_encoder_config) clip_tokenizer = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") # Make a small random CLIPVisionModel and accompanying CLIPImageProcessor torch.manual_seed(0) clip_image_encoder_config = CLIPVisionConfig( image_size=32, patch_size=2, num_channels=3, hidden_size=32, projection_dim=32, num_hidden_layers=5, num_attention_heads=4, intermediate_size=37, dropout=0.1, attention_dropout=0.1, initializer_range=0.02, ) image_encoder = CLIPVisionModelWithProjection(clip_image_encoder_config) image_processor = CLIPImageProcessor(crop_size=32, size=32) # Note that the text_decoder should already have its token embeddings resized. text_tokenizer = GPT2Tokenizer.from_pretrained("hf-internal-testing/tiny-random-GPT2Model") eos = "<|EOS|>" special_tokens_dict = {"eos_token": eos} text_tokenizer.add_special_tokens(special_tokens_dict) elif args.config_type == "big": text_encoder = CLIPTextModel.from_pretrained("openai/clip-vit-large-patch14") clip_tokenizer = CLIPTokenizer.from_pretrained("openai/clip-vit-large-patch14") image_encoder = CLIPVisionModelWithProjection.from_pretrained("openai/clip-vit-base-patch32") image_processor = CLIPImageProcessor.from_pretrained("openai/clip-vit-base-patch32") # Note that the text_decoder should already have its token embeddings resized. text_tokenizer = GPT2Tokenizer.from_pretrained("gpt2") eos = "<|EOS|>" special_tokens_dict = {"eos_token": eos} text_tokenizer.add_special_tokens(special_tokens_dict) else: raise NotImplementedError( f"Config type {args.config_type} is not implemented, currently only config types" " 'test' and 'big' are available." ) pipeline = UniDiffuserPipeline( vae=vae, text_encoder=text_encoder, image_encoder=image_encoder, clip_image_processor=image_processor, clip_tokenizer=clip_tokenizer, text_decoder=text_decoder, text_tokenizer=text_tokenizer, unet=unet, scheduler=scheduler, ) pipeline.save_pretrained(args.pipeline_output_path, safe_serialization=args.safe_serialization)
diffusers/scripts/convert_unidiffuser_to_diffusers.py/0
{ "file_path": "diffusers/scripts/convert_unidiffuser_to_diffusers.py", "repo_id": "diffusers", "token_count": 13871 }
108
# THIS FILE HAS BEEN AUTOGENERATED. To update: # 1. modify the `_deps` dict in setup.py # 2. run `make deps_table_update` deps = { "Pillow": "Pillow", "accelerate": "accelerate>=0.11.0", "compel": "compel==0.1.8", "datasets": "datasets", "filelock": "filelock", "flax": "flax>=0.4.1", "hf-doc-builder": "hf-doc-builder>=0.3.0", "huggingface-hub": "huggingface-hub>=0.20.2", "requests-mock": "requests-mock==1.10.0", "importlib_metadata": "importlib_metadata", "invisible-watermark": "invisible-watermark>=0.2.0", "isort": "isort>=5.5.4", "jax": "jax>=0.4.1", "jaxlib": "jaxlib>=0.4.1", "Jinja2": "Jinja2", "k-diffusion": "k-diffusion>=0.0.12", "torchsde": "torchsde", "note_seq": "note_seq", "librosa": "librosa", "numpy": "numpy", "parameterized": "parameterized", "peft": "peft>=0.6.0", "protobuf": "protobuf>=3.20.3,<4", "pytest": "pytest", "pytest-timeout": "pytest-timeout", "pytest-xdist": "pytest-xdist", "python": "python>=3.8.0", "ruff": "ruff==0.1.5", "safetensors": "safetensors>=0.3.1", "sentencepiece": "sentencepiece>=0.1.91,!=0.1.92", "GitPython": "GitPython<3.1.19", "scipy": "scipy", "onnx": "onnx", "regex": "regex!=2019.12.17", "requests": "requests", "tensorboard": "tensorboard", "torch": "torch>=1.4,<2.2.0", "torchvision": "torchvision<0.17", "transformers": "transformers>=4.25.1", "urllib3": "urllib3<=2.0.0", }
diffusers/src/diffusers/dependency_versions_table.py/0
{ "file_path": "diffusers/src/diffusers/dependency_versions_table.py", "repo_id": "diffusers", "token_count": 789 }
109
# Copyright 2023 The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import inspect import os from collections import defaultdict from contextlib import nullcontext from functools import partial from pathlib import Path from typing import Callable, Dict, List, Optional, Union import safetensors import torch import torch.nn.functional as F from huggingface_hub.utils import validate_hf_hub_args from torch import nn from ..models.embeddings import ( ImageProjection, IPAdapterFullImageProjection, IPAdapterPlusImageProjection, MultiIPAdapterImageProjection, ) from ..models.modeling_utils import _LOW_CPU_MEM_USAGE_DEFAULT, load_model_dict_into_meta from ..utils import ( USE_PEFT_BACKEND, _get_model_file, delete_adapter_layers, is_accelerate_available, logging, set_adapter_layers, set_weights_and_activate_adapters, ) from .utils import AttnProcsLayers if is_accelerate_available(): from accelerate import init_empty_weights from accelerate.hooks import AlignDevicesHook, CpuOffload, remove_hook_from_module logger = logging.get_logger(__name__) TEXT_ENCODER_NAME = "text_encoder" UNET_NAME = "unet" LORA_WEIGHT_NAME = "pytorch_lora_weights.bin" LORA_WEIGHT_NAME_SAFE = "pytorch_lora_weights.safetensors" CUSTOM_DIFFUSION_WEIGHT_NAME = "pytorch_custom_diffusion_weights.bin" CUSTOM_DIFFUSION_WEIGHT_NAME_SAFE = "pytorch_custom_diffusion_weights.safetensors" class UNet2DConditionLoadersMixin: """ Load LoRA layers into a [`UNet2DCondtionModel`]. """ text_encoder_name = TEXT_ENCODER_NAME unet_name = UNET_NAME @validate_hf_hub_args def load_attn_procs(self, pretrained_model_name_or_path_or_dict: Union[str, Dict[str, torch.Tensor]], **kwargs): r""" Load pretrained attention processor layers into [`UNet2DConditionModel`]. Attention processor layers have to be defined in [`attention_processor.py`](https://github.com/huggingface/diffusers/blob/main/src/diffusers/models/attention_processor.py) and be a `torch.nn.Module` class. Parameters: pretrained_model_name_or_path_or_dict (`str` or `os.PathLike` or `dict`): Can be either: - A string, the model id (for example `google/ddpm-celebahq-256`) of a pretrained model hosted on the Hub. - A path to a directory (for example `./my_model_directory`) containing the model weights saved with [`ModelMixin.save_pretrained`]. - A [torch state dict](https://pytorch.org/tutorials/beginner/saving_loading_models.html#what-is-a-state-dict). cache_dir (`Union[str, os.PathLike]`, *optional*): Path to a directory where a downloaded pretrained model configuration is cached if the standard cache is not used. force_download (`bool`, *optional*, defaults to `False`): Whether or not to force the (re-)download of the model weights and configuration files, overriding the cached versions if they exist. resume_download (`bool`, *optional*, defaults to `False`): Whether or not to resume downloading the model weights and configuration files. If set to `False`, any incompletely downloaded files are deleted. proxies (`Dict[str, str]`, *optional*): A dictionary of proxy servers to use by protocol or endpoint, for example, `{'http': 'foo.bar:3128', 'http://hostname': 'foo.bar:4012'}`. The proxies are used on each request. local_files_only (`bool`, *optional*, defaults to `False`): Whether to only load local model weights and configuration files or not. If set to `True`, the model won't be downloaded from the Hub. token (`str` or *bool*, *optional*): The token to use as HTTP bearer authorization for remote files. If `True`, the token generated from `diffusers-cli login` (stored in `~/.huggingface`) is used. low_cpu_mem_usage (`bool`, *optional*, defaults to `True` if torch version >= 1.9.0 else `False`): Speed up model loading only loading the pretrained weights and not initializing the weights. This also tries to not use more than 1x model size in CPU memory (including peak memory) while loading the model. Only supported for PyTorch >= 1.9.0. If you are using an older version of PyTorch, setting this argument to `True` will raise an error. revision (`str`, *optional*, defaults to `"main"`): The specific model version to use. It can be a branch name, a tag name, a commit id, or any identifier allowed by Git. subfolder (`str`, *optional*, defaults to `""`): The subfolder location of a model file within a larger model repository on the Hub or locally. mirror (`str`, *optional*): Mirror source to resolve accessibility issues if youโ€™re downloading a model in China. We do not guarantee the timeliness or safety of the source, and you should refer to the mirror site for more information. Example: ```py from diffusers import AutoPipelineForText2Image import torch pipeline = AutoPipelineForText2Image.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=torch.float16 ).to("cuda") pipeline.unet.load_attn_procs( "jbilcke-hf/sdxl-cinematic-1", weight_name="pytorch_lora_weights.safetensors", adapter_name="cinematic" ) ``` """ from ..models.attention_processor import CustomDiffusionAttnProcessor from ..models.lora import LoRACompatibleConv, LoRACompatibleLinear, LoRAConv2dLayer, LoRALinearLayer cache_dir = kwargs.pop("cache_dir", None) force_download = kwargs.pop("force_download", False) resume_download = kwargs.pop("resume_download", False) proxies = kwargs.pop("proxies", None) local_files_only = kwargs.pop("local_files_only", None) token = kwargs.pop("token", None) revision = kwargs.pop("revision", None) subfolder = kwargs.pop("subfolder", None) weight_name = kwargs.pop("weight_name", None) use_safetensors = kwargs.pop("use_safetensors", None) low_cpu_mem_usage = kwargs.pop("low_cpu_mem_usage", _LOW_CPU_MEM_USAGE_DEFAULT) # This value has the same meaning as the `--network_alpha` option in the kohya-ss trainer script. # See https://github.com/darkstorm2150/sd-scripts/blob/main/docs/train_network_README-en.md#execute-learning network_alphas = kwargs.pop("network_alphas", None) _pipeline = kwargs.pop("_pipeline", None) is_network_alphas_none = network_alphas is None allow_pickle = False if use_safetensors is None: use_safetensors = True allow_pickle = True user_agent = { "file_type": "attn_procs_weights", "framework": "pytorch", } if low_cpu_mem_usage and not is_accelerate_available(): low_cpu_mem_usage = False logger.warning( "Cannot initialize model with low cpu memory usage because `accelerate` was not found in the" " environment. Defaulting to `low_cpu_mem_usage=False`. It is strongly recommended to install" " `accelerate` for faster and less memory-intense model loading. You can do so with: \n```\npip" " install accelerate\n```\n." ) model_file = None if not isinstance(pretrained_model_name_or_path_or_dict, dict): # Let's first try to load .safetensors weights if (use_safetensors and weight_name is None) or ( weight_name is not None and weight_name.endswith(".safetensors") ): try: model_file = _get_model_file( pretrained_model_name_or_path_or_dict, weights_name=weight_name or LORA_WEIGHT_NAME_SAFE, cache_dir=cache_dir, force_download=force_download, resume_download=resume_download, proxies=proxies, local_files_only=local_files_only, token=token, revision=revision, subfolder=subfolder, user_agent=user_agent, ) state_dict = safetensors.torch.load_file(model_file, device="cpu") except IOError as e: if not allow_pickle: raise e # try loading non-safetensors weights pass if model_file is None: model_file = _get_model_file( pretrained_model_name_or_path_or_dict, weights_name=weight_name or LORA_WEIGHT_NAME, cache_dir=cache_dir, force_download=force_download, resume_download=resume_download, proxies=proxies, local_files_only=local_files_only, token=token, revision=revision, subfolder=subfolder, user_agent=user_agent, ) state_dict = torch.load(model_file, map_location="cpu") else: state_dict = pretrained_model_name_or_path_or_dict # fill attn processors lora_layers_list = [] is_lora = all(("lora" in k or k.endswith(".alpha")) for k in state_dict.keys()) and not USE_PEFT_BACKEND is_custom_diffusion = any("custom_diffusion" in k for k in state_dict.keys()) if is_lora: # correct keys state_dict, network_alphas = self.convert_state_dict_legacy_attn_format(state_dict, network_alphas) if network_alphas is not None: network_alphas_keys = list(network_alphas.keys()) used_network_alphas_keys = set() lora_grouped_dict = defaultdict(dict) mapped_network_alphas = {} all_keys = list(state_dict.keys()) for key in all_keys: value = state_dict.pop(key) attn_processor_key, sub_key = ".".join(key.split(".")[:-3]), ".".join(key.split(".")[-3:]) lora_grouped_dict[attn_processor_key][sub_key] = value # Create another `mapped_network_alphas` dictionary so that we can properly map them. if network_alphas is not None: for k in network_alphas_keys: if k.replace(".alpha", "") in key: mapped_network_alphas.update({attn_processor_key: network_alphas.get(k)}) used_network_alphas_keys.add(k) if not is_network_alphas_none: if len(set(network_alphas_keys) - used_network_alphas_keys) > 0: raise ValueError( f"The `network_alphas` has to be empty at this point but has the following keys \n\n {', '.join(network_alphas.keys())}" ) if len(state_dict) > 0: raise ValueError( f"The `state_dict` has to be empty at this point but has the following keys \n\n {', '.join(state_dict.keys())}" ) for key, value_dict in lora_grouped_dict.items(): attn_processor = self for sub_key in key.split("."): attn_processor = getattr(attn_processor, sub_key) # Process non-attention layers, which don't have to_{k,v,q,out_proj}_lora layers # or add_{k,v,q,out_proj}_proj_lora layers. rank = value_dict["lora.down.weight"].shape[0] if isinstance(attn_processor, LoRACompatibleConv): in_features = attn_processor.in_channels out_features = attn_processor.out_channels kernel_size = attn_processor.kernel_size ctx = init_empty_weights if low_cpu_mem_usage else nullcontext with ctx(): lora = LoRAConv2dLayer( in_features=in_features, out_features=out_features, rank=rank, kernel_size=kernel_size, stride=attn_processor.stride, padding=attn_processor.padding, network_alpha=mapped_network_alphas.get(key), ) elif isinstance(attn_processor, LoRACompatibleLinear): ctx = init_empty_weights if low_cpu_mem_usage else nullcontext with ctx(): lora = LoRALinearLayer( attn_processor.in_features, attn_processor.out_features, rank, mapped_network_alphas.get(key), ) else: raise ValueError(f"Module {key} is not a LoRACompatibleConv or LoRACompatibleLinear module.") value_dict = {k.replace("lora.", ""): v for k, v in value_dict.items()} lora_layers_list.append((attn_processor, lora)) if low_cpu_mem_usage: device = next(iter(value_dict.values())).device dtype = next(iter(value_dict.values())).dtype load_model_dict_into_meta(lora, value_dict, device=device, dtype=dtype) else: lora.load_state_dict(value_dict) elif is_custom_diffusion: attn_processors = {} custom_diffusion_grouped_dict = defaultdict(dict) for key, value in state_dict.items(): if len(value) == 0: custom_diffusion_grouped_dict[key] = {} else: if "to_out" in key: attn_processor_key, sub_key = ".".join(key.split(".")[:-3]), ".".join(key.split(".")[-3:]) else: attn_processor_key, sub_key = ".".join(key.split(".")[:-2]), ".".join(key.split(".")[-2:]) custom_diffusion_grouped_dict[attn_processor_key][sub_key] = value for key, value_dict in custom_diffusion_grouped_dict.items(): if len(value_dict) == 0: attn_processors[key] = CustomDiffusionAttnProcessor( train_kv=False, train_q_out=False, hidden_size=None, cross_attention_dim=None ) else: cross_attention_dim = value_dict["to_k_custom_diffusion.weight"].shape[1] hidden_size = value_dict["to_k_custom_diffusion.weight"].shape[0] train_q_out = True if "to_q_custom_diffusion.weight" in value_dict else False attn_processors[key] = CustomDiffusionAttnProcessor( train_kv=True, train_q_out=train_q_out, hidden_size=hidden_size, cross_attention_dim=cross_attention_dim, ) attn_processors[key].load_state_dict(value_dict) elif USE_PEFT_BACKEND: # In that case we have nothing to do as loading the adapter weights is already handled above by `set_peft_model_state_dict` # on the Unet pass else: raise ValueError( f"{model_file} does not seem to be in the correct format expected by LoRA or Custom Diffusion training." ) # <Unsafe code # We can be sure that the following works as it just sets attention processors, lora layers and puts all in the same dtype # Now we remove any existing hooks to is_model_cpu_offload = False is_sequential_cpu_offload = False # For PEFT backend the Unet is already offloaded at this stage as it is handled inside `lora_lora_weights_into_unet` if not USE_PEFT_BACKEND: if _pipeline is not None: for _, component in _pipeline.components.items(): if isinstance(component, nn.Module) and hasattr(component, "_hf_hook"): is_model_cpu_offload = isinstance(getattr(component, "_hf_hook"), CpuOffload) is_sequential_cpu_offload = isinstance(getattr(component, "_hf_hook"), AlignDevicesHook) logger.info( "Accelerate hooks detected. Since you have called `load_lora_weights()`, the previous hooks will be first removed. Then the LoRA parameters will be loaded and the hooks will be applied again." ) remove_hook_from_module(component, recurse=is_sequential_cpu_offload) # only custom diffusion needs to set attn processors if is_custom_diffusion: self.set_attn_processor(attn_processors) # set lora layers for target_module, lora_layer in lora_layers_list: target_module.set_lora_layer(lora_layer) self.to(dtype=self.dtype, device=self.device) # Offload back. if is_model_cpu_offload: _pipeline.enable_model_cpu_offload() elif is_sequential_cpu_offload: _pipeline.enable_sequential_cpu_offload() # Unsafe code /> def convert_state_dict_legacy_attn_format(self, state_dict, network_alphas): is_new_lora_format = all( key.startswith(self.unet_name) or key.startswith(self.text_encoder_name) for key in state_dict.keys() ) if is_new_lora_format: # Strip the `"unet"` prefix. is_text_encoder_present = any(key.startswith(self.text_encoder_name) for key in state_dict.keys()) if is_text_encoder_present: warn_message = "The state_dict contains LoRA params corresponding to the text encoder which are not being used here. To use both UNet and text encoder related LoRA params, use [`pipe.load_lora_weights()`](https://huggingface.co/docs/diffusers/main/en/api/loaders#diffusers.loaders.LoraLoaderMixin.load_lora_weights)." logger.warn(warn_message) unet_keys = [k for k in state_dict.keys() if k.startswith(self.unet_name)] state_dict = {k.replace(f"{self.unet_name}.", ""): v for k, v in state_dict.items() if k in unet_keys} # change processor format to 'pure' LoRACompatibleLinear format if any("processor" in k.split(".") for k in state_dict.keys()): def format_to_lora_compatible(key): if "processor" not in key.split("."): return key return key.replace(".processor", "").replace("to_out_lora", "to_out.0.lora").replace("_lora", ".lora") state_dict = {format_to_lora_compatible(k): v for k, v in state_dict.items()} if network_alphas is not None: network_alphas = {format_to_lora_compatible(k): v for k, v in network_alphas.items()} return state_dict, network_alphas def save_attn_procs( self, save_directory: Union[str, os.PathLike], is_main_process: bool = True, weight_name: str = None, save_function: Callable = None, safe_serialization: bool = True, **kwargs, ): r""" Save attention processor layers to a directory so that it can be reloaded with the [`~loaders.UNet2DConditionLoadersMixin.load_attn_procs`] method. Arguments: save_directory (`str` or `os.PathLike`): Directory to save an attention processor to (will be created if it doesn't exist). is_main_process (`bool`, *optional*, defaults to `True`): Whether the process calling this is the main process or not. Useful during distributed training and you need to call this function on all processes. In this case, set `is_main_process=True` only on the main process to avoid race conditions. save_function (`Callable`): The function to use to save the state dictionary. Useful during distributed training when you need to replace `torch.save` with another method. Can be configured with the environment variable `DIFFUSERS_SAVE_MODE`. safe_serialization (`bool`, *optional*, defaults to `True`): Whether to save the model using `safetensors` or with `pickle`. Example: ```py import torch from diffusers import DiffusionPipeline pipeline = DiffusionPipeline.from_pretrained( "CompVis/stable-diffusion-v1-4", torch_dtype=torch.float16, ).to("cuda") pipeline.unet.load_attn_procs("path-to-save-model", weight_name="pytorch_custom_diffusion_weights.bin") pipeline.unet.save_attn_procs("path-to-save-model", weight_name="pytorch_custom_diffusion_weights.bin") ``` """ from ..models.attention_processor import ( CustomDiffusionAttnProcessor, CustomDiffusionAttnProcessor2_0, CustomDiffusionXFormersAttnProcessor, ) if os.path.isfile(save_directory): logger.error(f"Provided path ({save_directory}) should be a directory, not a file") return if save_function is None: if safe_serialization: def save_function(weights, filename): return safetensors.torch.save_file(weights, filename, metadata={"format": "pt"}) else: save_function = torch.save os.makedirs(save_directory, exist_ok=True) is_custom_diffusion = any( isinstance( x, (CustomDiffusionAttnProcessor, CustomDiffusionAttnProcessor2_0, CustomDiffusionXFormersAttnProcessor), ) for (_, x) in self.attn_processors.items() ) if is_custom_diffusion: model_to_save = AttnProcsLayers( { y: x for (y, x) in self.attn_processors.items() if isinstance( x, ( CustomDiffusionAttnProcessor, CustomDiffusionAttnProcessor2_0, CustomDiffusionXFormersAttnProcessor, ), ) } ) state_dict = model_to_save.state_dict() for name, attn in self.attn_processors.items(): if len(attn.state_dict()) == 0: state_dict[name] = {} else: model_to_save = AttnProcsLayers(self.attn_processors) state_dict = model_to_save.state_dict() if weight_name is None: if safe_serialization: weight_name = CUSTOM_DIFFUSION_WEIGHT_NAME_SAFE if is_custom_diffusion else LORA_WEIGHT_NAME_SAFE else: weight_name = CUSTOM_DIFFUSION_WEIGHT_NAME if is_custom_diffusion else LORA_WEIGHT_NAME # Save the model save_path = Path(save_directory, weight_name).as_posix() save_function(state_dict, save_path) logger.info(f"Model weights saved in {save_path}") def fuse_lora(self, lora_scale=1.0, safe_fusing=False, adapter_names=None): self.lora_scale = lora_scale self._safe_fusing = safe_fusing self.apply(partial(self._fuse_lora_apply, adapter_names=adapter_names)) def _fuse_lora_apply(self, module, adapter_names=None): if not USE_PEFT_BACKEND: if hasattr(module, "_fuse_lora"): module._fuse_lora(self.lora_scale, self._safe_fusing) if adapter_names is not None: raise ValueError( "The `adapter_names` argument is not supported in your environment. Please switch" " to PEFT backend to use this argument by installing latest PEFT and transformers." " `pip install -U peft transformers`" ) else: from peft.tuners.tuners_utils import BaseTunerLayer merge_kwargs = {"safe_merge": self._safe_fusing} if isinstance(module, BaseTunerLayer): if self.lora_scale != 1.0: module.scale_layer(self.lora_scale) # For BC with prevous PEFT versions, we need to check the signature # of the `merge` method to see if it supports the `adapter_names` argument. supported_merge_kwargs = list(inspect.signature(module.merge).parameters) if "adapter_names" in supported_merge_kwargs: merge_kwargs["adapter_names"] = adapter_names elif "adapter_names" not in supported_merge_kwargs and adapter_names is not None: raise ValueError( "The `adapter_names` argument is not supported with your PEFT version. Please upgrade" " to the latest version of PEFT. `pip install -U peft`" ) module.merge(**merge_kwargs) def unfuse_lora(self): self.apply(self._unfuse_lora_apply) def _unfuse_lora_apply(self, module): if not USE_PEFT_BACKEND: if hasattr(module, "_unfuse_lora"): module._unfuse_lora() else: from peft.tuners.tuners_utils import BaseTunerLayer if isinstance(module, BaseTunerLayer): module.unmerge() def set_adapters( self, adapter_names: Union[List[str], str], weights: Optional[Union[List[float], float]] = None, ): """ Set the currently active adapters for use in the UNet. Args: adapter_names (`List[str]` or `str`): The names of the adapters to use. adapter_weights (`Union[List[float], float]`, *optional*): The adapter(s) weights to use with the UNet. If `None`, the weights are set to `1.0` for all the adapters. Example: ```py from diffusers import AutoPipelineForText2Image import torch pipeline = AutoPipelineForText2Image.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=torch.float16 ).to("cuda") pipeline.load_lora_weights( "jbilcke-hf/sdxl-cinematic-1", weight_name="pytorch_lora_weights.safetensors", adapter_name="cinematic" ) pipeline.load_lora_weights("nerijs/pixel-art-xl", weight_name="pixel-art-xl.safetensors", adapter_name="pixel") pipeline.set_adapters(["cinematic", "pixel"], adapter_weights=[0.5, 0.5]) ``` """ if not USE_PEFT_BACKEND: raise ValueError("PEFT backend is required for `set_adapters()`.") adapter_names = [adapter_names] if isinstance(adapter_names, str) else adapter_names if weights is None: weights = [1.0] * len(adapter_names) elif isinstance(weights, float): weights = [weights] * len(adapter_names) if len(adapter_names) != len(weights): raise ValueError( f"Length of adapter names {len(adapter_names)} is not equal to the length of their weights {len(weights)}." ) set_weights_and_activate_adapters(self, adapter_names, weights) def disable_lora(self): """ Disable the UNet's active LoRA layers. Example: ```py from diffusers import AutoPipelineForText2Image import torch pipeline = AutoPipelineForText2Image.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=torch.float16 ).to("cuda") pipeline.load_lora_weights( "jbilcke-hf/sdxl-cinematic-1", weight_name="pytorch_lora_weights.safetensors", adapter_name="cinematic" ) pipeline.disable_lora() ``` """ if not USE_PEFT_BACKEND: raise ValueError("PEFT backend is required for this method.") set_adapter_layers(self, enabled=False) def enable_lora(self): """ Enable the UNet's active LoRA layers. Example: ```py from diffusers import AutoPipelineForText2Image import torch pipeline = AutoPipelineForText2Image.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=torch.float16 ).to("cuda") pipeline.load_lora_weights( "jbilcke-hf/sdxl-cinematic-1", weight_name="pytorch_lora_weights.safetensors", adapter_name="cinematic" ) pipeline.enable_lora() ``` """ if not USE_PEFT_BACKEND: raise ValueError("PEFT backend is required for this method.") set_adapter_layers(self, enabled=True) def delete_adapters(self, adapter_names: Union[List[str], str]): """ Delete an adapter's LoRA layers from the UNet. Args: adapter_names (`Union[List[str], str]`): The names (single string or list of strings) of the adapter to delete. Example: ```py from diffusers import AutoPipelineForText2Image import torch pipeline = AutoPipelineForText2Image.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=torch.float16 ).to("cuda") pipeline.load_lora_weights( "jbilcke-hf/sdxl-cinematic-1", weight_name="pytorch_lora_weights.safetensors", adapter_names="cinematic" ) pipeline.delete_adapters("cinematic") ``` """ if not USE_PEFT_BACKEND: raise ValueError("PEFT backend is required for this method.") if isinstance(adapter_names, str): adapter_names = [adapter_names] for adapter_name in adapter_names: delete_adapter_layers(self, adapter_name) # Pop also the corresponding adapter from the config if hasattr(self, "peft_config"): self.peft_config.pop(adapter_name, None) def _convert_ip_adapter_image_proj_to_diffusers(self, state_dict): updated_state_dict = {} image_projection = None if "proj.weight" in state_dict: # IP-Adapter num_image_text_embeds = 4 clip_embeddings_dim = state_dict["proj.weight"].shape[-1] cross_attention_dim = state_dict["proj.weight"].shape[0] // 4 image_projection = ImageProjection( cross_attention_dim=cross_attention_dim, image_embed_dim=clip_embeddings_dim, num_image_text_embeds=num_image_text_embeds, ) for key, value in state_dict.items(): diffusers_name = key.replace("proj", "image_embeds") updated_state_dict[diffusers_name] = value elif "proj.3.weight" in state_dict: # IP-Adapter Full clip_embeddings_dim = state_dict["proj.0.weight"].shape[0] cross_attention_dim = state_dict["proj.3.weight"].shape[0] image_projection = IPAdapterFullImageProjection( cross_attention_dim=cross_attention_dim, image_embed_dim=clip_embeddings_dim ) for key, value in state_dict.items(): diffusers_name = key.replace("proj.0", "ff.net.0.proj") diffusers_name = diffusers_name.replace("proj.2", "ff.net.2") diffusers_name = diffusers_name.replace("proj.3", "norm") updated_state_dict[diffusers_name] = value else: # IP-Adapter Plus num_image_text_embeds = state_dict["latents"].shape[1] embed_dims = state_dict["proj_in.weight"].shape[1] output_dims = state_dict["proj_out.weight"].shape[0] hidden_dims = state_dict["latents"].shape[2] heads = state_dict["layers.0.0.to_q.weight"].shape[0] // 64 image_projection = IPAdapterPlusImageProjection( embed_dims=embed_dims, output_dims=output_dims, hidden_dims=hidden_dims, heads=heads, num_queries=num_image_text_embeds, ) for key, value in state_dict.items(): diffusers_name = key.replace("0.to", "2.to") diffusers_name = diffusers_name.replace("1.0.weight", "3.0.weight") diffusers_name = diffusers_name.replace("1.0.bias", "3.0.bias") diffusers_name = diffusers_name.replace("1.1.weight", "3.1.net.0.proj.weight") diffusers_name = diffusers_name.replace("1.3.weight", "3.1.net.2.weight") if "norm1" in diffusers_name: updated_state_dict[diffusers_name.replace("0.norm1", "0")] = value elif "norm2" in diffusers_name: updated_state_dict[diffusers_name.replace("0.norm2", "1")] = value elif "to_kv" in diffusers_name: v_chunk = value.chunk(2, dim=0) updated_state_dict[diffusers_name.replace("to_kv", "to_k")] = v_chunk[0] updated_state_dict[diffusers_name.replace("to_kv", "to_v")] = v_chunk[1] elif "to_out" in diffusers_name: updated_state_dict[diffusers_name.replace("to_out", "to_out.0")] = value else: updated_state_dict[diffusers_name] = value image_projection.load_state_dict(updated_state_dict) return image_projection def _convert_ip_adapter_attn_to_diffusers(self, state_dicts): from ..models.attention_processor import ( AttnProcessor, AttnProcessor2_0, IPAdapterAttnProcessor, IPAdapterAttnProcessor2_0, ) # set ip-adapter cross-attention processors & load state_dict attn_procs = {} key_id = 1 for name in self.attn_processors.keys(): cross_attention_dim = None if name.endswith("attn1.processor") else self.config.cross_attention_dim if name.startswith("mid_block"): hidden_size = self.config.block_out_channels[-1] elif name.startswith("up_blocks"): block_id = int(name[len("up_blocks.")]) hidden_size = list(reversed(self.config.block_out_channels))[block_id] elif name.startswith("down_blocks"): block_id = int(name[len("down_blocks.")]) hidden_size = self.config.block_out_channels[block_id] if cross_attention_dim is None or "motion_modules" in name: attn_processor_class = ( AttnProcessor2_0 if hasattr(F, "scaled_dot_product_attention") else AttnProcessor ) attn_procs[name] = attn_processor_class() else: attn_processor_class = ( IPAdapterAttnProcessor2_0 if hasattr(F, "scaled_dot_product_attention") else IPAdapterAttnProcessor ) num_image_text_embeds = [] for state_dict in state_dicts: if "proj.weight" in state_dict["image_proj"]: # IP-Adapter num_image_text_embeds += [4] elif "proj.3.weight" in state_dict["image_proj"]: # IP-Adapter Full Face num_image_text_embeds += [257] # 256 CLIP tokens + 1 CLS token else: # IP-Adapter Plus num_image_text_embeds += [state_dict["image_proj"]["latents"].shape[1]] attn_procs[name] = attn_processor_class( hidden_size=hidden_size, cross_attention_dim=cross_attention_dim, scale=1.0, num_tokens=num_image_text_embeds, ).to(dtype=self.dtype, device=self.device) value_dict = {} for i, state_dict in enumerate(state_dicts): value_dict.update({f"to_k_ip.{i}.weight": state_dict["ip_adapter"][f"{key_id}.to_k_ip.weight"]}) value_dict.update({f"to_v_ip.{i}.weight": state_dict["ip_adapter"][f"{key_id}.to_v_ip.weight"]}) attn_procs[name].load_state_dict(value_dict) key_id += 2 return attn_procs def _load_ip_adapter_weights(self, state_dicts): if not isinstance(state_dicts, list): state_dicts = [state_dicts] # Set encoder_hid_proj after loading ip_adapter weights, # because `IPAdapterPlusImageProjection` also has `attn_processors`. self.encoder_hid_proj = None attn_procs = self._convert_ip_adapter_attn_to_diffusers(state_dicts) self.set_attn_processor(attn_procs) # convert IP-Adapter Image Projection layers to diffusers image_projection_layers = [] for state_dict in state_dicts: image_projection_layer = self._convert_ip_adapter_image_proj_to_diffusers(state_dict["image_proj"]) image_projection_layer.to(device=self.device, dtype=self.dtype) image_projection_layers.append(image_projection_layer) self.encoder_hid_proj = MultiIPAdapterImageProjection(image_projection_layers) self.config.encoder_hid_dim_type = "ip_image_proj"
diffusers/src/diffusers/loaders/unet.py/0
{ "file_path": "diffusers/src/diffusers/loaders/unet.py", "repo_id": "diffusers", "token_count": 18810 }
110
# Copyright 2023 The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from dataclasses import dataclass from typing import Any, Dict, List, Optional, Tuple, Union import torch from torch import nn from torch.nn import functional as F from ..configuration_utils import ConfigMixin, register_to_config from ..loaders import FromOriginalControlNetMixin from ..utils import BaseOutput, logging from .attention_processor import ( ADDED_KV_ATTENTION_PROCESSORS, CROSS_ATTENTION_PROCESSORS, AttentionProcessor, AttnAddedKVProcessor, AttnProcessor, ) from .embeddings import TextImageProjection, TextImageTimeEmbedding, TextTimeEmbedding, TimestepEmbedding, Timesteps from .modeling_utils import ModelMixin from .unets.unet_2d_blocks import ( CrossAttnDownBlock2D, DownBlock2D, UNetMidBlock2D, UNetMidBlock2DCrossAttn, get_down_block, ) from .unets.unet_2d_condition import UNet2DConditionModel logger = logging.get_logger(__name__) # pylint: disable=invalid-name @dataclass class ControlNetOutput(BaseOutput): """ The output of [`ControlNetModel`]. Args: down_block_res_samples (`tuple[torch.Tensor]`): A tuple of downsample activations at different resolutions for each downsampling block. Each tensor should be of shape `(batch_size, channel * resolution, height //resolution, width // resolution)`. Output can be used to condition the original UNet's downsampling activations. mid_down_block_re_sample (`torch.Tensor`): The activation of the midde block (the lowest sample resolution). Each tensor should be of shape `(batch_size, channel * lowest_resolution, height // lowest_resolution, width // lowest_resolution)`. Output can be used to condition the original UNet's middle block activation. """ down_block_res_samples: Tuple[torch.Tensor] mid_block_res_sample: torch.Tensor class ControlNetConditioningEmbedding(nn.Module): """ Quoting from https://arxiv.org/abs/2302.05543: "Stable Diffusion uses a pre-processing method similar to VQ-GAN [11] to convert the entire dataset of 512 ร— 512 images into smaller 64 ร— 64 โ€œlatent imagesโ€ for stabilized training. This requires ControlNets to convert image-based conditions to 64 ร— 64 feature space to match the convolution size. We use a tiny network E(ยท) of four convolution layers with 4 ร— 4 kernels and 2 ร— 2 strides (activated by ReLU, channels are 16, 32, 64, 128, initialized with Gaussian weights, trained jointly with the full model) to encode image-space conditions ... into feature maps ..." """ def __init__( self, conditioning_embedding_channels: int, conditioning_channels: int = 3, block_out_channels: Tuple[int, ...] = (16, 32, 96, 256), ): super().__init__() self.conv_in = nn.Conv2d(conditioning_channels, block_out_channels[0], kernel_size=3, padding=1) self.blocks = nn.ModuleList([]) for i in range(len(block_out_channels) - 1): channel_in = block_out_channels[i] channel_out = block_out_channels[i + 1] self.blocks.append(nn.Conv2d(channel_in, channel_in, kernel_size=3, padding=1)) self.blocks.append(nn.Conv2d(channel_in, channel_out, kernel_size=3, padding=1, stride=2)) self.conv_out = zero_module( nn.Conv2d(block_out_channels[-1], conditioning_embedding_channels, kernel_size=3, padding=1) ) def forward(self, conditioning): embedding = self.conv_in(conditioning) embedding = F.silu(embedding) for block in self.blocks: embedding = block(embedding) embedding = F.silu(embedding) embedding = self.conv_out(embedding) return embedding class ControlNetModel(ModelMixin, ConfigMixin, FromOriginalControlNetMixin): """ A ControlNet model. Args: in_channels (`int`, defaults to 4): The number of channels in the input sample. flip_sin_to_cos (`bool`, defaults to `True`): Whether to flip the sin to cos in the time embedding. freq_shift (`int`, defaults to 0): The frequency shift to apply to the time embedding. down_block_types (`tuple[str]`, defaults to `("CrossAttnDownBlock2D", "CrossAttnDownBlock2D", "CrossAttnDownBlock2D", "DownBlock2D")`): The tuple of downsample blocks to use. only_cross_attention (`Union[bool, Tuple[bool]]`, defaults to `False`): block_out_channels (`tuple[int]`, defaults to `(320, 640, 1280, 1280)`): The tuple of output channels for each block. layers_per_block (`int`, defaults to 2): The number of layers per block. downsample_padding (`int`, defaults to 1): The padding to use for the downsampling convolution. mid_block_scale_factor (`float`, defaults to 1): The scale factor to use for the mid block. act_fn (`str`, defaults to "silu"): The activation function to use. norm_num_groups (`int`, *optional*, defaults to 32): The number of groups to use for the normalization. If None, normalization and activation layers is skipped in post-processing. norm_eps (`float`, defaults to 1e-5): The epsilon to use for the normalization. cross_attention_dim (`int`, defaults to 1280): The dimension of the cross attention features. transformer_layers_per_block (`int` or `Tuple[int]`, *optional*, defaults to 1): The number of transformer blocks of type [`~models.attention.BasicTransformerBlock`]. Only relevant for [`~models.unet_2d_blocks.CrossAttnDownBlock2D`], [`~models.unet_2d_blocks.CrossAttnUpBlock2D`], [`~models.unet_2d_blocks.UNetMidBlock2DCrossAttn`]. encoder_hid_dim (`int`, *optional*, defaults to None): If `encoder_hid_dim_type` is defined, `encoder_hidden_states` will be projected from `encoder_hid_dim` dimension to `cross_attention_dim`. encoder_hid_dim_type (`str`, *optional*, defaults to `None`): If given, the `encoder_hidden_states` and potentially other embeddings are down-projected to text embeddings of dimension `cross_attention` according to `encoder_hid_dim_type`. attention_head_dim (`Union[int, Tuple[int]]`, defaults to 8): The dimension of the attention heads. use_linear_projection (`bool`, defaults to `False`): class_embed_type (`str`, *optional*, defaults to `None`): The type of class embedding to use which is ultimately summed with the time embeddings. Choose from None, `"timestep"`, `"identity"`, `"projection"`, or `"simple_projection"`. addition_embed_type (`str`, *optional*, defaults to `None`): Configures an optional embedding which will be summed with the time embeddings. Choose from `None` or "text". "text" will use the `TextTimeEmbedding` layer. num_class_embeds (`int`, *optional*, defaults to 0): Input dimension of the learnable embedding matrix to be projected to `time_embed_dim`, when performing class conditioning with `class_embed_type` equal to `None`. upcast_attention (`bool`, defaults to `False`): resnet_time_scale_shift (`str`, defaults to `"default"`): Time scale shift config for ResNet blocks (see `ResnetBlock2D`). Choose from `default` or `scale_shift`. projection_class_embeddings_input_dim (`int`, *optional*, defaults to `None`): The dimension of the `class_labels` input when `class_embed_type="projection"`. Required when `class_embed_type="projection"`. controlnet_conditioning_channel_order (`str`, defaults to `"rgb"`): The channel order of conditional image. Will convert to `rgb` if it's `bgr`. conditioning_embedding_out_channels (`tuple[int]`, *optional*, defaults to `(16, 32, 96, 256)`): The tuple of output channel for each block in the `conditioning_embedding` layer. global_pool_conditions (`bool`, defaults to `False`): TODO(Patrick) - unused parameter. addition_embed_type_num_heads (`int`, defaults to 64): The number of heads to use for the `TextTimeEmbedding` layer. """ _supports_gradient_checkpointing = True @register_to_config def __init__( self, in_channels: int = 4, conditioning_channels: int = 3, flip_sin_to_cos: bool = True, freq_shift: int = 0, down_block_types: Tuple[str, ...] = ( "CrossAttnDownBlock2D", "CrossAttnDownBlock2D", "CrossAttnDownBlock2D", "DownBlock2D", ), mid_block_type: Optional[str] = "UNetMidBlock2DCrossAttn", only_cross_attention: Union[bool, Tuple[bool]] = False, block_out_channels: Tuple[int, ...] = (320, 640, 1280, 1280), layers_per_block: int = 2, downsample_padding: int = 1, mid_block_scale_factor: float = 1, act_fn: str = "silu", norm_num_groups: Optional[int] = 32, norm_eps: float = 1e-5, cross_attention_dim: int = 1280, transformer_layers_per_block: Union[int, Tuple[int, ...]] = 1, encoder_hid_dim: Optional[int] = None, encoder_hid_dim_type: Optional[str] = None, attention_head_dim: Union[int, Tuple[int, ...]] = 8, num_attention_heads: Optional[Union[int, Tuple[int, ...]]] = None, use_linear_projection: bool = False, class_embed_type: Optional[str] = None, addition_embed_type: Optional[str] = None, addition_time_embed_dim: Optional[int] = None, num_class_embeds: Optional[int] = None, upcast_attention: bool = False, resnet_time_scale_shift: str = "default", projection_class_embeddings_input_dim: Optional[int] = None, controlnet_conditioning_channel_order: str = "rgb", conditioning_embedding_out_channels: Optional[Tuple[int, ...]] = (16, 32, 96, 256), global_pool_conditions: bool = False, addition_embed_type_num_heads: int = 64, ): super().__init__() # If `num_attention_heads` is not defined (which is the case for most models) # it will default to `attention_head_dim`. This looks weird upon first reading it and it is. # The reason for this behavior is to correct for incorrectly named variables that were introduced # when this library was created. The incorrect naming was only discovered much later in https://github.com/huggingface/diffusers/issues/2011#issuecomment-1547958131 # Changing `attention_head_dim` to `num_attention_heads` for 40,000+ configurations is too backwards breaking # which is why we correct for the naming here. num_attention_heads = num_attention_heads or attention_head_dim # Check inputs if len(block_out_channels) != len(down_block_types): raise ValueError( f"Must provide the same number of `block_out_channels` as `down_block_types`. `block_out_channels`: {block_out_channels}. `down_block_types`: {down_block_types}." ) if not isinstance(only_cross_attention, bool) and len(only_cross_attention) != len(down_block_types): raise ValueError( f"Must provide the same number of `only_cross_attention` as `down_block_types`. `only_cross_attention`: {only_cross_attention}. `down_block_types`: {down_block_types}." ) if not isinstance(num_attention_heads, int) and len(num_attention_heads) != len(down_block_types): raise ValueError( f"Must provide the same number of `num_attention_heads` as `down_block_types`. `num_attention_heads`: {num_attention_heads}. `down_block_types`: {down_block_types}." ) if isinstance(transformer_layers_per_block, int): transformer_layers_per_block = [transformer_layers_per_block] * len(down_block_types) # input conv_in_kernel = 3 conv_in_padding = (conv_in_kernel - 1) // 2 self.conv_in = nn.Conv2d( in_channels, block_out_channels[0], kernel_size=conv_in_kernel, padding=conv_in_padding ) # time time_embed_dim = block_out_channels[0] * 4 self.time_proj = Timesteps(block_out_channels[0], flip_sin_to_cos, freq_shift) timestep_input_dim = block_out_channels[0] self.time_embedding = TimestepEmbedding( timestep_input_dim, time_embed_dim, act_fn=act_fn, ) if encoder_hid_dim_type is None and encoder_hid_dim is not None: encoder_hid_dim_type = "text_proj" self.register_to_config(encoder_hid_dim_type=encoder_hid_dim_type) logger.info("encoder_hid_dim_type defaults to 'text_proj' as `encoder_hid_dim` is defined.") if encoder_hid_dim is None and encoder_hid_dim_type is not None: raise ValueError( f"`encoder_hid_dim` has to be defined when `encoder_hid_dim_type` is set to {encoder_hid_dim_type}." ) if encoder_hid_dim_type == "text_proj": self.encoder_hid_proj = nn.Linear(encoder_hid_dim, cross_attention_dim) elif encoder_hid_dim_type == "text_image_proj": # image_embed_dim DOESN'T have to be `cross_attention_dim`. To not clutter the __init__ too much # they are set to `cross_attention_dim` here as this is exactly the required dimension for the currently only use # case when `addition_embed_type == "text_image_proj"` (Kadinsky 2.1)` self.encoder_hid_proj = TextImageProjection( text_embed_dim=encoder_hid_dim, image_embed_dim=cross_attention_dim, cross_attention_dim=cross_attention_dim, ) elif encoder_hid_dim_type is not None: raise ValueError( f"encoder_hid_dim_type: {encoder_hid_dim_type} must be None, 'text_proj' or 'text_image_proj'." ) else: self.encoder_hid_proj = None # class embedding if class_embed_type is None and num_class_embeds is not None: self.class_embedding = nn.Embedding(num_class_embeds, time_embed_dim) elif class_embed_type == "timestep": self.class_embedding = TimestepEmbedding(timestep_input_dim, time_embed_dim) elif class_embed_type == "identity": self.class_embedding = nn.Identity(time_embed_dim, time_embed_dim) elif class_embed_type == "projection": if projection_class_embeddings_input_dim is None: raise ValueError( "`class_embed_type`: 'projection' requires `projection_class_embeddings_input_dim` be set" ) # The projection `class_embed_type` is the same as the timestep `class_embed_type` except # 1. the `class_labels` inputs are not first converted to sinusoidal embeddings # 2. it projects from an arbitrary input dimension. # # Note that `TimestepEmbedding` is quite general, being mainly linear layers and activations. # When used for embedding actual timesteps, the timesteps are first converted to sinusoidal embeddings. # As a result, `TimestepEmbedding` can be passed arbitrary vectors. self.class_embedding = TimestepEmbedding(projection_class_embeddings_input_dim, time_embed_dim) else: self.class_embedding = None if addition_embed_type == "text": if encoder_hid_dim is not None: text_time_embedding_from_dim = encoder_hid_dim else: text_time_embedding_from_dim = cross_attention_dim self.add_embedding = TextTimeEmbedding( text_time_embedding_from_dim, time_embed_dim, num_heads=addition_embed_type_num_heads ) elif addition_embed_type == "text_image": # text_embed_dim and image_embed_dim DON'T have to be `cross_attention_dim`. To not clutter the __init__ too much # they are set to `cross_attention_dim` here as this is exactly the required dimension for the currently only use # case when `addition_embed_type == "text_image"` (Kadinsky 2.1)` self.add_embedding = TextImageTimeEmbedding( text_embed_dim=cross_attention_dim, image_embed_dim=cross_attention_dim, time_embed_dim=time_embed_dim ) elif addition_embed_type == "text_time": self.add_time_proj = Timesteps(addition_time_embed_dim, flip_sin_to_cos, freq_shift) self.add_embedding = TimestepEmbedding(projection_class_embeddings_input_dim, time_embed_dim) elif addition_embed_type is not None: raise ValueError(f"addition_embed_type: {addition_embed_type} must be None, 'text' or 'text_image'.") # control net conditioning embedding self.controlnet_cond_embedding = ControlNetConditioningEmbedding( conditioning_embedding_channels=block_out_channels[0], block_out_channels=conditioning_embedding_out_channels, conditioning_channels=conditioning_channels, ) self.down_blocks = nn.ModuleList([]) self.controlnet_down_blocks = nn.ModuleList([]) if isinstance(only_cross_attention, bool): only_cross_attention = [only_cross_attention] * len(down_block_types) if isinstance(attention_head_dim, int): attention_head_dim = (attention_head_dim,) * len(down_block_types) if isinstance(num_attention_heads, int): num_attention_heads = (num_attention_heads,) * len(down_block_types) # down output_channel = block_out_channels[0] controlnet_block = nn.Conv2d(output_channel, output_channel, kernel_size=1) controlnet_block = zero_module(controlnet_block) self.controlnet_down_blocks.append(controlnet_block) for i, down_block_type in enumerate(down_block_types): input_channel = output_channel output_channel = block_out_channels[i] is_final_block = i == len(block_out_channels) - 1 down_block = get_down_block( down_block_type, num_layers=layers_per_block, transformer_layers_per_block=transformer_layers_per_block[i], in_channels=input_channel, out_channels=output_channel, temb_channels=time_embed_dim, add_downsample=not is_final_block, resnet_eps=norm_eps, resnet_act_fn=act_fn, resnet_groups=norm_num_groups, cross_attention_dim=cross_attention_dim, num_attention_heads=num_attention_heads[i], attention_head_dim=attention_head_dim[i] if attention_head_dim[i] is not None else output_channel, downsample_padding=downsample_padding, use_linear_projection=use_linear_projection, only_cross_attention=only_cross_attention[i], upcast_attention=upcast_attention, resnet_time_scale_shift=resnet_time_scale_shift, ) self.down_blocks.append(down_block) for _ in range(layers_per_block): controlnet_block = nn.Conv2d(output_channel, output_channel, kernel_size=1) controlnet_block = zero_module(controlnet_block) self.controlnet_down_blocks.append(controlnet_block) if not is_final_block: controlnet_block = nn.Conv2d(output_channel, output_channel, kernel_size=1) controlnet_block = zero_module(controlnet_block) self.controlnet_down_blocks.append(controlnet_block) # mid mid_block_channel = block_out_channels[-1] controlnet_block = nn.Conv2d(mid_block_channel, mid_block_channel, kernel_size=1) controlnet_block = zero_module(controlnet_block) self.controlnet_mid_block = controlnet_block if mid_block_type == "UNetMidBlock2DCrossAttn": self.mid_block = UNetMidBlock2DCrossAttn( transformer_layers_per_block=transformer_layers_per_block[-1], in_channels=mid_block_channel, temb_channels=time_embed_dim, resnet_eps=norm_eps, resnet_act_fn=act_fn, output_scale_factor=mid_block_scale_factor, resnet_time_scale_shift=resnet_time_scale_shift, cross_attention_dim=cross_attention_dim, num_attention_heads=num_attention_heads[-1], resnet_groups=norm_num_groups, use_linear_projection=use_linear_projection, upcast_attention=upcast_attention, ) elif mid_block_type == "UNetMidBlock2D": self.mid_block = UNetMidBlock2D( in_channels=block_out_channels[-1], temb_channels=time_embed_dim, num_layers=0, resnet_eps=norm_eps, resnet_act_fn=act_fn, output_scale_factor=mid_block_scale_factor, resnet_groups=norm_num_groups, resnet_time_scale_shift=resnet_time_scale_shift, add_attention=False, ) else: raise ValueError(f"unknown mid_block_type : {mid_block_type}") @classmethod def from_unet( cls, unet: UNet2DConditionModel, controlnet_conditioning_channel_order: str = "rgb", conditioning_embedding_out_channels: Optional[Tuple[int, ...]] = (16, 32, 96, 256), load_weights_from_unet: bool = True, conditioning_channels: int = 3, ): r""" Instantiate a [`ControlNetModel`] from [`UNet2DConditionModel`]. Parameters: unet (`UNet2DConditionModel`): The UNet model weights to copy to the [`ControlNetModel`]. All configuration options are also copied where applicable. """ transformer_layers_per_block = ( unet.config.transformer_layers_per_block if "transformer_layers_per_block" in unet.config else 1 ) encoder_hid_dim = unet.config.encoder_hid_dim if "encoder_hid_dim" in unet.config else None encoder_hid_dim_type = unet.config.encoder_hid_dim_type if "encoder_hid_dim_type" in unet.config else None addition_embed_type = unet.config.addition_embed_type if "addition_embed_type" in unet.config else None addition_time_embed_dim = ( unet.config.addition_time_embed_dim if "addition_time_embed_dim" in unet.config else None ) controlnet = cls( encoder_hid_dim=encoder_hid_dim, encoder_hid_dim_type=encoder_hid_dim_type, addition_embed_type=addition_embed_type, addition_time_embed_dim=addition_time_embed_dim, transformer_layers_per_block=transformer_layers_per_block, in_channels=unet.config.in_channels, flip_sin_to_cos=unet.config.flip_sin_to_cos, freq_shift=unet.config.freq_shift, down_block_types=unet.config.down_block_types, only_cross_attention=unet.config.only_cross_attention, block_out_channels=unet.config.block_out_channels, layers_per_block=unet.config.layers_per_block, downsample_padding=unet.config.downsample_padding, mid_block_scale_factor=unet.config.mid_block_scale_factor, act_fn=unet.config.act_fn, norm_num_groups=unet.config.norm_num_groups, norm_eps=unet.config.norm_eps, cross_attention_dim=unet.config.cross_attention_dim, attention_head_dim=unet.config.attention_head_dim, num_attention_heads=unet.config.num_attention_heads, use_linear_projection=unet.config.use_linear_projection, class_embed_type=unet.config.class_embed_type, num_class_embeds=unet.config.num_class_embeds, upcast_attention=unet.config.upcast_attention, resnet_time_scale_shift=unet.config.resnet_time_scale_shift, projection_class_embeddings_input_dim=unet.config.projection_class_embeddings_input_dim, mid_block_type=unet.config.mid_block_type, controlnet_conditioning_channel_order=controlnet_conditioning_channel_order, conditioning_embedding_out_channels=conditioning_embedding_out_channels, conditioning_channels=conditioning_channels, ) if load_weights_from_unet: controlnet.conv_in.load_state_dict(unet.conv_in.state_dict()) controlnet.time_proj.load_state_dict(unet.time_proj.state_dict()) controlnet.time_embedding.load_state_dict(unet.time_embedding.state_dict()) if controlnet.class_embedding: controlnet.class_embedding.load_state_dict(unet.class_embedding.state_dict()) controlnet.down_blocks.load_state_dict(unet.down_blocks.state_dict()) controlnet.mid_block.load_state_dict(unet.mid_block.state_dict()) return controlnet @property # Copied from diffusers.models.unets.unet_2d_condition.UNet2DConditionModel.attn_processors def attn_processors(self) -> Dict[str, AttentionProcessor]: r""" Returns: `dict` of attention processors: A dictionary containing all attention processors used in the model with indexed by its weight name. """ # set recursively processors = {} def fn_recursive_add_processors(name: str, module: torch.nn.Module, processors: Dict[str, AttentionProcessor]): if hasattr(module, "get_processor"): processors[f"{name}.processor"] = module.get_processor(return_deprecated_lora=True) for sub_name, child in module.named_children(): fn_recursive_add_processors(f"{name}.{sub_name}", child, processors) return processors for name, module in self.named_children(): fn_recursive_add_processors(name, module, processors) return processors # Copied from diffusers.models.unets.unet_2d_condition.UNet2DConditionModel.set_attn_processor def set_attn_processor(self, processor: Union[AttentionProcessor, Dict[str, AttentionProcessor]]): r""" Sets the attention processor to use to compute attention. Parameters: processor (`dict` of `AttentionProcessor` or only `AttentionProcessor`): The instantiated processor class or a dictionary of processor classes that will be set as the processor for **all** `Attention` layers. If `processor` is a dict, the key needs to define the path to the corresponding cross attention processor. This is strongly recommended when setting trainable attention processors. """ count = len(self.attn_processors.keys()) if isinstance(processor, dict) and len(processor) != count: raise ValueError( f"A dict of processors was passed, but the number of processors {len(processor)} does not match the" f" number of attention layers: {count}. Please make sure to pass {count} processor classes." ) def fn_recursive_attn_processor(name: str, module: torch.nn.Module, processor): if hasattr(module, "set_processor"): if not isinstance(processor, dict): module.set_processor(processor) else: module.set_processor(processor.pop(f"{name}.processor")) for sub_name, child in module.named_children(): fn_recursive_attn_processor(f"{name}.{sub_name}", child, processor) for name, module in self.named_children(): fn_recursive_attn_processor(name, module, processor) # Copied from diffusers.models.unets.unet_2d_condition.UNet2DConditionModel.set_default_attn_processor def set_default_attn_processor(self): """ Disables custom attention processors and sets the default attention implementation. """ if all(proc.__class__ in ADDED_KV_ATTENTION_PROCESSORS for proc in self.attn_processors.values()): processor = AttnAddedKVProcessor() elif all(proc.__class__ in CROSS_ATTENTION_PROCESSORS for proc in self.attn_processors.values()): processor = AttnProcessor() else: raise ValueError( f"Cannot call `set_default_attn_processor` when attention processors are of type {next(iter(self.attn_processors.values()))}" ) self.set_attn_processor(processor) # Copied from diffusers.models.unets.unet_2d_condition.UNet2DConditionModel.set_attention_slice def set_attention_slice(self, slice_size: Union[str, int, List[int]]) -> None: r""" Enable sliced attention computation. When this option is enabled, the attention module splits the input tensor in slices to compute attention in several steps. This is useful for saving some memory in exchange for a small decrease in speed. Args: slice_size (`str` or `int` or `list(int)`, *optional*, defaults to `"auto"`): When `"auto"`, input to the attention heads is halved, so attention is computed in two steps. If `"max"`, maximum amount of memory is saved by running only one slice at a time. If a number is provided, uses as many slices as `attention_head_dim // slice_size`. In this case, `attention_head_dim` must be a multiple of `slice_size`. """ sliceable_head_dims = [] def fn_recursive_retrieve_sliceable_dims(module: torch.nn.Module): if hasattr(module, "set_attention_slice"): sliceable_head_dims.append(module.sliceable_head_dim) for child in module.children(): fn_recursive_retrieve_sliceable_dims(child) # retrieve number of attention layers for module in self.children(): fn_recursive_retrieve_sliceable_dims(module) num_sliceable_layers = len(sliceable_head_dims) if slice_size == "auto": # half the attention head size is usually a good trade-off between # speed and memory slice_size = [dim // 2 for dim in sliceable_head_dims] elif slice_size == "max": # make smallest slice possible slice_size = num_sliceable_layers * [1] slice_size = num_sliceable_layers * [slice_size] if not isinstance(slice_size, list) else slice_size if len(slice_size) != len(sliceable_head_dims): raise ValueError( f"You have provided {len(slice_size)}, but {self.config} has {len(sliceable_head_dims)} different" f" attention layers. Make sure to match `len(slice_size)` to be {len(sliceable_head_dims)}." ) for i in range(len(slice_size)): size = slice_size[i] dim = sliceable_head_dims[i] if size is not None and size > dim: raise ValueError(f"size {size} has to be smaller or equal to {dim}.") # Recursively walk through all the children. # Any children which exposes the set_attention_slice method # gets the message def fn_recursive_set_attention_slice(module: torch.nn.Module, slice_size: List[int]): if hasattr(module, "set_attention_slice"): module.set_attention_slice(slice_size.pop()) for child in module.children(): fn_recursive_set_attention_slice(child, slice_size) reversed_slice_size = list(reversed(slice_size)) for module in self.children(): fn_recursive_set_attention_slice(module, reversed_slice_size) def _set_gradient_checkpointing(self, module, value: bool = False) -> None: if isinstance(module, (CrossAttnDownBlock2D, DownBlock2D)): module.gradient_checkpointing = value def forward( self, sample: torch.FloatTensor, timestep: Union[torch.Tensor, float, int], encoder_hidden_states: torch.Tensor, controlnet_cond: torch.FloatTensor, conditioning_scale: float = 1.0, class_labels: Optional[torch.Tensor] = None, timestep_cond: Optional[torch.Tensor] = None, attention_mask: Optional[torch.Tensor] = None, added_cond_kwargs: Optional[Dict[str, torch.Tensor]] = None, cross_attention_kwargs: Optional[Dict[str, Any]] = None, guess_mode: bool = False, return_dict: bool = True, ) -> Union[ControlNetOutput, Tuple[Tuple[torch.FloatTensor, ...], torch.FloatTensor]]: """ The [`ControlNetModel`] forward method. Args: sample (`torch.FloatTensor`): The noisy input tensor. timestep (`Union[torch.Tensor, float, int]`): The number of timesteps to denoise an input. encoder_hidden_states (`torch.Tensor`): The encoder hidden states. controlnet_cond (`torch.FloatTensor`): The conditional input tensor of shape `(batch_size, sequence_length, hidden_size)`. conditioning_scale (`float`, defaults to `1.0`): The scale factor for ControlNet outputs. class_labels (`torch.Tensor`, *optional*, defaults to `None`): Optional class labels for conditioning. Their embeddings will be summed with the timestep embeddings. timestep_cond (`torch.Tensor`, *optional*, defaults to `None`): Additional conditional embeddings for timestep. If provided, the embeddings will be summed with the timestep_embedding passed through the `self.time_embedding` layer to obtain the final timestep embeddings. attention_mask (`torch.Tensor`, *optional*, defaults to `None`): An attention mask of shape `(batch, key_tokens)` is applied to `encoder_hidden_states`. If `1` the mask is kept, otherwise if `0` it is discarded. Mask will be converted into a bias, which adds large negative values to the attention scores corresponding to "discard" tokens. added_cond_kwargs (`dict`): Additional conditions for the Stable Diffusion XL UNet. cross_attention_kwargs (`dict[str]`, *optional*, defaults to `None`): A kwargs dictionary that if specified is passed along to the `AttnProcessor`. guess_mode (`bool`, defaults to `False`): In this mode, the ControlNet encoder tries its best to recognize the input content of the input even if you remove all prompts. A `guidance_scale` between 3.0 and 5.0 is recommended. return_dict (`bool`, defaults to `True`): Whether or not to return a [`~models.controlnet.ControlNetOutput`] instead of a plain tuple. Returns: [`~models.controlnet.ControlNetOutput`] **or** `tuple`: If `return_dict` is `True`, a [`~models.controlnet.ControlNetOutput`] is returned, otherwise a tuple is returned where the first element is the sample tensor. """ # check channel order channel_order = self.config.controlnet_conditioning_channel_order if channel_order == "rgb": # in rgb order by default ... elif channel_order == "bgr": controlnet_cond = torch.flip(controlnet_cond, dims=[1]) else: raise ValueError(f"unknown `controlnet_conditioning_channel_order`: {channel_order}") # prepare attention_mask if attention_mask is not None: attention_mask = (1 - attention_mask.to(sample.dtype)) * -10000.0 attention_mask = attention_mask.unsqueeze(1) # 1. time timesteps = timestep if not torch.is_tensor(timesteps): # TODO: this requires sync between CPU and GPU. So try to pass timesteps as tensors if you can # This would be a good case for the `match` statement (Python 3.10+) is_mps = sample.device.type == "mps" if isinstance(timestep, float): dtype = torch.float32 if is_mps else torch.float64 else: dtype = torch.int32 if is_mps else torch.int64 timesteps = torch.tensor([timesteps], dtype=dtype, device=sample.device) elif len(timesteps.shape) == 0: timesteps = timesteps[None].to(sample.device) # broadcast to batch dimension in a way that's compatible with ONNX/Core ML timesteps = timesteps.expand(sample.shape[0]) t_emb = self.time_proj(timesteps) # timesteps does not contain any weights and will always return f32 tensors # but time_embedding might actually be running in fp16. so we need to cast here. # there might be better ways to encapsulate this. t_emb = t_emb.to(dtype=sample.dtype) emb = self.time_embedding(t_emb, timestep_cond) aug_emb = None if self.class_embedding is not None: if class_labels is None: raise ValueError("class_labels should be provided when num_class_embeds > 0") if self.config.class_embed_type == "timestep": class_labels = self.time_proj(class_labels) class_emb = self.class_embedding(class_labels).to(dtype=self.dtype) emb = emb + class_emb if self.config.addition_embed_type is not None: if self.config.addition_embed_type == "text": aug_emb = self.add_embedding(encoder_hidden_states) elif self.config.addition_embed_type == "text_time": if "text_embeds" not in added_cond_kwargs: raise ValueError( f"{self.__class__} has the config param `addition_embed_type` set to 'text_time' which requires the keyword argument `text_embeds` to be passed in `added_cond_kwargs`" ) text_embeds = added_cond_kwargs.get("text_embeds") if "time_ids" not in added_cond_kwargs: raise ValueError( f"{self.__class__} has the config param `addition_embed_type` set to 'text_time' which requires the keyword argument `time_ids` to be passed in `added_cond_kwargs`" ) time_ids = added_cond_kwargs.get("time_ids") time_embeds = self.add_time_proj(time_ids.flatten()) time_embeds = time_embeds.reshape((text_embeds.shape[0], -1)) add_embeds = torch.concat([text_embeds, time_embeds], dim=-1) add_embeds = add_embeds.to(emb.dtype) aug_emb = self.add_embedding(add_embeds) emb = emb + aug_emb if aug_emb is not None else emb # 2. pre-process sample = self.conv_in(sample) controlnet_cond = self.controlnet_cond_embedding(controlnet_cond) sample = sample + controlnet_cond # 3. down down_block_res_samples = (sample,) for downsample_block in self.down_blocks: if hasattr(downsample_block, "has_cross_attention") and downsample_block.has_cross_attention: sample, res_samples = downsample_block( hidden_states=sample, temb=emb, encoder_hidden_states=encoder_hidden_states, attention_mask=attention_mask, cross_attention_kwargs=cross_attention_kwargs, ) else: sample, res_samples = downsample_block(hidden_states=sample, temb=emb) down_block_res_samples += res_samples # 4. mid if self.mid_block is not None: if hasattr(self.mid_block, "has_cross_attention") and self.mid_block.has_cross_attention: sample = self.mid_block( sample, emb, encoder_hidden_states=encoder_hidden_states, attention_mask=attention_mask, cross_attention_kwargs=cross_attention_kwargs, ) else: sample = self.mid_block(sample, emb) # 5. Control net blocks controlnet_down_block_res_samples = () for down_block_res_sample, controlnet_block in zip(down_block_res_samples, self.controlnet_down_blocks): down_block_res_sample = controlnet_block(down_block_res_sample) controlnet_down_block_res_samples = controlnet_down_block_res_samples + (down_block_res_sample,) down_block_res_samples = controlnet_down_block_res_samples mid_block_res_sample = self.controlnet_mid_block(sample) # 6. scaling if guess_mode and not self.config.global_pool_conditions: scales = torch.logspace(-1, 0, len(down_block_res_samples) + 1, device=sample.device) # 0.1 to 1.0 scales = scales * conditioning_scale down_block_res_samples = [sample * scale for sample, scale in zip(down_block_res_samples, scales)] mid_block_res_sample = mid_block_res_sample * scales[-1] # last one else: down_block_res_samples = [sample * conditioning_scale for sample in down_block_res_samples] mid_block_res_sample = mid_block_res_sample * conditioning_scale if self.config.global_pool_conditions: down_block_res_samples = [ torch.mean(sample, dim=(2, 3), keepdim=True) for sample in down_block_res_samples ] mid_block_res_sample = torch.mean(mid_block_res_sample, dim=(2, 3), keepdim=True) if not return_dict: return (down_block_res_samples, mid_block_res_sample) return ControlNetOutput( down_block_res_samples=down_block_res_samples, mid_block_res_sample=mid_block_res_sample ) def zero_module(module): for p in module.parameters(): nn.init.zeros_(p) return module
diffusers/src/diffusers/models/controlnet.py/0
{ "file_path": "diffusers/src/diffusers/models/controlnet.py", "repo_id": "diffusers", "token_count": 18789 }
111
# Copyright 2023 The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from ..utils import deprecate from .transformers.t5_film_transformer import ( DecoderLayer, NewGELUActivation, T5DenseGatedActDense, T5FilmDecoder, T5FiLMLayer, T5LayerCrossAttention, T5LayerFFCond, T5LayerNorm, T5LayerSelfAttentionCond, ) class T5FilmDecoder(T5FilmDecoder): deprecation_message = "Importing `T5FilmDecoder` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import T5FilmDecoder`, instead." deprecate("T5FilmDecoder", "0.29", deprecation_message) class DecoderLayer(DecoderLayer): deprecation_message = "Importing `DecoderLayer` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import DecoderLayer`, instead." deprecate("DecoderLayer", "0.29", deprecation_message) class T5LayerSelfAttentionCond(T5LayerSelfAttentionCond): deprecation_message = "Importing `T5LayerSelfAttentionCond` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import T5LayerSelfAttentionCond`, instead." deprecate("T5LayerSelfAttentionCond", "0.29", deprecation_message) class T5LayerCrossAttention(T5LayerCrossAttention): deprecation_message = "Importing `T5LayerCrossAttention` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import T5LayerCrossAttention`, instead." deprecate("T5LayerCrossAttention", "0.29", deprecation_message) class T5LayerFFCond(T5LayerFFCond): deprecation_message = "Importing `T5LayerFFCond` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import T5LayerFFCond`, instead." deprecate("T5LayerFFCond", "0.29", deprecation_message) class T5DenseGatedActDense(T5DenseGatedActDense): deprecation_message = "Importing `T5DenseGatedActDense` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import T5DenseGatedActDense`, instead." deprecate("T5DenseGatedActDense", "0.29", deprecation_message) class T5LayerNorm(T5LayerNorm): deprecation_message = "Importing `T5LayerNorm` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import T5LayerNorm`, instead." deprecate("T5LayerNorm", "0.29", deprecation_message) class NewGELUActivation(NewGELUActivation): deprecation_message = "Importing `T5LayerNorm` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import NewGELUActivation`, instead." deprecate("NewGELUActivation", "0.29", deprecation_message) class T5FiLMLayer(T5FiLMLayer): deprecation_message = "Importing `T5FiLMLayer` from `diffusers.models.t5_film_transformer` is deprecated and this will be removed in a future version. Please use `from diffusers.models.transformers.t5_film_transformer import T5FiLMLayer`, instead." deprecate("T5FiLMLayer", "0.29", deprecation_message)
diffusers/src/diffusers/models/t5_film_transformer.py/0
{ "file_path": "diffusers/src/diffusers/models/t5_film_transformer.py", "repo_id": "diffusers", "token_count": 1344 }
112
# Copyright 2023 The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import math from typing import Optional, Tuple, Union import torch import torch.nn.functional as F from torch import nn from ..activations import get_activation from ..resnet import Downsample1D, ResidualTemporalBlock1D, Upsample1D, rearrange_dims class DownResnetBlock1D(nn.Module): def __init__( self, in_channels: int, out_channels: Optional[int] = None, num_layers: int = 1, conv_shortcut: bool = False, temb_channels: int = 32, groups: int = 32, groups_out: Optional[int] = None, non_linearity: Optional[str] = None, time_embedding_norm: str = "default", output_scale_factor: float = 1.0, add_downsample: bool = True, ): super().__init__() self.in_channels = in_channels out_channels = in_channels if out_channels is None else out_channels self.out_channels = out_channels self.use_conv_shortcut = conv_shortcut self.time_embedding_norm = time_embedding_norm self.add_downsample = add_downsample self.output_scale_factor = output_scale_factor if groups_out is None: groups_out = groups # there will always be at least one resnet resnets = [ResidualTemporalBlock1D(in_channels, out_channels, embed_dim=temb_channels)] for _ in range(num_layers): resnets.append(ResidualTemporalBlock1D(out_channels, out_channels, embed_dim=temb_channels)) self.resnets = nn.ModuleList(resnets) if non_linearity is None: self.nonlinearity = None else: self.nonlinearity = get_activation(non_linearity) self.downsample = None if add_downsample: self.downsample = Downsample1D(out_channels, use_conv=True, padding=1) def forward(self, hidden_states: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: output_states = () hidden_states = self.resnets[0](hidden_states, temb) for resnet in self.resnets[1:]: hidden_states = resnet(hidden_states, temb) output_states += (hidden_states,) if self.nonlinearity is not None: hidden_states = self.nonlinearity(hidden_states) if self.downsample is not None: hidden_states = self.downsample(hidden_states) return hidden_states, output_states class UpResnetBlock1D(nn.Module): def __init__( self, in_channels: int, out_channels: Optional[int] = None, num_layers: int = 1, temb_channels: int = 32, groups: int = 32, groups_out: Optional[int] = None, non_linearity: Optional[str] = None, time_embedding_norm: str = "default", output_scale_factor: float = 1.0, add_upsample: bool = True, ): super().__init__() self.in_channels = in_channels out_channels = in_channels if out_channels is None else out_channels self.out_channels = out_channels self.time_embedding_norm = time_embedding_norm self.add_upsample = add_upsample self.output_scale_factor = output_scale_factor if groups_out is None: groups_out = groups # there will always be at least one resnet resnets = [ResidualTemporalBlock1D(2 * in_channels, out_channels, embed_dim=temb_channels)] for _ in range(num_layers): resnets.append(ResidualTemporalBlock1D(out_channels, out_channels, embed_dim=temb_channels)) self.resnets = nn.ModuleList(resnets) if non_linearity is None: self.nonlinearity = None else: self.nonlinearity = get_activation(non_linearity) self.upsample = None if add_upsample: self.upsample = Upsample1D(out_channels, use_conv_transpose=True) def forward( self, hidden_states: torch.FloatTensor, res_hidden_states_tuple: Optional[Tuple[torch.FloatTensor, ...]] = None, temb: Optional[torch.FloatTensor] = None, ) -> torch.FloatTensor: if res_hidden_states_tuple is not None: res_hidden_states = res_hidden_states_tuple[-1] hidden_states = torch.cat((hidden_states, res_hidden_states), dim=1) hidden_states = self.resnets[0](hidden_states, temb) for resnet in self.resnets[1:]: hidden_states = resnet(hidden_states, temb) if self.nonlinearity is not None: hidden_states = self.nonlinearity(hidden_states) if self.upsample is not None: hidden_states = self.upsample(hidden_states) return hidden_states class ValueFunctionMidBlock1D(nn.Module): def __init__(self, in_channels: int, out_channels: int, embed_dim: int): super().__init__() self.in_channels = in_channels self.out_channels = out_channels self.embed_dim = embed_dim self.res1 = ResidualTemporalBlock1D(in_channels, in_channels // 2, embed_dim=embed_dim) self.down1 = Downsample1D(out_channels // 2, use_conv=True) self.res2 = ResidualTemporalBlock1D(in_channels // 2, in_channels // 4, embed_dim=embed_dim) self.down2 = Downsample1D(out_channels // 4, use_conv=True) def forward(self, x: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: x = self.res1(x, temb) x = self.down1(x) x = self.res2(x, temb) x = self.down2(x) return x class MidResTemporalBlock1D(nn.Module): def __init__( self, in_channels: int, out_channels: int, embed_dim: int, num_layers: int = 1, add_downsample: bool = False, add_upsample: bool = False, non_linearity: Optional[str] = None, ): super().__init__() self.in_channels = in_channels self.out_channels = out_channels self.add_downsample = add_downsample # there will always be at least one resnet resnets = [ResidualTemporalBlock1D(in_channels, out_channels, embed_dim=embed_dim)] for _ in range(num_layers): resnets.append(ResidualTemporalBlock1D(out_channels, out_channels, embed_dim=embed_dim)) self.resnets = nn.ModuleList(resnets) if non_linearity is None: self.nonlinearity = None else: self.nonlinearity = get_activation(non_linearity) self.upsample = None if add_upsample: self.upsample = Downsample1D(out_channels, use_conv=True) self.downsample = None if add_downsample: self.downsample = Downsample1D(out_channels, use_conv=True) if self.upsample and self.downsample: raise ValueError("Block cannot downsample and upsample") def forward(self, hidden_states: torch.FloatTensor, temb: torch.FloatTensor) -> torch.FloatTensor: hidden_states = self.resnets[0](hidden_states, temb) for resnet in self.resnets[1:]: hidden_states = resnet(hidden_states, temb) if self.upsample: hidden_states = self.upsample(hidden_states) if self.downsample: self.downsample = self.downsample(hidden_states) return hidden_states class OutConv1DBlock(nn.Module): def __init__(self, num_groups_out: int, out_channels: int, embed_dim: int, act_fn: str): super().__init__() self.final_conv1d_1 = nn.Conv1d(embed_dim, embed_dim, 5, padding=2) self.final_conv1d_gn = nn.GroupNorm(num_groups_out, embed_dim) self.final_conv1d_act = get_activation(act_fn) self.final_conv1d_2 = nn.Conv1d(embed_dim, out_channels, 1) def forward(self, hidden_states: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: hidden_states = self.final_conv1d_1(hidden_states) hidden_states = rearrange_dims(hidden_states) hidden_states = self.final_conv1d_gn(hidden_states) hidden_states = rearrange_dims(hidden_states) hidden_states = self.final_conv1d_act(hidden_states) hidden_states = self.final_conv1d_2(hidden_states) return hidden_states class OutValueFunctionBlock(nn.Module): def __init__(self, fc_dim: int, embed_dim: int, act_fn: str = "mish"): super().__init__() self.final_block = nn.ModuleList( [ nn.Linear(fc_dim + embed_dim, fc_dim // 2), get_activation(act_fn), nn.Linear(fc_dim // 2, 1), ] ) def forward(self, hidden_states: torch.FloatTensor, temb: torch.FloatTensor) -> torch.FloatTensor: hidden_states = hidden_states.view(hidden_states.shape[0], -1) hidden_states = torch.cat((hidden_states, temb), dim=-1) for layer in self.final_block: hidden_states = layer(hidden_states) return hidden_states _kernels = { "linear": [1 / 8, 3 / 8, 3 / 8, 1 / 8], "cubic": [-0.01171875, -0.03515625, 0.11328125, 0.43359375, 0.43359375, 0.11328125, -0.03515625, -0.01171875], "lanczos3": [ 0.003689131001010537, 0.015056144446134567, -0.03399861603975296, -0.066637322306633, 0.13550527393817902, 0.44638532400131226, 0.44638532400131226, 0.13550527393817902, -0.066637322306633, -0.03399861603975296, 0.015056144446134567, 0.003689131001010537, ], } class Downsample1d(nn.Module): def __init__(self, kernel: str = "linear", pad_mode: str = "reflect"): super().__init__() self.pad_mode = pad_mode kernel_1d = torch.tensor(_kernels[kernel]) self.pad = kernel_1d.shape[0] // 2 - 1 self.register_buffer("kernel", kernel_1d) def forward(self, hidden_states: torch.FloatTensor) -> torch.FloatTensor: hidden_states = F.pad(hidden_states, (self.pad,) * 2, self.pad_mode) weight = hidden_states.new_zeros([hidden_states.shape[1], hidden_states.shape[1], self.kernel.shape[0]]) indices = torch.arange(hidden_states.shape[1], device=hidden_states.device) kernel = self.kernel.to(weight)[None, :].expand(hidden_states.shape[1], -1) weight[indices, indices] = kernel return F.conv1d(hidden_states, weight, stride=2) class Upsample1d(nn.Module): def __init__(self, kernel: str = "linear", pad_mode: str = "reflect"): super().__init__() self.pad_mode = pad_mode kernel_1d = torch.tensor(_kernels[kernel]) * 2 self.pad = kernel_1d.shape[0] // 2 - 1 self.register_buffer("kernel", kernel_1d) def forward(self, hidden_states: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: hidden_states = F.pad(hidden_states, ((self.pad + 1) // 2,) * 2, self.pad_mode) weight = hidden_states.new_zeros([hidden_states.shape[1], hidden_states.shape[1], self.kernel.shape[0]]) indices = torch.arange(hidden_states.shape[1], device=hidden_states.device) kernel = self.kernel.to(weight)[None, :].expand(hidden_states.shape[1], -1) weight[indices, indices] = kernel return F.conv_transpose1d(hidden_states, weight, stride=2, padding=self.pad * 2 + 1) class SelfAttention1d(nn.Module): def __init__(self, in_channels: int, n_head: int = 1, dropout_rate: float = 0.0): super().__init__() self.channels = in_channels self.group_norm = nn.GroupNorm(1, num_channels=in_channels) self.num_heads = n_head self.query = nn.Linear(self.channels, self.channels) self.key = nn.Linear(self.channels, self.channels) self.value = nn.Linear(self.channels, self.channels) self.proj_attn = nn.Linear(self.channels, self.channels, bias=True) self.dropout = nn.Dropout(dropout_rate, inplace=True) def transpose_for_scores(self, projection: torch.Tensor) -> torch.Tensor: new_projection_shape = projection.size()[:-1] + (self.num_heads, -1) # move heads to 2nd position (B, T, H * D) -> (B, T, H, D) -> (B, H, T, D) new_projection = projection.view(new_projection_shape).permute(0, 2, 1, 3) return new_projection def forward(self, hidden_states: torch.FloatTensor) -> torch.FloatTensor: residual = hidden_states batch, channel_dim, seq = hidden_states.shape hidden_states = self.group_norm(hidden_states) hidden_states = hidden_states.transpose(1, 2) query_proj = self.query(hidden_states) key_proj = self.key(hidden_states) value_proj = self.value(hidden_states) query_states = self.transpose_for_scores(query_proj) key_states = self.transpose_for_scores(key_proj) value_states = self.transpose_for_scores(value_proj) scale = 1 / math.sqrt(math.sqrt(key_states.shape[-1])) attention_scores = torch.matmul(query_states * scale, key_states.transpose(-1, -2) * scale) attention_probs = torch.softmax(attention_scores, dim=-1) # compute attention output hidden_states = torch.matmul(attention_probs, value_states) hidden_states = hidden_states.permute(0, 2, 1, 3).contiguous() new_hidden_states_shape = hidden_states.size()[:-2] + (self.channels,) hidden_states = hidden_states.view(new_hidden_states_shape) # compute next hidden_states hidden_states = self.proj_attn(hidden_states) hidden_states = hidden_states.transpose(1, 2) hidden_states = self.dropout(hidden_states) output = hidden_states + residual return output class ResConvBlock(nn.Module): def __init__(self, in_channels: int, mid_channels: int, out_channels: int, is_last: bool = False): super().__init__() self.is_last = is_last self.has_conv_skip = in_channels != out_channels if self.has_conv_skip: self.conv_skip = nn.Conv1d(in_channels, out_channels, 1, bias=False) self.conv_1 = nn.Conv1d(in_channels, mid_channels, 5, padding=2) self.group_norm_1 = nn.GroupNorm(1, mid_channels) self.gelu_1 = nn.GELU() self.conv_2 = nn.Conv1d(mid_channels, out_channels, 5, padding=2) if not self.is_last: self.group_norm_2 = nn.GroupNorm(1, out_channels) self.gelu_2 = nn.GELU() def forward(self, hidden_states: torch.FloatTensor) -> torch.FloatTensor: residual = self.conv_skip(hidden_states) if self.has_conv_skip else hidden_states hidden_states = self.conv_1(hidden_states) hidden_states = self.group_norm_1(hidden_states) hidden_states = self.gelu_1(hidden_states) hidden_states = self.conv_2(hidden_states) if not self.is_last: hidden_states = self.group_norm_2(hidden_states) hidden_states = self.gelu_2(hidden_states) output = hidden_states + residual return output class UNetMidBlock1D(nn.Module): def __init__(self, mid_channels: int, in_channels: int, out_channels: Optional[int] = None): super().__init__() out_channels = in_channels if out_channels is None else out_channels # there is always at least one resnet self.down = Downsample1d("cubic") resnets = [ ResConvBlock(in_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, out_channels), ] attentions = [ SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(out_channels, out_channels // 32), ] self.up = Upsample1d(kernel="cubic") self.attentions = nn.ModuleList(attentions) self.resnets = nn.ModuleList(resnets) def forward(self, hidden_states: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: hidden_states = self.down(hidden_states) for attn, resnet in zip(self.attentions, self.resnets): hidden_states = resnet(hidden_states) hidden_states = attn(hidden_states) hidden_states = self.up(hidden_states) return hidden_states class AttnDownBlock1D(nn.Module): def __init__(self, out_channels: int, in_channels: int, mid_channels: Optional[int] = None): super().__init__() mid_channels = out_channels if mid_channels is None else mid_channels self.down = Downsample1d("cubic") resnets = [ ResConvBlock(in_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, out_channels), ] attentions = [ SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(out_channels, out_channels // 32), ] self.attentions = nn.ModuleList(attentions) self.resnets = nn.ModuleList(resnets) def forward(self, hidden_states: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: hidden_states = self.down(hidden_states) for resnet, attn in zip(self.resnets, self.attentions): hidden_states = resnet(hidden_states) hidden_states = attn(hidden_states) return hidden_states, (hidden_states,) class DownBlock1D(nn.Module): def __init__(self, out_channels: int, in_channels: int, mid_channels: Optional[int] = None): super().__init__() mid_channels = out_channels if mid_channels is None else mid_channels self.down = Downsample1d("cubic") resnets = [ ResConvBlock(in_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, out_channels), ] self.resnets = nn.ModuleList(resnets) def forward(self, hidden_states: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: hidden_states = self.down(hidden_states) for resnet in self.resnets: hidden_states = resnet(hidden_states) return hidden_states, (hidden_states,) class DownBlock1DNoSkip(nn.Module): def __init__(self, out_channels: int, in_channels: int, mid_channels: Optional[int] = None): super().__init__() mid_channels = out_channels if mid_channels is None else mid_channels resnets = [ ResConvBlock(in_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, out_channels), ] self.resnets = nn.ModuleList(resnets) def forward(self, hidden_states: torch.FloatTensor, temb: Optional[torch.FloatTensor] = None) -> torch.FloatTensor: hidden_states = torch.cat([hidden_states, temb], dim=1) for resnet in self.resnets: hidden_states = resnet(hidden_states) return hidden_states, (hidden_states,) class AttnUpBlock1D(nn.Module): def __init__(self, in_channels: int, out_channels: int, mid_channels: Optional[int] = None): super().__init__() mid_channels = out_channels if mid_channels is None else mid_channels resnets = [ ResConvBlock(2 * in_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, out_channels), ] attentions = [ SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(mid_channels, mid_channels // 32), SelfAttention1d(out_channels, out_channels // 32), ] self.attentions = nn.ModuleList(attentions) self.resnets = nn.ModuleList(resnets) self.up = Upsample1d(kernel="cubic") def forward( self, hidden_states: torch.FloatTensor, res_hidden_states_tuple: Tuple[torch.FloatTensor, ...], temb: Optional[torch.FloatTensor] = None, ) -> torch.FloatTensor: res_hidden_states = res_hidden_states_tuple[-1] hidden_states = torch.cat([hidden_states, res_hidden_states], dim=1) for resnet, attn in zip(self.resnets, self.attentions): hidden_states = resnet(hidden_states) hidden_states = attn(hidden_states) hidden_states = self.up(hidden_states) return hidden_states class UpBlock1D(nn.Module): def __init__(self, in_channels: int, out_channels: int, mid_channels: Optional[int] = None): super().__init__() mid_channels = in_channels if mid_channels is None else mid_channels resnets = [ ResConvBlock(2 * in_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, out_channels), ] self.resnets = nn.ModuleList(resnets) self.up = Upsample1d(kernel="cubic") def forward( self, hidden_states: torch.FloatTensor, res_hidden_states_tuple: Tuple[torch.FloatTensor, ...], temb: Optional[torch.FloatTensor] = None, ) -> torch.FloatTensor: res_hidden_states = res_hidden_states_tuple[-1] hidden_states = torch.cat([hidden_states, res_hidden_states], dim=1) for resnet in self.resnets: hidden_states = resnet(hidden_states) hidden_states = self.up(hidden_states) return hidden_states class UpBlock1DNoSkip(nn.Module): def __init__(self, in_channels: int, out_channels: int, mid_channels: Optional[int] = None): super().__init__() mid_channels = in_channels if mid_channels is None else mid_channels resnets = [ ResConvBlock(2 * in_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, mid_channels), ResConvBlock(mid_channels, mid_channels, out_channels, is_last=True), ] self.resnets = nn.ModuleList(resnets) def forward( self, hidden_states: torch.FloatTensor, res_hidden_states_tuple: Tuple[torch.FloatTensor, ...], temb: Optional[torch.FloatTensor] = None, ) -> torch.FloatTensor: res_hidden_states = res_hidden_states_tuple[-1] hidden_states = torch.cat([hidden_states, res_hidden_states], dim=1) for resnet in self.resnets: hidden_states = resnet(hidden_states) return hidden_states DownBlockType = Union[DownResnetBlock1D, DownBlock1D, AttnDownBlock1D, DownBlock1DNoSkip] MidBlockType = Union[MidResTemporalBlock1D, ValueFunctionMidBlock1D, UNetMidBlock1D] OutBlockType = Union[OutConv1DBlock, OutValueFunctionBlock] UpBlockType = Union[UpResnetBlock1D, UpBlock1D, AttnUpBlock1D, UpBlock1DNoSkip] def get_down_block( down_block_type: str, num_layers: int, in_channels: int, out_channels: int, temb_channels: int, add_downsample: bool, ) -> DownBlockType: if down_block_type == "DownResnetBlock1D": return DownResnetBlock1D( in_channels=in_channels, num_layers=num_layers, out_channels=out_channels, temb_channels=temb_channels, add_downsample=add_downsample, ) elif down_block_type == "DownBlock1D": return DownBlock1D(out_channels=out_channels, in_channels=in_channels) elif down_block_type == "AttnDownBlock1D": return AttnDownBlock1D(out_channels=out_channels, in_channels=in_channels) elif down_block_type == "DownBlock1DNoSkip": return DownBlock1DNoSkip(out_channels=out_channels, in_channels=in_channels) raise ValueError(f"{down_block_type} does not exist.") def get_up_block( up_block_type: str, num_layers: int, in_channels: int, out_channels: int, temb_channels: int, add_upsample: bool ) -> UpBlockType: if up_block_type == "UpResnetBlock1D": return UpResnetBlock1D( in_channels=in_channels, num_layers=num_layers, out_channels=out_channels, temb_channels=temb_channels, add_upsample=add_upsample, ) elif up_block_type == "UpBlock1D": return UpBlock1D(in_channels=in_channels, out_channels=out_channels) elif up_block_type == "AttnUpBlock1D": return AttnUpBlock1D(in_channels=in_channels, out_channels=out_channels) elif up_block_type == "UpBlock1DNoSkip": return UpBlock1DNoSkip(in_channels=in_channels, out_channels=out_channels) raise ValueError(f"{up_block_type} does not exist.") def get_mid_block( mid_block_type: str, num_layers: int, in_channels: int, mid_channels: int, out_channels: int, embed_dim: int, add_downsample: bool, ) -> MidBlockType: if mid_block_type == "MidResTemporalBlock1D": return MidResTemporalBlock1D( num_layers=num_layers, in_channels=in_channels, out_channels=out_channels, embed_dim=embed_dim, add_downsample=add_downsample, ) elif mid_block_type == "ValueFunctionMidBlock1D": return ValueFunctionMidBlock1D(in_channels=in_channels, out_channels=out_channels, embed_dim=embed_dim) elif mid_block_type == "UNetMidBlock1D": return UNetMidBlock1D(in_channels=in_channels, mid_channels=mid_channels, out_channels=out_channels) raise ValueError(f"{mid_block_type} does not exist.") def get_out_block( *, out_block_type: str, num_groups_out: int, embed_dim: int, out_channels: int, act_fn: str, fc_dim: int ) -> Optional[OutBlockType]: if out_block_type == "OutConv1DBlock": return OutConv1DBlock(num_groups_out, out_channels, embed_dim, act_fn) elif out_block_type == "ValueFunction": return OutValueFunctionBlock(fc_dim, embed_dim, act_fn) return None
diffusers/src/diffusers/models/unets/unet_1d_blocks.py/0
{ "file_path": "diffusers/src/diffusers/models/unets/unet_1d_blocks.py", "repo_id": "diffusers", "token_count": 12024 }
113
# coding=utf-8 # Copyright 2023 The HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """PyTorch optimization for diffusion models.""" import math from enum import Enum from typing import Optional, Union from torch.optim import Optimizer from torch.optim.lr_scheduler import LambdaLR from .utils import logging logger = logging.get_logger(__name__) class SchedulerType(Enum): LINEAR = "linear" COSINE = "cosine" COSINE_WITH_RESTARTS = "cosine_with_restarts" POLYNOMIAL = "polynomial" CONSTANT = "constant" CONSTANT_WITH_WARMUP = "constant_with_warmup" PIECEWISE_CONSTANT = "piecewise_constant" def get_constant_schedule(optimizer: Optimizer, last_epoch: int = -1) -> LambdaLR: """ Create a schedule with a constant learning rate, using the learning rate set in optimizer. Args: optimizer ([`~torch.optim.Optimizer`]): The optimizer for which to schedule the learning rate. last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. Return: `torch.optim.lr_scheduler.LambdaLR` with the appropriate schedule. """ return LambdaLR(optimizer, lambda _: 1, last_epoch=last_epoch) def get_constant_schedule_with_warmup(optimizer: Optimizer, num_warmup_steps: int, last_epoch: int = -1) -> LambdaLR: """ Create a schedule with a constant learning rate preceded by a warmup period during which the learning rate increases linearly between 0 and the initial lr set in the optimizer. Args: optimizer ([`~torch.optim.Optimizer`]): The optimizer for which to schedule the learning rate. num_warmup_steps (`int`): The number of steps for the warmup phase. last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. Return: `torch.optim.lr_scheduler.LambdaLR` with the appropriate schedule. """ def lr_lambda(current_step: int): if current_step < num_warmup_steps: return float(current_step) / float(max(1.0, num_warmup_steps)) return 1.0 return LambdaLR(optimizer, lr_lambda, last_epoch=last_epoch) def get_piecewise_constant_schedule(optimizer: Optimizer, step_rules: str, last_epoch: int = -1) -> LambdaLR: """ Create a schedule with a constant learning rate, using the learning rate set in optimizer. Args: optimizer ([`~torch.optim.Optimizer`]): The optimizer for which to schedule the learning rate. step_rules (`string`): The rules for the learning rate. ex: rule_steps="1:10,0.1:20,0.01:30,0.005" it means that the learning rate if multiple 1 for the first 10 steps, mutiple 0.1 for the next 20 steps, multiple 0.01 for the next 30 steps and multiple 0.005 for the other steps. last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. Return: `torch.optim.lr_scheduler.LambdaLR` with the appropriate schedule. """ rules_dict = {} rule_list = step_rules.split(",") for rule_str in rule_list[:-1]: value_str, steps_str = rule_str.split(":") steps = int(steps_str) value = float(value_str) rules_dict[steps] = value last_lr_multiple = float(rule_list[-1]) def create_rules_function(rules_dict, last_lr_multiple): def rule_func(steps: int) -> float: sorted_steps = sorted(rules_dict.keys()) for i, sorted_step in enumerate(sorted_steps): if steps < sorted_step: return rules_dict[sorted_steps[i]] return last_lr_multiple return rule_func rules_func = create_rules_function(rules_dict, last_lr_multiple) return LambdaLR(optimizer, rules_func, last_epoch=last_epoch) def get_linear_schedule_with_warmup( optimizer: Optimizer, num_warmup_steps: int, num_training_steps: int, last_epoch: int = -1 ) -> LambdaLR: """ Create a schedule with a learning rate that decreases linearly from the initial lr set in the optimizer to 0, after a warmup period during which it increases linearly from 0 to the initial lr set in the optimizer. Args: optimizer ([`~torch.optim.Optimizer`]): The optimizer for which to schedule the learning rate. num_warmup_steps (`int`): The number of steps for the warmup phase. num_training_steps (`int`): The total number of training steps. last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. Return: `torch.optim.lr_scheduler.LambdaLR` with the appropriate schedule. """ def lr_lambda(current_step: int): if current_step < num_warmup_steps: return float(current_step) / float(max(1, num_warmup_steps)) return max( 0.0, float(num_training_steps - current_step) / float(max(1, num_training_steps - num_warmup_steps)) ) return LambdaLR(optimizer, lr_lambda, last_epoch) def get_cosine_schedule_with_warmup( optimizer: Optimizer, num_warmup_steps: int, num_training_steps: int, num_cycles: float = 0.5, last_epoch: int = -1 ) -> LambdaLR: """ Create a schedule with a learning rate that decreases following the values of the cosine function between the initial lr set in the optimizer to 0, after a warmup period during which it increases linearly between 0 and the initial lr set in the optimizer. Args: optimizer ([`~torch.optim.Optimizer`]): The optimizer for which to schedule the learning rate. num_warmup_steps (`int`): The number of steps for the warmup phase. num_training_steps (`int`): The total number of training steps. num_periods (`float`, *optional*, defaults to 0.5): The number of periods of the cosine function in a schedule (the default is to just decrease from the max value to 0 following a half-cosine). last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. Return: `torch.optim.lr_scheduler.LambdaLR` with the appropriate schedule. """ def lr_lambda(current_step): if current_step < num_warmup_steps: return float(current_step) / float(max(1, num_warmup_steps)) progress = float(current_step - num_warmup_steps) / float(max(1, num_training_steps - num_warmup_steps)) return max(0.0, 0.5 * (1.0 + math.cos(math.pi * float(num_cycles) * 2.0 * progress))) return LambdaLR(optimizer, lr_lambda, last_epoch) def get_cosine_with_hard_restarts_schedule_with_warmup( optimizer: Optimizer, num_warmup_steps: int, num_training_steps: int, num_cycles: int = 1, last_epoch: int = -1 ) -> LambdaLR: """ Create a schedule with a learning rate that decreases following the values of the cosine function between the initial lr set in the optimizer to 0, with several hard restarts, after a warmup period during which it increases linearly between 0 and the initial lr set in the optimizer. Args: optimizer ([`~torch.optim.Optimizer`]): The optimizer for which to schedule the learning rate. num_warmup_steps (`int`): The number of steps for the warmup phase. num_training_steps (`int`): The total number of training steps. num_cycles (`int`, *optional*, defaults to 1): The number of hard restarts to use. last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. Return: `torch.optim.lr_scheduler.LambdaLR` with the appropriate schedule. """ def lr_lambda(current_step): if current_step < num_warmup_steps: return float(current_step) / float(max(1, num_warmup_steps)) progress = float(current_step - num_warmup_steps) / float(max(1, num_training_steps - num_warmup_steps)) if progress >= 1.0: return 0.0 return max(0.0, 0.5 * (1.0 + math.cos(math.pi * ((float(num_cycles) * progress) % 1.0)))) return LambdaLR(optimizer, lr_lambda, last_epoch) def get_polynomial_decay_schedule_with_warmup( optimizer: Optimizer, num_warmup_steps: int, num_training_steps: int, lr_end: float = 1e-7, power: float = 1.0, last_epoch: int = -1, ) -> LambdaLR: """ Create a schedule with a learning rate that decreases as a polynomial decay from the initial lr set in the optimizer to end lr defined by *lr_end*, after a warmup period during which it increases linearly from 0 to the initial lr set in the optimizer. Args: optimizer ([`~torch.optim.Optimizer`]): The optimizer for which to schedule the learning rate. num_warmup_steps (`int`): The number of steps for the warmup phase. num_training_steps (`int`): The total number of training steps. lr_end (`float`, *optional*, defaults to 1e-7): The end LR. power (`float`, *optional*, defaults to 1.0): Power factor. last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. Note: *power* defaults to 1.0 as in the fairseq implementation, which in turn is based on the original BERT implementation at https://github.com/google-research/bert/blob/f39e881b169b9d53bea03d2d341b31707a6c052b/optimization.py#L37 Return: `torch.optim.lr_scheduler.LambdaLR` with the appropriate schedule. """ lr_init = optimizer.defaults["lr"] if not (lr_init > lr_end): raise ValueError(f"lr_end ({lr_end}) must be be smaller than initial lr ({lr_init})") def lr_lambda(current_step: int): if current_step < num_warmup_steps: return float(current_step) / float(max(1, num_warmup_steps)) elif current_step > num_training_steps: return lr_end / lr_init # as LambdaLR multiplies by lr_init else: lr_range = lr_init - lr_end decay_steps = num_training_steps - num_warmup_steps pct_remaining = 1 - (current_step - num_warmup_steps) / decay_steps decay = lr_range * pct_remaining**power + lr_end return decay / lr_init # as LambdaLR multiplies by lr_init return LambdaLR(optimizer, lr_lambda, last_epoch) TYPE_TO_SCHEDULER_FUNCTION = { SchedulerType.LINEAR: get_linear_schedule_with_warmup, SchedulerType.COSINE: get_cosine_schedule_with_warmup, SchedulerType.COSINE_WITH_RESTARTS: get_cosine_with_hard_restarts_schedule_with_warmup, SchedulerType.POLYNOMIAL: get_polynomial_decay_schedule_with_warmup, SchedulerType.CONSTANT: get_constant_schedule, SchedulerType.CONSTANT_WITH_WARMUP: get_constant_schedule_with_warmup, SchedulerType.PIECEWISE_CONSTANT: get_piecewise_constant_schedule, } def get_scheduler( name: Union[str, SchedulerType], optimizer: Optimizer, step_rules: Optional[str] = None, num_warmup_steps: Optional[int] = None, num_training_steps: Optional[int] = None, num_cycles: int = 1, power: float = 1.0, last_epoch: int = -1, ) -> LambdaLR: """ Unified API to get any scheduler from its name. Args: name (`str` or `SchedulerType`): The name of the scheduler to use. optimizer (`torch.optim.Optimizer`): The optimizer that will be used during training. step_rules (`str`, *optional*): A string representing the step rules to use. This is only used by the `PIECEWISE_CONSTANT` scheduler. num_warmup_steps (`int`, *optional*): The number of warmup steps to do. This is not required by all schedulers (hence the argument being optional), the function will raise an error if it's unset and the scheduler type requires it. num_training_steps (`int``, *optional*): The number of training steps to do. This is not required by all schedulers (hence the argument being optional), the function will raise an error if it's unset and the scheduler type requires it. num_cycles (`int`, *optional*): The number of hard restarts used in `COSINE_WITH_RESTARTS` scheduler. power (`float`, *optional*, defaults to 1.0): Power factor. See `POLYNOMIAL` scheduler last_epoch (`int`, *optional*, defaults to -1): The index of the last epoch when resuming training. """ name = SchedulerType(name) schedule_func = TYPE_TO_SCHEDULER_FUNCTION[name] if name == SchedulerType.CONSTANT: return schedule_func(optimizer, last_epoch=last_epoch) if name == SchedulerType.PIECEWISE_CONSTANT: return schedule_func(optimizer, step_rules=step_rules, last_epoch=last_epoch) # All other schedulers require `num_warmup_steps` if num_warmup_steps is None: raise ValueError(f"{name} requires `num_warmup_steps`, please provide that argument.") if name == SchedulerType.CONSTANT_WITH_WARMUP: return schedule_func(optimizer, num_warmup_steps=num_warmup_steps, last_epoch=last_epoch) # All other schedulers require `num_training_steps` if num_training_steps is None: raise ValueError(f"{name} requires `num_training_steps`, please provide that argument.") if name == SchedulerType.COSINE_WITH_RESTARTS: return schedule_func( optimizer, num_warmup_steps=num_warmup_steps, num_training_steps=num_training_steps, num_cycles=num_cycles, last_epoch=last_epoch, ) if name == SchedulerType.POLYNOMIAL: return schedule_func( optimizer, num_warmup_steps=num_warmup_steps, num_training_steps=num_training_steps, power=power, last_epoch=last_epoch, ) return schedule_func( optimizer, num_warmup_steps=num_warmup_steps, num_training_steps=num_training_steps, last_epoch=last_epoch )
diffusers/src/diffusers/optimization.py/0
{ "file_path": "diffusers/src/diffusers/optimization.py", "repo_id": "diffusers", "token_count": 5888 }
114
# coding=utf-8 # Copyright 2023 The HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import inspect from collections import OrderedDict from huggingface_hub.utils import validate_hf_hub_args from ..configuration_utils import ConfigMixin from .controlnet import ( StableDiffusionControlNetImg2ImgPipeline, StableDiffusionControlNetInpaintPipeline, StableDiffusionControlNetPipeline, StableDiffusionXLControlNetImg2ImgPipeline, StableDiffusionXLControlNetInpaintPipeline, StableDiffusionXLControlNetPipeline, ) from .deepfloyd_if import IFImg2ImgPipeline, IFInpaintingPipeline, IFPipeline from .kandinsky import ( KandinskyCombinedPipeline, KandinskyImg2ImgCombinedPipeline, KandinskyImg2ImgPipeline, KandinskyInpaintCombinedPipeline, KandinskyInpaintPipeline, KandinskyPipeline, ) from .kandinsky2_2 import ( KandinskyV22CombinedPipeline, KandinskyV22Img2ImgCombinedPipeline, KandinskyV22Img2ImgPipeline, KandinskyV22InpaintCombinedPipeline, KandinskyV22InpaintPipeline, KandinskyV22Pipeline, ) from .kandinsky3 import Kandinsky3Img2ImgPipeline, Kandinsky3Pipeline from .latent_consistency_models import LatentConsistencyModelImg2ImgPipeline, LatentConsistencyModelPipeline from .pixart_alpha import PixArtAlphaPipeline from .stable_diffusion import ( StableDiffusionImg2ImgPipeline, StableDiffusionInpaintPipeline, StableDiffusionPipeline, ) from .stable_diffusion_xl import ( StableDiffusionXLImg2ImgPipeline, StableDiffusionXLInpaintPipeline, StableDiffusionXLPipeline, ) from .wuerstchen import WuerstchenCombinedPipeline, WuerstchenDecoderPipeline AUTO_TEXT2IMAGE_PIPELINES_MAPPING = OrderedDict( [ ("stable-diffusion", StableDiffusionPipeline), ("stable-diffusion-xl", StableDiffusionXLPipeline), ("if", IFPipeline), ("kandinsky", KandinskyCombinedPipeline), ("kandinsky22", KandinskyV22CombinedPipeline), ("kandinsky3", Kandinsky3Pipeline), ("stable-diffusion-controlnet", StableDiffusionControlNetPipeline), ("stable-diffusion-xl-controlnet", StableDiffusionXLControlNetPipeline), ("wuerstchen", WuerstchenCombinedPipeline), ("lcm", LatentConsistencyModelPipeline), ("pixart", PixArtAlphaPipeline), ] ) AUTO_IMAGE2IMAGE_PIPELINES_MAPPING = OrderedDict( [ ("stable-diffusion", StableDiffusionImg2ImgPipeline), ("stable-diffusion-xl", StableDiffusionXLImg2ImgPipeline), ("if", IFImg2ImgPipeline), ("kandinsky", KandinskyImg2ImgCombinedPipeline), ("kandinsky22", KandinskyV22Img2ImgCombinedPipeline), ("kandinsky3", Kandinsky3Img2ImgPipeline), ("stable-diffusion-controlnet", StableDiffusionControlNetImg2ImgPipeline), ("stable-diffusion-xl-controlnet", StableDiffusionXLControlNetImg2ImgPipeline), ("lcm", LatentConsistencyModelImg2ImgPipeline), ] ) AUTO_INPAINT_PIPELINES_MAPPING = OrderedDict( [ ("stable-diffusion", StableDiffusionInpaintPipeline), ("stable-diffusion-xl", StableDiffusionXLInpaintPipeline), ("if", IFInpaintingPipeline), ("kandinsky", KandinskyInpaintCombinedPipeline), ("kandinsky22", KandinskyV22InpaintCombinedPipeline), ("stable-diffusion-controlnet", StableDiffusionControlNetInpaintPipeline), ("stable-diffusion-xl-controlnet", StableDiffusionXLControlNetInpaintPipeline), ] ) _AUTO_TEXT2IMAGE_DECODER_PIPELINES_MAPPING = OrderedDict( [ ("kandinsky", KandinskyPipeline), ("kandinsky22", KandinskyV22Pipeline), ("wuerstchen", WuerstchenDecoderPipeline), ] ) _AUTO_IMAGE2IMAGE_DECODER_PIPELINES_MAPPING = OrderedDict( [ ("kandinsky", KandinskyImg2ImgPipeline), ("kandinsky22", KandinskyV22Img2ImgPipeline), ] ) _AUTO_INPAINT_DECODER_PIPELINES_MAPPING = OrderedDict( [ ("kandinsky", KandinskyInpaintPipeline), ("kandinsky22", KandinskyV22InpaintPipeline), ] ) SUPPORTED_TASKS_MAPPINGS = [ AUTO_TEXT2IMAGE_PIPELINES_MAPPING, AUTO_IMAGE2IMAGE_PIPELINES_MAPPING, AUTO_INPAINT_PIPELINES_MAPPING, _AUTO_TEXT2IMAGE_DECODER_PIPELINES_MAPPING, _AUTO_IMAGE2IMAGE_DECODER_PIPELINES_MAPPING, _AUTO_INPAINT_DECODER_PIPELINES_MAPPING, ] def _get_connected_pipeline(pipeline_cls): # for now connected pipelines can only be loaded from decoder pipelines, such as kandinsky-community/kandinsky-2-2-decoder if pipeline_cls in _AUTO_TEXT2IMAGE_DECODER_PIPELINES_MAPPING.values(): return _get_task_class( AUTO_TEXT2IMAGE_PIPELINES_MAPPING, pipeline_cls.__name__, throw_error_if_not_exist=False ) if pipeline_cls in _AUTO_IMAGE2IMAGE_DECODER_PIPELINES_MAPPING.values(): return _get_task_class( AUTO_IMAGE2IMAGE_PIPELINES_MAPPING, pipeline_cls.__name__, throw_error_if_not_exist=False ) if pipeline_cls in _AUTO_INPAINT_DECODER_PIPELINES_MAPPING.values(): return _get_task_class(AUTO_INPAINT_PIPELINES_MAPPING, pipeline_cls.__name__, throw_error_if_not_exist=False) def _get_task_class(mapping, pipeline_class_name, throw_error_if_not_exist: bool = True): def get_model(pipeline_class_name): for task_mapping in SUPPORTED_TASKS_MAPPINGS: for model_name, pipeline in task_mapping.items(): if pipeline.__name__ == pipeline_class_name: return model_name model_name = get_model(pipeline_class_name) if model_name is not None: task_class = mapping.get(model_name, None) if task_class is not None: return task_class if throw_error_if_not_exist: raise ValueError(f"AutoPipeline can't find a pipeline linked to {pipeline_class_name} for {model_name}") def _get_signature_keys(obj): parameters = inspect.signature(obj.__init__).parameters required_parameters = {k: v for k, v in parameters.items() if v.default == inspect._empty} optional_parameters = set({k for k, v in parameters.items() if v.default != inspect._empty}) expected_modules = set(required_parameters.keys()) - {"self"} return expected_modules, optional_parameters class AutoPipelineForText2Image(ConfigMixin): r""" [`AutoPipelineForText2Image`] is a generic pipeline class that instantiates a text-to-image pipeline class. The specific underlying pipeline class is automatically selected from either the [`~AutoPipelineForText2Image.from_pretrained`] or [`~AutoPipelineForText2Image.from_pipe`] methods. This class cannot be instantiated using `__init__()` (throws an error). Class attributes: - **config_name** (`str`) -- The configuration filename that stores the class and module names of all the diffusion pipeline's components. """ config_name = "model_index.json" def __init__(self, *args, **kwargs): raise EnvironmentError( f"{self.__class__.__name__} is designed to be instantiated " f"using the `{self.__class__.__name__}.from_pretrained(pretrained_model_name_or_path)` or " f"`{self.__class__.__name__}.from_pipe(pipeline)` methods." ) @classmethod @validate_hf_hub_args def from_pretrained(cls, pretrained_model_or_path, **kwargs): r""" Instantiates a text-to-image Pytorch diffusion pipeline from pretrained pipeline weight. The from_pretrained() method takes care of returning the correct pipeline class instance by: 1. Detect the pipeline class of the pretrained_model_or_path based on the _class_name property of its config object 2. Find the text-to-image pipeline linked to the pipeline class using pattern matching on pipeline class name. If a `controlnet` argument is passed, it will instantiate a [`StableDiffusionControlNetPipeline`] object. The pipeline is set in evaluation mode (`model.eval()`) by default. If you get the error message below, you need to finetune the weights for your downstream task: ``` Some weights of UNet2DConditionModel were not initialized from the model checkpoint at runwayml/stable-diffusion-v1-5 and are newly initialized because the shapes did not match: - conv_in.weight: found shape torch.Size([320, 4, 3, 3]) in the checkpoint and torch.Size([320, 9, 3, 3]) in the model instantiated You should probably TRAIN this model on a down-stream task to be able to use it for predictions and inference. ``` Parameters: pretrained_model_name_or_path (`str` or `os.PathLike`, *optional*): Can be either: - A string, the *repo id* (for example `CompVis/ldm-text2im-large-256`) of a pretrained pipeline hosted on the Hub. - A path to a *directory* (for example `./my_pipeline_directory/`) containing pipeline weights saved using [`~DiffusionPipeline.save_pretrained`]. torch_dtype (`str` or `torch.dtype`, *optional*): Override the default `torch.dtype` and load the model with another dtype. If "auto" is passed, the dtype is automatically derived from the model's weights. force_download (`bool`, *optional*, defaults to `False`): Whether or not to force the (re-)download of the model weights and configuration files, overriding the cached versions if they exist. cache_dir (`Union[str, os.PathLike]`, *optional*): Path to a directory where a downloaded pretrained model configuration is cached if the standard cache is not used. resume_download (`bool`, *optional*, defaults to `False`): Whether or not to resume downloading the model weights and configuration files. If set to `False`, any incompletely downloaded files are deleted. proxies (`Dict[str, str]`, *optional*): A dictionary of proxy servers to use by protocol or endpoint, for example, `{'http': 'foo.bar:3128', 'http://hostname': 'foo.bar:4012'}`. The proxies are used on each request. output_loading_info(`bool`, *optional*, defaults to `False`): Whether or not to also return a dictionary containing missing keys, unexpected keys and error messages. local_files_only (`bool`, *optional*, defaults to `False`): Whether to only load local model weights and configuration files or not. If set to `True`, the model won't be downloaded from the Hub. token (`str` or *bool*, *optional*): The token to use as HTTP bearer authorization for remote files. If `True`, the token generated from `diffusers-cli login` (stored in `~/.huggingface`) is used. revision (`str`, *optional*, defaults to `"main"`): The specific model version to use. It can be a branch name, a tag name, a commit id, or any identifier allowed by Git. custom_revision (`str`, *optional*, defaults to `"main"`): The specific model version to use. It can be a branch name, a tag name, or a commit id similar to `revision` when loading a custom pipeline from the Hub. It can be a ๐Ÿค— Diffusers version when loading a custom pipeline from GitHub, otherwise it defaults to `"main"` when loading from the Hub. mirror (`str`, *optional*): Mirror source to resolve accessibility issues if youโ€™re downloading a model in China. We do not guarantee the timeliness or safety of the source, and you should refer to the mirror site for more information. device_map (`str` or `Dict[str, Union[int, str, torch.device]]`, *optional*): A map that specifies where each submodule should go. It doesnโ€™t need to be defined for each parameter/buffer name; once a given module name is inside, every submodule of it will be sent to the same device. Set `device_map="auto"` to have ๐Ÿค— Accelerate automatically compute the most optimized `device_map`. For more information about each option see [designing a device map](https://hf.co/docs/accelerate/main/en/usage_guides/big_modeling#designing-a-device-map). max_memory (`Dict`, *optional*): A dictionary device identifier for the maximum memory. Will default to the maximum memory available for each GPU and the available CPU RAM if unset. offload_folder (`str` or `os.PathLike`, *optional*): The path to offload weights if device_map contains the value `"disk"`. offload_state_dict (`bool`, *optional*): If `True`, temporarily offloads the CPU state dict to the hard drive to avoid running out of CPU RAM if the weight of the CPU state dict + the biggest shard of the checkpoint does not fit. Defaults to `True` when there is some disk offload. low_cpu_mem_usage (`bool`, *optional*, defaults to `True` if torch version >= 1.9.0 else `False`): Speed up model loading only loading the pretrained weights and not initializing the weights. This also tries to not use more than 1x model size in CPU memory (including peak memory) while loading the model. Only supported for PyTorch >= 1.9.0. If you are using an older version of PyTorch, setting this argument to `True` will raise an error. use_safetensors (`bool`, *optional*, defaults to `None`): If set to `None`, the safetensors weights are downloaded if they're available **and** if the safetensors library is installed. If set to `True`, the model is forcibly loaded from safetensors weights. If set to `False`, safetensors weights are not loaded. kwargs (remaining dictionary of keyword arguments, *optional*): Can be used to overwrite load and saveable variables (the pipeline components of the specific pipeline class). The overwritten components are passed directly to the pipelines `__init__` method. See example below for more information. variant (`str`, *optional*): Load weights from a specified variant filename such as `"fp16"` or `"ema"`. This is ignored when loading `from_flax`. <Tip> To use private or [gated](https://huggingface.co/docs/hub/models-gated#gated-models) models, log-in with `huggingface-cli login`. </Tip> Examples: ```py >>> from diffusers import AutoPipelineForText2Image >>> pipeline = AutoPipelineForText2Image.from_pretrained("runwayml/stable-diffusion-v1-5") >>> image = pipeline(prompt).images[0] ``` """ cache_dir = kwargs.pop("cache_dir", None) force_download = kwargs.pop("force_download", False) resume_download = kwargs.pop("resume_download", False) proxies = kwargs.pop("proxies", None) token = kwargs.pop("token", None) local_files_only = kwargs.pop("local_files_only", False) revision = kwargs.pop("revision", None) load_config_kwargs = { "cache_dir": cache_dir, "force_download": force_download, "resume_download": resume_download, "proxies": proxies, "token": token, "local_files_only": local_files_only, "revision": revision, } config = cls.load_config(pretrained_model_or_path, **load_config_kwargs) orig_class_name = config["_class_name"] if "controlnet" in kwargs: orig_class_name = config["_class_name"].replace("Pipeline", "ControlNetPipeline") text_2_image_cls = _get_task_class(AUTO_TEXT2IMAGE_PIPELINES_MAPPING, orig_class_name) kwargs = {**load_config_kwargs, **kwargs} return text_2_image_cls.from_pretrained(pretrained_model_or_path, **kwargs) @classmethod def from_pipe(cls, pipeline, **kwargs): r""" Instantiates a text-to-image Pytorch diffusion pipeline from another instantiated diffusion pipeline class. The from_pipe() method takes care of returning the correct pipeline class instance by finding the text-to-image pipeline linked to the pipeline class using pattern matching on pipeline class name. All the modules the pipeline contains will be used to initialize the new pipeline without reallocating additional memoery. The pipeline is set in evaluation mode (`model.eval()`) by default. Parameters: pipeline (`DiffusionPipeline`): an instantiated `DiffusionPipeline` object ```py >>> from diffusers import AutoPipelineForText2Image, AutoPipelineForImage2Image >>> pipe_i2i = AutoPipelineForImage2Image.from_pretrained( ... "runwayml/stable-diffusion-v1-5", requires_safety_checker=False ... ) >>> pipe_t2i = AutoPipelineForText2Image.from_pipe(pipe_i2i) >>> image = pipe_t2i(prompt).images[0] ``` """ original_config = dict(pipeline.config) original_cls_name = pipeline.__class__.__name__ # derive the pipeline class to instantiate text_2_image_cls = _get_task_class(AUTO_TEXT2IMAGE_PIPELINES_MAPPING, original_cls_name) if "controlnet" in kwargs: if kwargs["controlnet"] is not None: text_2_image_cls = _get_task_class( AUTO_TEXT2IMAGE_PIPELINES_MAPPING, text_2_image_cls.__name__.replace("ControlNet", "").replace("Pipeline", "ControlNetPipeline"), ) else: text_2_image_cls = _get_task_class( AUTO_TEXT2IMAGE_PIPELINES_MAPPING, text_2_image_cls.__name__.replace("ControlNetPipeline", "Pipeline"), ) # define expected module and optional kwargs given the pipeline signature expected_modules, optional_kwargs = _get_signature_keys(text_2_image_cls) pretrained_model_name_or_path = original_config.pop("_name_or_path", None) # allow users pass modules in `kwargs` to override the original pipeline's components passed_class_obj = {k: kwargs.pop(k) for k in expected_modules if k in kwargs} original_class_obj = { k: pipeline.components[k] for k, v in pipeline.components.items() if k in expected_modules and k not in passed_class_obj } # allow users pass optional kwargs to override the original pipelines config attribute passed_pipe_kwargs = {k: kwargs.pop(k) for k in optional_kwargs if k in kwargs} original_pipe_kwargs = { k: original_config[k] for k, v in original_config.items() if k in optional_kwargs and k not in passed_pipe_kwargs } # config that were not expected by original pipeline is stored as private attribute # we will pass them as optional arguments if they can be accepted by the pipeline additional_pipe_kwargs = [ k[1:] for k in original_config.keys() if k.startswith("_") and k[1:] in optional_kwargs and k[1:] not in passed_pipe_kwargs ] for k in additional_pipe_kwargs: original_pipe_kwargs[k] = original_config.pop(f"_{k}") text_2_image_kwargs = {**passed_class_obj, **original_class_obj, **passed_pipe_kwargs, **original_pipe_kwargs} # store unused config as private attribute unused_original_config = { f"{'' if k.startswith('_') else '_'}{k}": original_config[k] for k, v in original_config.items() if k not in text_2_image_kwargs } missing_modules = set(expected_modules) - set(pipeline._optional_components) - set(text_2_image_kwargs.keys()) if len(missing_modules) > 0: raise ValueError( f"Pipeline {text_2_image_cls} expected {expected_modules}, but only {set(list(passed_class_obj.keys()) + list(original_class_obj.keys()))} were passed" ) model = text_2_image_cls(**text_2_image_kwargs) model.register_to_config(_name_or_path=pretrained_model_name_or_path) model.register_to_config(**unused_original_config) return model class AutoPipelineForImage2Image(ConfigMixin): r""" [`AutoPipelineForImage2Image`] is a generic pipeline class that instantiates an image-to-image pipeline class. The specific underlying pipeline class is automatically selected from either the [`~AutoPipelineForImage2Image.from_pretrained`] or [`~AutoPipelineForImage2Image.from_pipe`] methods. This class cannot be instantiated using `__init__()` (throws an error). Class attributes: - **config_name** (`str`) -- The configuration filename that stores the class and module names of all the diffusion pipeline's components. """ config_name = "model_index.json" def __init__(self, *args, **kwargs): raise EnvironmentError( f"{self.__class__.__name__} is designed to be instantiated " f"using the `{self.__class__.__name__}.from_pretrained(pretrained_model_name_or_path)` or " f"`{self.__class__.__name__}.from_pipe(pipeline)` methods." ) @classmethod @validate_hf_hub_args def from_pretrained(cls, pretrained_model_or_path, **kwargs): r""" Instantiates a image-to-image Pytorch diffusion pipeline from pretrained pipeline weight. The from_pretrained() method takes care of returning the correct pipeline class instance by: 1. Detect the pipeline class of the pretrained_model_or_path based on the _class_name property of its config object 2. Find the image-to-image pipeline linked to the pipeline class using pattern matching on pipeline class name. If a `controlnet` argument is passed, it will instantiate a [`StableDiffusionControlNetImg2ImgPipeline`] object. The pipeline is set in evaluation mode (`model.eval()`) by default. If you get the error message below, you need to finetune the weights for your downstream task: ``` Some weights of UNet2DConditionModel were not initialized from the model checkpoint at runwayml/stable-diffusion-v1-5 and are newly initialized because the shapes did not match: - conv_in.weight: found shape torch.Size([320, 4, 3, 3]) in the checkpoint and torch.Size([320, 9, 3, 3]) in the model instantiated You should probably TRAIN this model on a down-stream task to be able to use it for predictions and inference. ``` Parameters: pretrained_model_name_or_path (`str` or `os.PathLike`, *optional*): Can be either: - A string, the *repo id* (for example `CompVis/ldm-text2im-large-256`) of a pretrained pipeline hosted on the Hub. - A path to a *directory* (for example `./my_pipeline_directory/`) containing pipeline weights saved using [`~DiffusionPipeline.save_pretrained`]. torch_dtype (`str` or `torch.dtype`, *optional*): Override the default `torch.dtype` and load the model with another dtype. If "auto" is passed, the dtype is automatically derived from the model's weights. force_download (`bool`, *optional*, defaults to `False`): Whether or not to force the (re-)download of the model weights and configuration files, overriding the cached versions if they exist. cache_dir (`Union[str, os.PathLike]`, *optional*): Path to a directory where a downloaded pretrained model configuration is cached if the standard cache is not used. resume_download (`bool`, *optional*, defaults to `False`): Whether or not to resume downloading the model weights and configuration files. If set to `False`, any incompletely downloaded files are deleted. proxies (`Dict[str, str]`, *optional*): A dictionary of proxy servers to use by protocol or endpoint, for example, `{'http': 'foo.bar:3128', 'http://hostname': 'foo.bar:4012'}`. The proxies are used on each request. output_loading_info(`bool`, *optional*, defaults to `False`): Whether or not to also return a dictionary containing missing keys, unexpected keys and error messages. local_files_only (`bool`, *optional*, defaults to `False`): Whether to only load local model weights and configuration files or not. If set to `True`, the model won't be downloaded from the Hub. token (`str` or *bool*, *optional*): The token to use as HTTP bearer authorization for remote files. If `True`, the token generated from `diffusers-cli login` (stored in `~/.huggingface`) is used. revision (`str`, *optional*, defaults to `"main"`): The specific model version to use. It can be a branch name, a tag name, a commit id, or any identifier allowed by Git. custom_revision (`str`, *optional*, defaults to `"main"`): The specific model version to use. It can be a branch name, a tag name, or a commit id similar to `revision` when loading a custom pipeline from the Hub. It can be a ๐Ÿค— Diffusers version when loading a custom pipeline from GitHub, otherwise it defaults to `"main"` when loading from the Hub. mirror (`str`, *optional*): Mirror source to resolve accessibility issues if youโ€™re downloading a model in China. We do not guarantee the timeliness or safety of the source, and you should refer to the mirror site for more information. device_map (`str` or `Dict[str, Union[int, str, torch.device]]`, *optional*): A map that specifies where each submodule should go. It doesnโ€™t need to be defined for each parameter/buffer name; once a given module name is inside, every submodule of it will be sent to the same device. Set `device_map="auto"` to have ๐Ÿค— Accelerate automatically compute the most optimized `device_map`. For more information about each option see [designing a device map](https://hf.co/docs/accelerate/main/en/usage_guides/big_modeling#designing-a-device-map). max_memory (`Dict`, *optional*): A dictionary device identifier for the maximum memory. Will default to the maximum memory available for each GPU and the available CPU RAM if unset. offload_folder (`str` or `os.PathLike`, *optional*): The path to offload weights if device_map contains the value `"disk"`. offload_state_dict (`bool`, *optional*): If `True`, temporarily offloads the CPU state dict to the hard drive to avoid running out of CPU RAM if the weight of the CPU state dict + the biggest shard of the checkpoint does not fit. Defaults to `True` when there is some disk offload. low_cpu_mem_usage (`bool`, *optional*, defaults to `True` if torch version >= 1.9.0 else `False`): Speed up model loading only loading the pretrained weights and not initializing the weights. This also tries to not use more than 1x model size in CPU memory (including peak memory) while loading the model. Only supported for PyTorch >= 1.9.0. If you are using an older version of PyTorch, setting this argument to `True` will raise an error. use_safetensors (`bool`, *optional*, defaults to `None`): If set to `None`, the safetensors weights are downloaded if they're available **and** if the safetensors library is installed. If set to `True`, the model is forcibly loaded from safetensors weights. If set to `False`, safetensors weights are not loaded. kwargs (remaining dictionary of keyword arguments, *optional*): Can be used to overwrite load and saveable variables (the pipeline components of the specific pipeline class). The overwritten components are passed directly to the pipelines `__init__` method. See example below for more information. variant (`str`, *optional*): Load weights from a specified variant filename such as `"fp16"` or `"ema"`. This is ignored when loading `from_flax`. <Tip> To use private or [gated](https://huggingface.co/docs/hub/models-gated#gated-models) models, log-in with `huggingface-cli login`. </Tip> Examples: ```py >>> from diffusers import AutoPipelineForImage2Image >>> pipeline = AutoPipelineForImage2Image.from_pretrained("runwayml/stable-diffusion-v1-5") >>> image = pipeline(prompt, image).images[0] ``` """ cache_dir = kwargs.pop("cache_dir", None) force_download = kwargs.pop("force_download", False) resume_download = kwargs.pop("resume_download", False) proxies = kwargs.pop("proxies", None) token = kwargs.pop("token", None) local_files_only = kwargs.pop("local_files_only", False) revision = kwargs.pop("revision", None) load_config_kwargs = { "cache_dir": cache_dir, "force_download": force_download, "resume_download": resume_download, "proxies": proxies, "token": token, "local_files_only": local_files_only, "revision": revision, } config = cls.load_config(pretrained_model_or_path, **load_config_kwargs) orig_class_name = config["_class_name"] if "controlnet" in kwargs: orig_class_name = config["_class_name"].replace("Pipeline", "ControlNetPipeline") image_2_image_cls = _get_task_class(AUTO_IMAGE2IMAGE_PIPELINES_MAPPING, orig_class_name) kwargs = {**load_config_kwargs, **kwargs} return image_2_image_cls.from_pretrained(pretrained_model_or_path, **kwargs) @classmethod def from_pipe(cls, pipeline, **kwargs): r""" Instantiates a image-to-image Pytorch diffusion pipeline from another instantiated diffusion pipeline class. The from_pipe() method takes care of returning the correct pipeline class instance by finding the image-to-image pipeline linked to the pipeline class using pattern matching on pipeline class name. All the modules the pipeline contains will be used to initialize the new pipeline without reallocating additional memoery. The pipeline is set in evaluation mode (`model.eval()`) by default. Parameters: pipeline (`DiffusionPipeline`): an instantiated `DiffusionPipeline` object Examples: ```py >>> from diffusers import AutoPipelineForText2Image, AutoPipelineForImage2Image >>> pipe_t2i = AutoPipelineForText2Image.from_pretrained( ... "runwayml/stable-diffusion-v1-5", requires_safety_checker=False ... ) >>> pipe_i2i = AutoPipelineForImage2Image.from_pipe(pipe_t2i) >>> image = pipe_i2i(prompt, image).images[0] ``` """ original_config = dict(pipeline.config) original_cls_name = pipeline.__class__.__name__ # derive the pipeline class to instantiate image_2_image_cls = _get_task_class(AUTO_IMAGE2IMAGE_PIPELINES_MAPPING, original_cls_name) if "controlnet" in kwargs: if kwargs["controlnet"] is not None: image_2_image_cls = _get_task_class( AUTO_IMAGE2IMAGE_PIPELINES_MAPPING, image_2_image_cls.__name__.replace("ControlNet", "").replace( "Img2ImgPipeline", "ControlNetImg2ImgPipeline" ), ) else: image_2_image_cls = _get_task_class( AUTO_IMAGE2IMAGE_PIPELINES_MAPPING, image_2_image_cls.__name__.replace("ControlNetImg2ImgPipeline", "Img2ImgPipeline"), ) # define expected module and optional kwargs given the pipeline signature expected_modules, optional_kwargs = _get_signature_keys(image_2_image_cls) pretrained_model_name_or_path = original_config.pop("_name_or_path", None) # allow users pass modules in `kwargs` to override the original pipeline's components passed_class_obj = {k: kwargs.pop(k) for k in expected_modules if k in kwargs} original_class_obj = { k: pipeline.components[k] for k, v in pipeline.components.items() if k in expected_modules and k not in passed_class_obj } # allow users pass optional kwargs to override the original pipelines config attribute passed_pipe_kwargs = {k: kwargs.pop(k) for k in optional_kwargs if k in kwargs} original_pipe_kwargs = { k: original_config[k] for k, v in original_config.items() if k in optional_kwargs and k not in passed_pipe_kwargs } # config attribute that were not expected by original pipeline is stored as its private attribute # we will pass them as optional arguments if they can be accepted by the pipeline additional_pipe_kwargs = [ k[1:] for k in original_config.keys() if k.startswith("_") and k[1:] in optional_kwargs and k[1:] not in passed_pipe_kwargs ] for k in additional_pipe_kwargs: original_pipe_kwargs[k] = original_config.pop(f"_{k}") image_2_image_kwargs = {**passed_class_obj, **original_class_obj, **passed_pipe_kwargs, **original_pipe_kwargs} # store unused config as private attribute unused_original_config = { f"{'' if k.startswith('_') else '_'}{k}": original_config[k] for k, v in original_config.items() if k not in image_2_image_kwargs } missing_modules = set(expected_modules) - set(pipeline._optional_components) - set(image_2_image_kwargs.keys()) if len(missing_modules) > 0: raise ValueError( f"Pipeline {image_2_image_cls} expected {expected_modules}, but only {set(list(passed_class_obj.keys()) + list(original_class_obj.keys()))} were passed" ) model = image_2_image_cls(**image_2_image_kwargs) model.register_to_config(_name_or_path=pretrained_model_name_or_path) model.register_to_config(**unused_original_config) return model class AutoPipelineForInpainting(ConfigMixin): r""" [`AutoPipelineForInpainting`] is a generic pipeline class that instantiates an inpainting pipeline class. The specific underlying pipeline class is automatically selected from either the [`~AutoPipelineForInpainting.from_pretrained`] or [`~AutoPipelineForInpainting.from_pipe`] methods. This class cannot be instantiated using `__init__()` (throws an error). Class attributes: - **config_name** (`str`) -- The configuration filename that stores the class and module names of all the diffusion pipeline's components. """ config_name = "model_index.json" def __init__(self, *args, **kwargs): raise EnvironmentError( f"{self.__class__.__name__} is designed to be instantiated " f"using the `{self.__class__.__name__}.from_pretrained(pretrained_model_name_or_path)` or " f"`{self.__class__.__name__}.from_pipe(pipeline)` methods." ) @classmethod @validate_hf_hub_args def from_pretrained(cls, pretrained_model_or_path, **kwargs): r""" Instantiates a inpainting Pytorch diffusion pipeline from pretrained pipeline weight. The from_pretrained() method takes care of returning the correct pipeline class instance by: 1. Detect the pipeline class of the pretrained_model_or_path based on the _class_name property of its config object 2. Find the inpainting pipeline linked to the pipeline class using pattern matching on pipeline class name. If a `controlnet` argument is passed, it will instantiate a [`StableDiffusionControlNetInpaintPipeline`] object. The pipeline is set in evaluation mode (`model.eval()`) by default. If you get the error message below, you need to finetune the weights for your downstream task: ``` Some weights of UNet2DConditionModel were not initialized from the model checkpoint at runwayml/stable-diffusion-v1-5 and are newly initialized because the shapes did not match: - conv_in.weight: found shape torch.Size([320, 4, 3, 3]) in the checkpoint and torch.Size([320, 9, 3, 3]) in the model instantiated You should probably TRAIN this model on a down-stream task to be able to use it for predictions and inference. ``` Parameters: pretrained_model_name_or_path (`str` or `os.PathLike`, *optional*): Can be either: - A string, the *repo id* (for example `CompVis/ldm-text2im-large-256`) of a pretrained pipeline hosted on the Hub. - A path to a *directory* (for example `./my_pipeline_directory/`) containing pipeline weights saved using [`~DiffusionPipeline.save_pretrained`]. torch_dtype (`str` or `torch.dtype`, *optional*): Override the default `torch.dtype` and load the model with another dtype. If "auto" is passed, the dtype is automatically derived from the model's weights. force_download (`bool`, *optional*, defaults to `False`): Whether or not to force the (re-)download of the model weights and configuration files, overriding the cached versions if they exist. cache_dir (`Union[str, os.PathLike]`, *optional*): Path to a directory where a downloaded pretrained model configuration is cached if the standard cache is not used. resume_download (`bool`, *optional*, defaults to `False`): Whether or not to resume downloading the model weights and configuration files. If set to `False`, any incompletely downloaded files are deleted. proxies (`Dict[str, str]`, *optional*): A dictionary of proxy servers to use by protocol or endpoint, for example, `{'http': 'foo.bar:3128', 'http://hostname': 'foo.bar:4012'}`. The proxies are used on each request. output_loading_info(`bool`, *optional*, defaults to `False`): Whether or not to also return a dictionary containing missing keys, unexpected keys and error messages. local_files_only (`bool`, *optional*, defaults to `False`): Whether to only load local model weights and configuration files or not. If set to `True`, the model won't be downloaded from the Hub. token (`str` or *bool*, *optional*): The token to use as HTTP bearer authorization for remote files. If `True`, the token generated from `diffusers-cli login` (stored in `~/.huggingface`) is used. revision (`str`, *optional*, defaults to `"main"`): The specific model version to use. It can be a branch name, a tag name, a commit id, or any identifier allowed by Git. custom_revision (`str`, *optional*, defaults to `"main"`): The specific model version to use. It can be a branch name, a tag name, or a commit id similar to `revision` when loading a custom pipeline from the Hub. It can be a ๐Ÿค— Diffusers version when loading a custom pipeline from GitHub, otherwise it defaults to `"main"` when loading from the Hub. mirror (`str`, *optional*): Mirror source to resolve accessibility issues if youโ€™re downloading a model in China. We do not guarantee the timeliness or safety of the source, and you should refer to the mirror site for more information. device_map (`str` or `Dict[str, Union[int, str, torch.device]]`, *optional*): A map that specifies where each submodule should go. It doesnโ€™t need to be defined for each parameter/buffer name; once a given module name is inside, every submodule of it will be sent to the same device. Set `device_map="auto"` to have ๐Ÿค— Accelerate automatically compute the most optimized `device_map`. For more information about each option see [designing a device map](https://hf.co/docs/accelerate/main/en/usage_guides/big_modeling#designing-a-device-map). max_memory (`Dict`, *optional*): A dictionary device identifier for the maximum memory. Will default to the maximum memory available for each GPU and the available CPU RAM if unset. offload_folder (`str` or `os.PathLike`, *optional*): The path to offload weights if device_map contains the value `"disk"`. offload_state_dict (`bool`, *optional*): If `True`, temporarily offloads the CPU state dict to the hard drive to avoid running out of CPU RAM if the weight of the CPU state dict + the biggest shard of the checkpoint does not fit. Defaults to `True` when there is some disk offload. low_cpu_mem_usage (`bool`, *optional*, defaults to `True` if torch version >= 1.9.0 else `False`): Speed up model loading only loading the pretrained weights and not initializing the weights. This also tries to not use more than 1x model size in CPU memory (including peak memory) while loading the model. Only supported for PyTorch >= 1.9.0. If you are using an older version of PyTorch, setting this argument to `True` will raise an error. use_safetensors (`bool`, *optional*, defaults to `None`): If set to `None`, the safetensors weights are downloaded if they're available **and** if the safetensors library is installed. If set to `True`, the model is forcibly loaded from safetensors weights. If set to `False`, safetensors weights are not loaded. kwargs (remaining dictionary of keyword arguments, *optional*): Can be used to overwrite load and saveable variables (the pipeline components of the specific pipeline class). The overwritten components are passed directly to the pipelines `__init__` method. See example below for more information. variant (`str`, *optional*): Load weights from a specified variant filename such as `"fp16"` or `"ema"`. This is ignored when loading `from_flax`. <Tip> To use private or [gated](https://huggingface.co/docs/hub/models-gated#gated-models) models, log-in with `huggingface-cli login`. </Tip> Examples: ```py >>> from diffusers import AutoPipelineForInpainting >>> pipeline = AutoPipelineForInpainting.from_pretrained("runwayml/stable-diffusion-v1-5") >>> image = pipeline(prompt, image=init_image, mask_image=mask_image).images[0] ``` """ cache_dir = kwargs.pop("cache_dir", None) force_download = kwargs.pop("force_download", False) resume_download = kwargs.pop("resume_download", False) proxies = kwargs.pop("proxies", None) token = kwargs.pop("token", None) local_files_only = kwargs.pop("local_files_only", False) revision = kwargs.pop("revision", None) load_config_kwargs = { "cache_dir": cache_dir, "force_download": force_download, "resume_download": resume_download, "proxies": proxies, "token": token, "local_files_only": local_files_only, "revision": revision, } config = cls.load_config(pretrained_model_or_path, **load_config_kwargs) orig_class_name = config["_class_name"] if "controlnet" in kwargs: orig_class_name = config["_class_name"].replace("Pipeline", "ControlNetPipeline") inpainting_cls = _get_task_class(AUTO_INPAINT_PIPELINES_MAPPING, orig_class_name) kwargs = {**load_config_kwargs, **kwargs} return inpainting_cls.from_pretrained(pretrained_model_or_path, **kwargs) @classmethod def from_pipe(cls, pipeline, **kwargs): r""" Instantiates a inpainting Pytorch diffusion pipeline from another instantiated diffusion pipeline class. The from_pipe() method takes care of returning the correct pipeline class instance by finding the inpainting pipeline linked to the pipeline class using pattern matching on pipeline class name. All the modules the pipeline class contain will be used to initialize the new pipeline without reallocating additional memoery. The pipeline is set in evaluation mode (`model.eval()`) by default. Parameters: pipeline (`DiffusionPipeline`): an instantiated `DiffusionPipeline` object Examples: ```py >>> from diffusers import AutoPipelineForText2Image, AutoPipelineForInpainting >>> pipe_t2i = AutoPipelineForText2Image.from_pretrained( ... "DeepFloyd/IF-I-XL-v1.0", requires_safety_checker=False ... ) >>> pipe_inpaint = AutoPipelineForInpainting.from_pipe(pipe_t2i) >>> image = pipe_inpaint(prompt, image=init_image, mask_image=mask_image).images[0] ``` """ original_config = dict(pipeline.config) original_cls_name = pipeline.__class__.__name__ # derive the pipeline class to instantiate inpainting_cls = _get_task_class(AUTO_INPAINT_PIPELINES_MAPPING, original_cls_name) if "controlnet" in kwargs: if kwargs["controlnet"] is not None: inpainting_cls = _get_task_class( AUTO_INPAINT_PIPELINES_MAPPING, inpainting_cls.__name__.replace("ControlNet", "").replace( "InpaintPipeline", "ControlNetInpaintPipeline" ), ) else: inpainting_cls = _get_task_class( AUTO_INPAINT_PIPELINES_MAPPING, inpainting_cls.__name__.replace("ControlNetInpaintPipeline", "InpaintPipeline"), ) # define expected module and optional kwargs given the pipeline signature expected_modules, optional_kwargs = _get_signature_keys(inpainting_cls) pretrained_model_name_or_path = original_config.pop("_name_or_path", None) # allow users pass modules in `kwargs` to override the original pipeline's components passed_class_obj = {k: kwargs.pop(k) for k in expected_modules if k in kwargs} original_class_obj = { k: pipeline.components[k] for k, v in pipeline.components.items() if k in expected_modules and k not in passed_class_obj } # allow users pass optional kwargs to override the original pipelines config attribute passed_pipe_kwargs = {k: kwargs.pop(k) for k in optional_kwargs if k in kwargs} original_pipe_kwargs = { k: original_config[k] for k, v in original_config.items() if k in optional_kwargs and k not in passed_pipe_kwargs } # config that were not expected by original pipeline is stored as private attribute # we will pass them as optional arguments if they can be accepted by the pipeline additional_pipe_kwargs = [ k[1:] for k in original_config.keys() if k.startswith("_") and k[1:] in optional_kwargs and k[1:] not in passed_pipe_kwargs ] for k in additional_pipe_kwargs: original_pipe_kwargs[k] = original_config.pop(f"_{k}") inpainting_kwargs = {**passed_class_obj, **original_class_obj, **passed_pipe_kwargs, **original_pipe_kwargs} # store unused config as private attribute unused_original_config = { f"{'' if k.startswith('_') else '_'}{k}": original_config[k] for k, v in original_config.items() if k not in inpainting_kwargs } missing_modules = set(expected_modules) - set(pipeline._optional_components) - set(inpainting_kwargs.keys()) if len(missing_modules) > 0: raise ValueError( f"Pipeline {inpainting_cls} expected {expected_modules}, but only {set(list(passed_class_obj.keys()) + list(original_class_obj.keys()))} were passed" ) model = inpainting_cls(**inpainting_kwargs) model.register_to_config(_name_or_path=pretrained_model_name_or_path) model.register_to_config(**unused_original_config) return model
diffusers/src/diffusers/pipelines/auto_pipeline.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/auto_pipeline.py", "repo_id": "diffusers", "token_count": 20667 }
115
# Copyright 2023 The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import inspect from typing import Any, Callable, Dict, List, Optional, Tuple, Union import numpy as np import PIL.Image import torch import torch.nn.functional as F from transformers import ( CLIPImageProcessor, CLIPTextModel, CLIPTextModelWithProjection, CLIPTokenizer, CLIPVisionModelWithProjection, ) from diffusers.utils.import_utils import is_invisible_watermark_available from ...image_processor import PipelineImageInput, VaeImageProcessor from ...loaders import ( IPAdapterMixin, StableDiffusionXLLoraLoaderMixin, TextualInversionLoaderMixin, ) from ...models import AutoencoderKL, ControlNetModel, ImageProjection, UNet2DConditionModel from ...models.attention_processor import ( AttnProcessor2_0, LoRAAttnProcessor2_0, LoRAXFormersAttnProcessor, XFormersAttnProcessor, ) from ...models.lora import adjust_lora_scale_text_encoder from ...schedulers import KarrasDiffusionSchedulers from ...utils import ( USE_PEFT_BACKEND, deprecate, logging, replace_example_docstring, scale_lora_layers, unscale_lora_layers, ) from ...utils.torch_utils import is_compiled_module, randn_tensor from ..pipeline_utils import DiffusionPipeline from ..stable_diffusion_xl.pipeline_output import StableDiffusionXLPipelineOutput if is_invisible_watermark_available(): from ..stable_diffusion_xl.watermark import StableDiffusionXLWatermarker from .multicontrolnet import MultiControlNetModel logger = logging.get_logger(__name__) # pylint: disable=invalid-name EXAMPLE_DOC_STRING = """ Examples: ```py >>> # pip install accelerate transformers safetensors diffusers >>> import torch >>> import numpy as np >>> from PIL import Image >>> from transformers import DPTFeatureExtractor, DPTForDepthEstimation >>> from diffusers import ControlNetModel, StableDiffusionXLControlNetImg2ImgPipeline, AutoencoderKL >>> from diffusers.utils import load_image >>> depth_estimator = DPTForDepthEstimation.from_pretrained("Intel/dpt-hybrid-midas").to("cuda") >>> feature_extractor = DPTFeatureExtractor.from_pretrained("Intel/dpt-hybrid-midas") >>> controlnet = ControlNetModel.from_pretrained( ... "diffusers/controlnet-depth-sdxl-1.0-small", ... variant="fp16", ... use_safetensors=True, ... torch_dtype=torch.float16, ... ).to("cuda") >>> vae = AutoencoderKL.from_pretrained("madebyollin/sdxl-vae-fp16-fix", torch_dtype=torch.float16).to("cuda") >>> pipe = StableDiffusionXLControlNetImg2ImgPipeline.from_pretrained( ... "stabilityai/stable-diffusion-xl-base-1.0", ... controlnet=controlnet, ... vae=vae, ... variant="fp16", ... use_safetensors=True, ... torch_dtype=torch.float16, ... ).to("cuda") >>> pipe.enable_model_cpu_offload() >>> def get_depth_map(image): ... image = feature_extractor(images=image, return_tensors="pt").pixel_values.to("cuda") ... with torch.no_grad(), torch.autocast("cuda"): ... depth_map = depth_estimator(image).predicted_depth ... depth_map = torch.nn.functional.interpolate( ... depth_map.unsqueeze(1), ... size=(1024, 1024), ... mode="bicubic", ... align_corners=False, ... ) ... depth_min = torch.amin(depth_map, dim=[1, 2, 3], keepdim=True) ... depth_max = torch.amax(depth_map, dim=[1, 2, 3], keepdim=True) ... depth_map = (depth_map - depth_min) / (depth_max - depth_min) ... image = torch.cat([depth_map] * 3, dim=1) ... image = image.permute(0, 2, 3, 1).cpu().numpy()[0] ... image = Image.fromarray((image * 255.0).clip(0, 255).astype(np.uint8)) ... return image >>> prompt = "A robot, 4k photo" >>> image = load_image( ... "https://huggingface.co/datasets/hf-internal-testing/diffusers-images/resolve/main" ... "/kandinsky/cat.png" ... ).resize((1024, 1024)) >>> controlnet_conditioning_scale = 0.5 # recommended for good generalization >>> depth_image = get_depth_map(image) >>> images = pipe( ... prompt, ... image=image, ... control_image=depth_image, ... strength=0.99, ... num_inference_steps=50, ... controlnet_conditioning_scale=controlnet_conditioning_scale, ... ).images >>> images[0].save(f"robot_cat.png") ``` """ # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion_img2img.retrieve_latents def retrieve_latents( encoder_output: torch.Tensor, generator: Optional[torch.Generator] = None, sample_mode: str = "sample" ): if hasattr(encoder_output, "latent_dist") and sample_mode == "sample": return encoder_output.latent_dist.sample(generator) elif hasattr(encoder_output, "latent_dist") and sample_mode == "argmax": return encoder_output.latent_dist.mode() elif hasattr(encoder_output, "latents"): return encoder_output.latents else: raise AttributeError("Could not access latents of provided encoder_output") class StableDiffusionXLControlNetImg2ImgPipeline( DiffusionPipeline, TextualInversionLoaderMixin, StableDiffusionXLLoraLoaderMixin, IPAdapterMixin ): r""" Pipeline for image-to-image generation using Stable Diffusion XL with ControlNet guidance. This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods the library implements for all the pipelines (such as downloading or saving, running on a particular device, etc.) The pipeline also inherits the following loading methods: - [`~loaders.TextualInversionLoaderMixin.load_textual_inversion`] for loading textual inversion embeddings - [`~loaders.StableDiffusionXLLoraLoaderMixin.load_lora_weights`] for loading LoRA weights - [`~loaders.StableDiffusionXLLoraLoaderMixin.save_lora_weights`] for saving LoRA weights - [`~loaders.IPAdapterMixin.load_ip_adapter`] for loading IP Adapters Args: vae ([`AutoencoderKL`]): Variational Auto-Encoder (VAE) Model to encode and decode images to and from latent representations. text_encoder ([`CLIPTextModel`]): Frozen text-encoder. Stable Diffusion uses the text portion of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip#transformers.CLIPTextModel), specifically the [clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14) variant. text_encoder_2 ([` CLIPTextModelWithProjection`]): Second frozen text-encoder. Stable Diffusion XL uses the text and pool portion of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip#transformers.CLIPTextModelWithProjection), specifically the [laion/CLIP-ViT-bigG-14-laion2B-39B-b160k](https://huggingface.co/laion/CLIP-ViT-bigG-14-laion2B-39B-b160k) variant. tokenizer (`CLIPTokenizer`): Tokenizer of class [CLIPTokenizer](https://huggingface.co/docs/transformers/v4.21.0/en/model_doc/clip#transformers.CLIPTokenizer). tokenizer_2 (`CLIPTokenizer`): Second Tokenizer of class [CLIPTokenizer](https://huggingface.co/docs/transformers/v4.21.0/en/model_doc/clip#transformers.CLIPTokenizer). unet ([`UNet2DConditionModel`]): Conditional U-Net architecture to denoise the encoded image latents. controlnet ([`ControlNetModel`] or `List[ControlNetModel]`): Provides additional conditioning to the unet during the denoising process. If you set multiple ControlNets as a list, the outputs from each ControlNet are added together to create one combined additional conditioning. scheduler ([`SchedulerMixin`]): A scheduler to be used in combination with `unet` to denoise the encoded image latents. Can be one of [`DDIMScheduler`], [`LMSDiscreteScheduler`], or [`PNDMScheduler`]. requires_aesthetics_score (`bool`, *optional*, defaults to `"False"`): Whether the `unet` requires an `aesthetic_score` condition to be passed during inference. Also see the config of `stabilityai/stable-diffusion-xl-refiner-1-0`. force_zeros_for_empty_prompt (`bool`, *optional*, defaults to `"True"`): Whether the negative prompt embeddings shall be forced to always be set to 0. Also see the config of `stabilityai/stable-diffusion-xl-base-1-0`. add_watermarker (`bool`, *optional*): Whether to use the [invisible_watermark library](https://github.com/ShieldMnt/invisible-watermark/) to watermark output images. If not defined, it will default to True if the package is installed, otherwise no watermarker will be used. feature_extractor ([`~transformers.CLIPImageProcessor`]): A `CLIPImageProcessor` to extract features from generated images; used as inputs to the `safety_checker`. """ model_cpu_offload_seq = "text_encoder->text_encoder_2->image_encoder->unet->vae" _optional_components = [ "tokenizer", "tokenizer_2", "text_encoder", "text_encoder_2", "feature_extractor", "image_encoder", ] _callback_tensor_inputs = ["latents", "prompt_embeds", "negative_prompt_embeds"] def __init__( self, vae: AutoencoderKL, text_encoder: CLIPTextModel, text_encoder_2: CLIPTextModelWithProjection, tokenizer: CLIPTokenizer, tokenizer_2: CLIPTokenizer, unet: UNet2DConditionModel, controlnet: Union[ControlNetModel, List[ControlNetModel], Tuple[ControlNetModel], MultiControlNetModel], scheduler: KarrasDiffusionSchedulers, requires_aesthetics_score: bool = False, force_zeros_for_empty_prompt: bool = True, add_watermarker: Optional[bool] = None, feature_extractor: CLIPImageProcessor = None, image_encoder: CLIPVisionModelWithProjection = None, ): super().__init__() if isinstance(controlnet, (list, tuple)): controlnet = MultiControlNetModel(controlnet) self.register_modules( vae=vae, text_encoder=text_encoder, text_encoder_2=text_encoder_2, tokenizer=tokenizer, tokenizer_2=tokenizer_2, unet=unet, controlnet=controlnet, scheduler=scheduler, feature_extractor=feature_extractor, image_encoder=image_encoder, ) self.vae_scale_factor = 2 ** (len(self.vae.config.block_out_channels) - 1) self.image_processor = VaeImageProcessor(vae_scale_factor=self.vae_scale_factor, do_convert_rgb=True) self.control_image_processor = VaeImageProcessor( vae_scale_factor=self.vae_scale_factor, do_convert_rgb=True, do_normalize=False ) add_watermarker = add_watermarker if add_watermarker is not None else is_invisible_watermark_available() if add_watermarker: self.watermark = StableDiffusionXLWatermarker() else: self.watermark = None self.register_to_config(force_zeros_for_empty_prompt=force_zeros_for_empty_prompt) self.register_to_config(requires_aesthetics_score=requires_aesthetics_score) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_vae_slicing def enable_vae_slicing(self): r""" Enable sliced VAE decoding. When this option is enabled, the VAE will split the input tensor in slices to compute decoding in several steps. This is useful to save some memory and allow larger batch sizes. """ self.vae.enable_slicing() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_vae_slicing def disable_vae_slicing(self): r""" Disable sliced VAE decoding. If `enable_vae_slicing` was previously enabled, this method will go back to computing decoding in one step. """ self.vae.disable_slicing() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_vae_tiling def enable_vae_tiling(self): r""" Enable tiled VAE decoding. When this option is enabled, the VAE will split the input tensor into tiles to compute decoding and encoding in several steps. This is useful for saving a large amount of memory and to allow processing larger images. """ self.vae.enable_tiling() # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_vae_tiling def disable_vae_tiling(self): r""" Disable tiled VAE decoding. If `enable_vae_tiling` was previously enabled, this method will go back to computing decoding in one step. """ self.vae.disable_tiling() # Copied from diffusers.pipelines.stable_diffusion_xl.pipeline_stable_diffusion_xl.StableDiffusionXLPipeline.encode_prompt def encode_prompt( self, prompt: str, prompt_2: Optional[str] = None, device: Optional[torch.device] = None, num_images_per_prompt: int = 1, do_classifier_free_guidance: bool = True, negative_prompt: Optional[str] = None, negative_prompt_2: Optional[str] = None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, pooled_prompt_embeds: Optional[torch.FloatTensor] = None, negative_pooled_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, clip_skip: Optional[int] = None, ): r""" Encodes the prompt into text encoder hidden states. Args: prompt (`str` or `List[str]`, *optional*): prompt to be encoded prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts to be sent to the `tokenizer_2` and `text_encoder_2`. If not defined, `prompt` is used in both text-encoders device: (`torch.device`): torch device num_images_per_prompt (`int`): number of images that should be generated per prompt do_classifier_free_guidance (`bool`): whether to use classifier free guidance or not negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). negative_prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation to be sent to `tokenizer_2` and `text_encoder_2`. If not defined, `negative_prompt` is used in both text-encoders prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled text embeddings will be generated from `prompt` input argument. negative_pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled negative_prompt_embeds will be generated from `negative_prompt` input argument. lora_scale (`float`, *optional*): A lora scale that will be applied to all LoRA layers of the text encoder if LoRA layers are loaded. clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. """ device = device or self._execution_device # set lora scale so that monkey patched LoRA # function of text encoder can correctly access it if lora_scale is not None and isinstance(self, StableDiffusionXLLoraLoaderMixin): self._lora_scale = lora_scale # dynamically adjust the LoRA scale if self.text_encoder is not None: if not USE_PEFT_BACKEND: adjust_lora_scale_text_encoder(self.text_encoder, lora_scale) else: scale_lora_layers(self.text_encoder, lora_scale) if self.text_encoder_2 is not None: if not USE_PEFT_BACKEND: adjust_lora_scale_text_encoder(self.text_encoder_2, lora_scale) else: scale_lora_layers(self.text_encoder_2, lora_scale) prompt = [prompt] if isinstance(prompt, str) else prompt if prompt is not None: batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] # Define tokenizers and text encoders tokenizers = [self.tokenizer, self.tokenizer_2] if self.tokenizer is not None else [self.tokenizer_2] text_encoders = ( [self.text_encoder, self.text_encoder_2] if self.text_encoder is not None else [self.text_encoder_2] ) if prompt_embeds is None: prompt_2 = prompt_2 or prompt prompt_2 = [prompt_2] if isinstance(prompt_2, str) else prompt_2 # textual inversion: procecss multi-vector tokens if necessary prompt_embeds_list = [] prompts = [prompt, prompt_2] for prompt, tokenizer, text_encoder in zip(prompts, tokenizers, text_encoders): if isinstance(self, TextualInversionLoaderMixin): prompt = self.maybe_convert_prompt(prompt, tokenizer) text_inputs = tokenizer( prompt, padding="max_length", max_length=tokenizer.model_max_length, truncation=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal( text_input_ids, untruncated_ids ): removed_text = tokenizer.batch_decode(untruncated_ids[:, tokenizer.model_max_length - 1 : -1]) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {tokenizer.model_max_length} tokens: {removed_text}" ) prompt_embeds = text_encoder(text_input_ids.to(device), output_hidden_states=True) # We are only ALWAYS interested in the pooled output of the final text encoder pooled_prompt_embeds = prompt_embeds[0] if clip_skip is None: prompt_embeds = prompt_embeds.hidden_states[-2] else: # "2" because SDXL always indexes from the penultimate layer. prompt_embeds = prompt_embeds.hidden_states[-(clip_skip + 2)] prompt_embeds_list.append(prompt_embeds) prompt_embeds = torch.concat(prompt_embeds_list, dim=-1) # get unconditional embeddings for classifier free guidance zero_out_negative_prompt = negative_prompt is None and self.config.force_zeros_for_empty_prompt if do_classifier_free_guidance and negative_prompt_embeds is None and zero_out_negative_prompt: negative_prompt_embeds = torch.zeros_like(prompt_embeds) negative_pooled_prompt_embeds = torch.zeros_like(pooled_prompt_embeds) elif do_classifier_free_guidance and negative_prompt_embeds is None: negative_prompt = negative_prompt or "" negative_prompt_2 = negative_prompt_2 or negative_prompt # normalize str to list negative_prompt = batch_size * [negative_prompt] if isinstance(negative_prompt, str) else negative_prompt negative_prompt_2 = ( batch_size * [negative_prompt_2] if isinstance(negative_prompt_2, str) else negative_prompt_2 ) uncond_tokens: List[str] if prompt is not None and type(prompt) is not type(negative_prompt): raise TypeError( f"`negative_prompt` should be the same type to `prompt`, but got {type(negative_prompt)} !=" f" {type(prompt)}." ) elif batch_size != len(negative_prompt): raise ValueError( f"`negative_prompt`: {negative_prompt} has batch size {len(negative_prompt)}, but `prompt`:" f" {prompt} has batch size {batch_size}. Please make sure that passed `negative_prompt` matches" " the batch size of `prompt`." ) else: uncond_tokens = [negative_prompt, negative_prompt_2] negative_prompt_embeds_list = [] for negative_prompt, tokenizer, text_encoder in zip(uncond_tokens, tokenizers, text_encoders): if isinstance(self, TextualInversionLoaderMixin): negative_prompt = self.maybe_convert_prompt(negative_prompt, tokenizer) max_length = prompt_embeds.shape[1] uncond_input = tokenizer( negative_prompt, padding="max_length", max_length=max_length, truncation=True, return_tensors="pt", ) negative_prompt_embeds = text_encoder( uncond_input.input_ids.to(device), output_hidden_states=True, ) # We are only ALWAYS interested in the pooled output of the final text encoder negative_pooled_prompt_embeds = negative_prompt_embeds[0] negative_prompt_embeds = negative_prompt_embeds.hidden_states[-2] negative_prompt_embeds_list.append(negative_prompt_embeds) negative_prompt_embeds = torch.concat(negative_prompt_embeds_list, dim=-1) if self.text_encoder_2 is not None: prompt_embeds = prompt_embeds.to(dtype=self.text_encoder_2.dtype, device=device) else: prompt_embeds = prompt_embeds.to(dtype=self.unet.dtype, device=device) bs_embed, seq_len, _ = prompt_embeds.shape # duplicate text embeddings for each generation per prompt, using mps friendly method prompt_embeds = prompt_embeds.repeat(1, num_images_per_prompt, 1) prompt_embeds = prompt_embeds.view(bs_embed * num_images_per_prompt, seq_len, -1) if do_classifier_free_guidance: # duplicate unconditional embeddings for each generation per prompt, using mps friendly method seq_len = negative_prompt_embeds.shape[1] if self.text_encoder_2 is not None: negative_prompt_embeds = negative_prompt_embeds.to(dtype=self.text_encoder_2.dtype, device=device) else: negative_prompt_embeds = negative_prompt_embeds.to(dtype=self.unet.dtype, device=device) negative_prompt_embeds = negative_prompt_embeds.repeat(1, num_images_per_prompt, 1) negative_prompt_embeds = negative_prompt_embeds.view(batch_size * num_images_per_prompt, seq_len, -1) pooled_prompt_embeds = pooled_prompt_embeds.repeat(1, num_images_per_prompt).view( bs_embed * num_images_per_prompt, -1 ) if do_classifier_free_guidance: negative_pooled_prompt_embeds = negative_pooled_prompt_embeds.repeat(1, num_images_per_prompt).view( bs_embed * num_images_per_prompt, -1 ) if self.text_encoder is not None: if isinstance(self, StableDiffusionXLLoraLoaderMixin) and USE_PEFT_BACKEND: # Retrieve the original scale by scaling back the LoRA layers unscale_lora_layers(self.text_encoder, lora_scale) if self.text_encoder_2 is not None: if isinstance(self, StableDiffusionXLLoraLoaderMixin) and USE_PEFT_BACKEND: # Retrieve the original scale by scaling back the LoRA layers unscale_lora_layers(self.text_encoder_2, lora_scale) return prompt_embeds, negative_prompt_embeds, pooled_prompt_embeds, negative_pooled_prompt_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.encode_image def encode_image(self, image, device, num_images_per_prompt, output_hidden_states=None): dtype = next(self.image_encoder.parameters()).dtype if not isinstance(image, torch.Tensor): image = self.feature_extractor(image, return_tensors="pt").pixel_values image = image.to(device=device, dtype=dtype) if output_hidden_states: image_enc_hidden_states = self.image_encoder(image, output_hidden_states=True).hidden_states[-2] image_enc_hidden_states = image_enc_hidden_states.repeat_interleave(num_images_per_prompt, dim=0) uncond_image_enc_hidden_states = self.image_encoder( torch.zeros_like(image), output_hidden_states=True ).hidden_states[-2] uncond_image_enc_hidden_states = uncond_image_enc_hidden_states.repeat_interleave( num_images_per_prompt, dim=0 ) return image_enc_hidden_states, uncond_image_enc_hidden_states else: image_embeds = self.image_encoder(image).image_embeds image_embeds = image_embeds.repeat_interleave(num_images_per_prompt, dim=0) uncond_image_embeds = torch.zeros_like(image_embeds) return image_embeds, uncond_image_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_ip_adapter_image_embeds def prepare_ip_adapter_image_embeds(self, ip_adapter_image, device, num_images_per_prompt): if not isinstance(ip_adapter_image, list): ip_adapter_image = [ip_adapter_image] if len(ip_adapter_image) != len(self.unet.encoder_hid_proj.image_projection_layers): raise ValueError( f"`ip_adapter_image` must have same length as the number of IP Adapters. Got {len(ip_adapter_image)} images and {len(self.unet.encoder_hid_proj.image_projection_layers)} IP Adapters." ) image_embeds = [] for single_ip_adapter_image, image_proj_layer in zip( ip_adapter_image, self.unet.encoder_hid_proj.image_projection_layers ): output_hidden_state = not isinstance(image_proj_layer, ImageProjection) single_image_embeds, single_negative_image_embeds = self.encode_image( single_ip_adapter_image, device, 1, output_hidden_state ) single_image_embeds = torch.stack([single_image_embeds] * num_images_per_prompt, dim=0) single_negative_image_embeds = torch.stack([single_negative_image_embeds] * num_images_per_prompt, dim=0) if self.do_classifier_free_guidance: single_image_embeds = torch.cat([single_negative_image_embeds, single_image_embeds]) single_image_embeds = single_image_embeds.to(device) image_embeds.append(single_image_embeds) return image_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_extra_step_kwargs def prepare_extra_step_kwargs(self, generator, eta): # prepare extra kwargs for the scheduler step, since not all schedulers have the same signature # eta (ฮท) is only used with the DDIMScheduler, it will be ignored for other schedulers. # eta corresponds to ฮท in DDIM paper: https://arxiv.org/abs/2010.02502 # and should be between [0, 1] accepts_eta = "eta" in set(inspect.signature(self.scheduler.step).parameters.keys()) extra_step_kwargs = {} if accepts_eta: extra_step_kwargs["eta"] = eta # check if the scheduler accepts generator accepts_generator = "generator" in set(inspect.signature(self.scheduler.step).parameters.keys()) if accepts_generator: extra_step_kwargs["generator"] = generator return extra_step_kwargs def check_inputs( self, prompt, prompt_2, image, strength, num_inference_steps, callback_steps, negative_prompt=None, negative_prompt_2=None, prompt_embeds=None, negative_prompt_embeds=None, pooled_prompt_embeds=None, negative_pooled_prompt_embeds=None, controlnet_conditioning_scale=1.0, control_guidance_start=0.0, control_guidance_end=1.0, callback_on_step_end_tensor_inputs=None, ): if strength < 0 or strength > 1: raise ValueError(f"The value of strength should in [0.0, 1.0] but is {strength}") if num_inference_steps is None: raise ValueError("`num_inference_steps` cannot be None.") elif not isinstance(num_inference_steps, int) or num_inference_steps <= 0: raise ValueError( f"`num_inference_steps` has to be a positive integer but is {num_inference_steps} of type" f" {type(num_inference_steps)}." ) if callback_steps is not None and (not isinstance(callback_steps, int) or callback_steps <= 0): raise ValueError( f"`callback_steps` has to be a positive integer but is {callback_steps} of type" f" {type(callback_steps)}." ) if callback_on_step_end_tensor_inputs is not None and not all( k in self._callback_tensor_inputs for k in callback_on_step_end_tensor_inputs ): raise ValueError( f"`callback_on_step_end_tensor_inputs` has to be in {self._callback_tensor_inputs}, but found {[k for k in callback_on_step_end_tensor_inputs if k not in self._callback_tensor_inputs]}" ) if prompt is not None and prompt_embeds is not None: raise ValueError( f"Cannot forward both `prompt`: {prompt} and `prompt_embeds`: {prompt_embeds}. Please make sure to" " only forward one of the two." ) elif prompt_2 is not None and prompt_embeds is not None: raise ValueError( f"Cannot forward both `prompt_2`: {prompt_2} and `prompt_embeds`: {prompt_embeds}. Please make sure to" " only forward one of the two." ) elif prompt is None and prompt_embeds is None: raise ValueError( "Provide either `prompt` or `prompt_embeds`. Cannot leave both `prompt` and `prompt_embeds` undefined." ) elif prompt is not None and (not isinstance(prompt, str) and not isinstance(prompt, list)): raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") elif prompt_2 is not None and (not isinstance(prompt_2, str) and not isinstance(prompt_2, list)): raise ValueError(f"`prompt_2` has to be of type `str` or `list` but is {type(prompt_2)}") if negative_prompt is not None and negative_prompt_embeds is not None: raise ValueError( f"Cannot forward both `negative_prompt`: {negative_prompt} and `negative_prompt_embeds`:" f" {negative_prompt_embeds}. Please make sure to only forward one of the two." ) elif negative_prompt_2 is not None and negative_prompt_embeds is not None: raise ValueError( f"Cannot forward both `negative_prompt_2`: {negative_prompt_2} and `negative_prompt_embeds`:" f" {negative_prompt_embeds}. Please make sure to only forward one of the two." ) if prompt_embeds is not None and negative_prompt_embeds is not None: if prompt_embeds.shape != negative_prompt_embeds.shape: raise ValueError( "`prompt_embeds` and `negative_prompt_embeds` must have the same shape when passed directly, but" f" got: `prompt_embeds` {prompt_embeds.shape} != `negative_prompt_embeds`" f" {negative_prompt_embeds.shape}." ) if prompt_embeds is not None and pooled_prompt_embeds is None: raise ValueError( "If `prompt_embeds` are provided, `pooled_prompt_embeds` also have to be passed. Make sure to generate `pooled_prompt_embeds` from the same text encoder that was used to generate `prompt_embeds`." ) if negative_prompt_embeds is not None and negative_pooled_prompt_embeds is None: raise ValueError( "If `negative_prompt_embeds` are provided, `negative_pooled_prompt_embeds` also have to be passed. Make sure to generate `negative_pooled_prompt_embeds` from the same text encoder that was used to generate `negative_prompt_embeds`." ) # `prompt` needs more sophisticated handling when there are multiple # conditionings. if isinstance(self.controlnet, MultiControlNetModel): if isinstance(prompt, list): logger.warning( f"You have {len(self.controlnet.nets)} ControlNets and you have passed {len(prompt)}" " prompts. The conditionings will be fixed across the prompts." ) # Check `image` is_compiled = hasattr(F, "scaled_dot_product_attention") and isinstance( self.controlnet, torch._dynamo.eval_frame.OptimizedModule ) if ( isinstance(self.controlnet, ControlNetModel) or is_compiled and isinstance(self.controlnet._orig_mod, ControlNetModel) ): self.check_image(image, prompt, prompt_embeds) elif ( isinstance(self.controlnet, MultiControlNetModel) or is_compiled and isinstance(self.controlnet._orig_mod, MultiControlNetModel) ): if not isinstance(image, list): raise TypeError("For multiple controlnets: `image` must be type `list`") # When `image` is a nested list: # (e.g. [[canny_image_1, pose_image_1], [canny_image_2, pose_image_2]]) elif any(isinstance(i, list) for i in image): raise ValueError("A single batch of multiple conditionings are supported at the moment.") elif len(image) != len(self.controlnet.nets): raise ValueError( f"For multiple controlnets: `image` must have the same length as the number of controlnets, but got {len(image)} images and {len(self.controlnet.nets)} ControlNets." ) for image_ in image: self.check_image(image_, prompt, prompt_embeds) else: assert False # Check `controlnet_conditioning_scale` if ( isinstance(self.controlnet, ControlNetModel) or is_compiled and isinstance(self.controlnet._orig_mod, ControlNetModel) ): if not isinstance(controlnet_conditioning_scale, float): raise TypeError("For single controlnet: `controlnet_conditioning_scale` must be type `float`.") elif ( isinstance(self.controlnet, MultiControlNetModel) or is_compiled and isinstance(self.controlnet._orig_mod, MultiControlNetModel) ): if isinstance(controlnet_conditioning_scale, list): if any(isinstance(i, list) for i in controlnet_conditioning_scale): raise ValueError("A single batch of multiple conditionings are supported at the moment.") elif isinstance(controlnet_conditioning_scale, list) and len(controlnet_conditioning_scale) != len( self.controlnet.nets ): raise ValueError( "For multiple controlnets: When `controlnet_conditioning_scale` is specified as `list`, it must have" " the same length as the number of controlnets" ) else: assert False if not isinstance(control_guidance_start, (tuple, list)): control_guidance_start = [control_guidance_start] if not isinstance(control_guidance_end, (tuple, list)): control_guidance_end = [control_guidance_end] if len(control_guidance_start) != len(control_guidance_end): raise ValueError( f"`control_guidance_start` has {len(control_guidance_start)} elements, but `control_guidance_end` has {len(control_guidance_end)} elements. Make sure to provide the same number of elements to each list." ) if isinstance(self.controlnet, MultiControlNetModel): if len(control_guidance_start) != len(self.controlnet.nets): raise ValueError( f"`control_guidance_start`: {control_guidance_start} has {len(control_guidance_start)} elements but there are {len(self.controlnet.nets)} controlnets available. Make sure to provide {len(self.controlnet.nets)}." ) for start, end in zip(control_guidance_start, control_guidance_end): if start >= end: raise ValueError( f"control guidance start: {start} cannot be larger or equal to control guidance end: {end}." ) if start < 0.0: raise ValueError(f"control guidance start: {start} can't be smaller than 0.") if end > 1.0: raise ValueError(f"control guidance end: {end} can't be larger than 1.0.") # Copied from diffusers.pipelines.controlnet.pipeline_controlnet_sd_xl.StableDiffusionXLControlNetPipeline.check_image def check_image(self, image, prompt, prompt_embeds): image_is_pil = isinstance(image, PIL.Image.Image) image_is_tensor = isinstance(image, torch.Tensor) image_is_np = isinstance(image, np.ndarray) image_is_pil_list = isinstance(image, list) and isinstance(image[0], PIL.Image.Image) image_is_tensor_list = isinstance(image, list) and isinstance(image[0], torch.Tensor) image_is_np_list = isinstance(image, list) and isinstance(image[0], np.ndarray) if ( not image_is_pil and not image_is_tensor and not image_is_np and not image_is_pil_list and not image_is_tensor_list and not image_is_np_list ): raise TypeError( f"image must be passed and be one of PIL image, numpy array, torch tensor, list of PIL images, list of numpy arrays or list of torch tensors, but is {type(image)}" ) if image_is_pil: image_batch_size = 1 else: image_batch_size = len(image) if prompt is not None and isinstance(prompt, str): prompt_batch_size = 1 elif prompt is not None and isinstance(prompt, list): prompt_batch_size = len(prompt) elif prompt_embeds is not None: prompt_batch_size = prompt_embeds.shape[0] if image_batch_size != 1 and image_batch_size != prompt_batch_size: raise ValueError( f"If image batch size is not 1, image batch size must be same as prompt batch size. image batch size: {image_batch_size}, prompt batch size: {prompt_batch_size}" ) # Copied from diffusers.pipelines.controlnet.pipeline_controlnet_sd_xl.StableDiffusionXLControlNetPipeline.prepare_image def prepare_control_image( self, image, width, height, batch_size, num_images_per_prompt, device, dtype, do_classifier_free_guidance=False, guess_mode=False, ): image = self.control_image_processor.preprocess(image, height=height, width=width).to(dtype=torch.float32) image_batch_size = image.shape[0] if image_batch_size == 1: repeat_by = batch_size else: # image batch size is the same as prompt batch size repeat_by = num_images_per_prompt image = image.repeat_interleave(repeat_by, dim=0) image = image.to(device=device, dtype=dtype) if do_classifier_free_guidance and not guess_mode: image = torch.cat([image] * 2) return image # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion_img2img.StableDiffusionImg2ImgPipeline.get_timesteps def get_timesteps(self, num_inference_steps, strength, device): # get the original timestep using init_timestep init_timestep = min(int(num_inference_steps * strength), num_inference_steps) t_start = max(num_inference_steps - init_timestep, 0) timesteps = self.scheduler.timesteps[t_start * self.scheduler.order :] if hasattr(self.scheduler, "set_begin_index"): self.scheduler.set_begin_index(t_start * self.scheduler.order) return timesteps, num_inference_steps - t_start # Copied from diffusers.pipelines.stable_diffusion_xl.pipeline_stable_diffusion_xl_img2img.StableDiffusionXLImg2ImgPipeline.prepare_latents def prepare_latents( self, image, timestep, batch_size, num_images_per_prompt, dtype, device, generator=None, add_noise=True ): if not isinstance(image, (torch.Tensor, PIL.Image.Image, list)): raise ValueError( f"`image` has to be of type `torch.Tensor`, `PIL.Image.Image` or list but is {type(image)}" ) # Offload text encoder if `enable_model_cpu_offload` was enabled if hasattr(self, "final_offload_hook") and self.final_offload_hook is not None: self.text_encoder_2.to("cpu") torch.cuda.empty_cache() image = image.to(device=device, dtype=dtype) batch_size = batch_size * num_images_per_prompt if image.shape[1] == 4: init_latents = image else: # make sure the VAE is in float32 mode, as it overflows in float16 if self.vae.config.force_upcast: image = image.float() self.vae.to(dtype=torch.float32) if isinstance(generator, list) and len(generator) != batch_size: raise ValueError( f"You have passed a list of generators of length {len(generator)}, but requested an effective batch" f" size of {batch_size}. Make sure the batch size matches the length of the generators." ) elif isinstance(generator, list): init_latents = [ retrieve_latents(self.vae.encode(image[i : i + 1]), generator=generator[i]) for i in range(batch_size) ] init_latents = torch.cat(init_latents, dim=0) else: init_latents = retrieve_latents(self.vae.encode(image), generator=generator) if self.vae.config.force_upcast: self.vae.to(dtype) init_latents = init_latents.to(dtype) init_latents = self.vae.config.scaling_factor * init_latents if batch_size > init_latents.shape[0] and batch_size % init_latents.shape[0] == 0: # expand init_latents for batch_size additional_image_per_prompt = batch_size // init_latents.shape[0] init_latents = torch.cat([init_latents] * additional_image_per_prompt, dim=0) elif batch_size > init_latents.shape[0] and batch_size % init_latents.shape[0] != 0: raise ValueError( f"Cannot duplicate `image` of batch size {init_latents.shape[0]} to {batch_size} text prompts." ) else: init_latents = torch.cat([init_latents], dim=0) if add_noise: shape = init_latents.shape noise = randn_tensor(shape, generator=generator, device=device, dtype=dtype) # get latents init_latents = self.scheduler.add_noise(init_latents, noise, timestep) latents = init_latents return latents # Copied from diffusers.pipelines.stable_diffusion_xl.pipeline_stable_diffusion_xl_img2img.StableDiffusionXLImg2ImgPipeline._get_add_time_ids def _get_add_time_ids( self, original_size, crops_coords_top_left, target_size, aesthetic_score, negative_aesthetic_score, negative_original_size, negative_crops_coords_top_left, negative_target_size, dtype, text_encoder_projection_dim=None, ): if self.config.requires_aesthetics_score: add_time_ids = list(original_size + crops_coords_top_left + (aesthetic_score,)) add_neg_time_ids = list( negative_original_size + negative_crops_coords_top_left + (negative_aesthetic_score,) ) else: add_time_ids = list(original_size + crops_coords_top_left + target_size) add_neg_time_ids = list(negative_original_size + crops_coords_top_left + negative_target_size) passed_add_embed_dim = ( self.unet.config.addition_time_embed_dim * len(add_time_ids) + text_encoder_projection_dim ) expected_add_embed_dim = self.unet.add_embedding.linear_1.in_features if ( expected_add_embed_dim > passed_add_embed_dim and (expected_add_embed_dim - passed_add_embed_dim) == self.unet.config.addition_time_embed_dim ): raise ValueError( f"Model expects an added time embedding vector of length {expected_add_embed_dim}, but a vector of {passed_add_embed_dim} was created. Please make sure to enable `requires_aesthetics_score` with `pipe.register_to_config(requires_aesthetics_score=True)` to make sure `aesthetic_score` {aesthetic_score} and `negative_aesthetic_score` {negative_aesthetic_score} is correctly used by the model." ) elif ( expected_add_embed_dim < passed_add_embed_dim and (passed_add_embed_dim - expected_add_embed_dim) == self.unet.config.addition_time_embed_dim ): raise ValueError( f"Model expects an added time embedding vector of length {expected_add_embed_dim}, but a vector of {passed_add_embed_dim} was created. Please make sure to disable `requires_aesthetics_score` with `pipe.register_to_config(requires_aesthetics_score=False)` to make sure `target_size` {target_size} is correctly used by the model." ) elif expected_add_embed_dim != passed_add_embed_dim: raise ValueError( f"Model expects an added time embedding vector of length {expected_add_embed_dim}, but a vector of {passed_add_embed_dim} was created. The model has an incorrect config. Please check `unet.config.time_embedding_type` and `text_encoder_2.config.projection_dim`." ) add_time_ids = torch.tensor([add_time_ids], dtype=dtype) add_neg_time_ids = torch.tensor([add_neg_time_ids], dtype=dtype) return add_time_ids, add_neg_time_ids # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion_upscale.StableDiffusionUpscalePipeline.upcast_vae def upcast_vae(self): dtype = self.vae.dtype self.vae.to(dtype=torch.float32) use_torch_2_0_or_xformers = isinstance( self.vae.decoder.mid_block.attentions[0].processor, ( AttnProcessor2_0, XFormersAttnProcessor, LoRAXFormersAttnProcessor, LoRAAttnProcessor2_0, ), ) # if xformers or torch_2_0 is used attention block does not need # to be in float32 which can save lots of memory if use_torch_2_0_or_xformers: self.vae.post_quant_conv.to(dtype) self.vae.decoder.conv_in.to(dtype) self.vae.decoder.mid_block.to(dtype) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_freeu def enable_freeu(self, s1: float, s2: float, b1: float, b2: float): r"""Enables the FreeU mechanism as in https://arxiv.org/abs/2309.11497. The suffixes after the scaling factors represent the stages where they are being applied. Please refer to the [official repository](https://github.com/ChenyangSi/FreeU) for combinations of the values that are known to work well for different pipelines such as Stable Diffusion v1, v2, and Stable Diffusion XL. Args: s1 (`float`): Scaling factor for stage 1 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. s2 (`float`): Scaling factor for stage 2 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. b1 (`float`): Scaling factor for stage 1 to amplify the contributions of backbone features. b2 (`float`): Scaling factor for stage 2 to amplify the contributions of backbone features. """ if not hasattr(self, "unet"): raise ValueError("The pipeline must have `unet` for using FreeU.") self.unet.enable_freeu(s1=s1, s2=s2, b1=b1, b2=b2) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_freeu def disable_freeu(self): """Disables the FreeU mechanism if enabled.""" self.unet.disable_freeu() @property def guidance_scale(self): return self._guidance_scale @property def clip_skip(self): return self._clip_skip # here `guidance_scale` is defined analog to the guidance weight `w` of equation (2) # of the Imagen paper: https://arxiv.org/pdf/2205.11487.pdf . `guidance_scale = 1` # corresponds to doing no classifier free guidance. @property def do_classifier_free_guidance(self): return self._guidance_scale > 1 @property def cross_attention_kwargs(self): return self._cross_attention_kwargs @property def num_timesteps(self): return self._num_timesteps @torch.no_grad() @replace_example_docstring(EXAMPLE_DOC_STRING) def __call__( self, prompt: Union[str, List[str]] = None, prompt_2: Optional[Union[str, List[str]]] = None, image: PipelineImageInput = None, control_image: PipelineImageInput = None, height: Optional[int] = None, width: Optional[int] = None, strength: float = 0.8, num_inference_steps: int = 50, guidance_scale: float = 5.0, negative_prompt: Optional[Union[str, List[str]]] = None, negative_prompt_2: Optional[Union[str, List[str]]] = None, num_images_per_prompt: Optional[int] = 1, eta: float = 0.0, generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, latents: Optional[torch.FloatTensor] = None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, pooled_prompt_embeds: Optional[torch.FloatTensor] = None, negative_pooled_prompt_embeds: Optional[torch.FloatTensor] = None, ip_adapter_image: Optional[PipelineImageInput] = None, output_type: Optional[str] = "pil", return_dict: bool = True, cross_attention_kwargs: Optional[Dict[str, Any]] = None, controlnet_conditioning_scale: Union[float, List[float]] = 0.8, guess_mode: bool = False, control_guidance_start: Union[float, List[float]] = 0.0, control_guidance_end: Union[float, List[float]] = 1.0, original_size: Tuple[int, int] = None, crops_coords_top_left: Tuple[int, int] = (0, 0), target_size: Tuple[int, int] = None, negative_original_size: Optional[Tuple[int, int]] = None, negative_crops_coords_top_left: Tuple[int, int] = (0, 0), negative_target_size: Optional[Tuple[int, int]] = None, aesthetic_score: float = 6.0, negative_aesthetic_score: float = 2.5, clip_skip: Optional[int] = None, callback_on_step_end: Optional[Callable[[int, int, Dict], None]] = None, callback_on_step_end_tensor_inputs: List[str] = ["latents"], **kwargs, ): r""" Function invoked when calling the pipeline for generation. Args: prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide the image generation. If not defined, one has to pass `prompt_embeds`. instead. prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts to be sent to the `tokenizer_2` and `text_encoder_2`. If not defined, `prompt` is used in both text-encoders image (`torch.FloatTensor`, `PIL.Image.Image`, `np.ndarray`, `List[torch.FloatTensor]`, `List[PIL.Image.Image]`, `List[np.ndarray]`,: `List[List[torch.FloatTensor]]`, `List[List[np.ndarray]]` or `List[List[PIL.Image.Image]]`): The initial image will be used as the starting point for the image generation process. Can also accept image latents as `image`, if passing latents directly, it will not be encoded again. control_image (`torch.FloatTensor`, `PIL.Image.Image`, `np.ndarray`, `List[torch.FloatTensor]`, `List[PIL.Image.Image]`, `List[np.ndarray]`,: `List[List[torch.FloatTensor]]`, `List[List[np.ndarray]]` or `List[List[PIL.Image.Image]]`): The ControlNet input condition. ControlNet uses this input condition to generate guidance to Unet. If the type is specified as `Torch.FloatTensor`, it is passed to ControlNet as is. `PIL.Image.Image` can also be accepted as an image. The dimensions of the output image defaults to `image`'s dimensions. If height and/or width are passed, `image` is resized according to them. If multiple ControlNets are specified in init, images must be passed as a list such that each element of the list can be correctly batched for input to a single controlnet. height (`int`, *optional*, defaults to the size of control_image): The height in pixels of the generated image. Anything below 512 pixels won't work well for [stabilityai/stable-diffusion-xl-base-1.0](https://huggingface.co/stabilityai/stable-diffusion-xl-base-1.0) and checkpoints that are not specifically fine-tuned on low resolutions. width (`int`, *optional*, defaults to the size of control_image): The width in pixels of the generated image. Anything below 512 pixels won't work well for [stabilityai/stable-diffusion-xl-base-1.0](https://huggingface.co/stabilityai/stable-diffusion-xl-base-1.0) and checkpoints that are not specifically fine-tuned on low resolutions. num_inference_steps (`int`, *optional*, defaults to 50): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. strength (`float`, *optional*, defaults to 0.3): Conceptually, indicates how much to transform the reference `image`. Must be between 0 and 1. `image` will be used as a starting point, adding more noise to it the larger the `strength`. The number of denoising steps depends on the amount of noise initially added. When `strength` is 1, added noise will be maximum and the denoising process will run for the full number of iterations specified in `num_inference_steps`. guidance_scale (`float`, *optional*, defaults to 7.5): Guidance scale as defined in [Classifier-Free Diffusion Guidance](https://arxiv.org/abs/2207.12598). `guidance_scale` is defined as `w` of equation 2. of [Imagen Paper](https://arxiv.org/pdf/2205.11487.pdf). Guidance scale is enabled by setting `guidance_scale > 1`. Higher guidance scale encourages to generate images that are closely linked to the text `prompt`, usually at the expense of lower image quality. negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). negative_prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation to be sent to `tokenizer_2` and `text_encoder_2`. If not defined, `negative_prompt` is used in both text-encoders num_images_per_prompt (`int`, *optional*, defaults to 1): The number of images to generate per prompt. eta (`float`, *optional*, defaults to 0.0): Corresponds to parameter eta (ฮท) in the DDIM paper: https://arxiv.org/abs/2010.02502. Only applies to [`schedulers.DDIMScheduler`], will be ignored for others. generator (`torch.Generator` or `List[torch.Generator]`, *optional*): One or a list of [torch generator(s)](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents, sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor will ge generated by sampling using the supplied random `generator`. prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled text embeddings will be generated from `prompt` input argument. negative_pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled negative_prompt_embeds will be generated from `negative_prompt` input argument. ip_adapter_image: (`PipelineImageInput`, *optional*): Optional image input to work with IP Adapters. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generate image. Choose between [PIL](https://pillow.readthedocs.io/en/stable/): `PIL.Image.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] instead of a plain tuple. cross_attention_kwargs (`dict`, *optional*): A kwargs dictionary that if specified is passed along to the `AttentionProcessor` as defined under `self.processor` in [diffusers.models.attention_processor](https://github.com/huggingface/diffusers/blob/main/src/diffusers/models/attention_processor.py). controlnet_conditioning_scale (`float` or `List[float]`, *optional*, defaults to 1.0): The outputs of the controlnet are multiplied by `controlnet_conditioning_scale` before they are added to the residual in the original unet. If multiple ControlNets are specified in init, you can set the corresponding scale as a list. guess_mode (`bool`, *optional*, defaults to `False`): In this mode, the ControlNet encoder will try best to recognize the content of the input image even if you remove all prompts. The `guidance_scale` between 3.0 and 5.0 is recommended. control_guidance_start (`float` or `List[float]`, *optional*, defaults to 0.0): The percentage of total steps at which the controlnet starts applying. control_guidance_end (`float` or `List[float]`, *optional*, defaults to 1.0): The percentage of total steps at which the controlnet stops applying. original_size (`Tuple[int]`, *optional*, defaults to (1024, 1024)): If `original_size` is not the same as `target_size` the image will appear to be down- or upsampled. `original_size` defaults to `(height, width)` if not specified. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). crops_coords_top_left (`Tuple[int]`, *optional*, defaults to (0, 0)): `crops_coords_top_left` can be used to generate an image that appears to be "cropped" from the position `crops_coords_top_left` downwards. Favorable, well-centered images are usually achieved by setting `crops_coords_top_left` to (0, 0). Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). target_size (`Tuple[int]`, *optional*, defaults to (1024, 1024)): For most cases, `target_size` should be set to the desired height and width of the generated image. If not specified it will default to `(height, width)`. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). negative_original_size (`Tuple[int]`, *optional*, defaults to (1024, 1024)): To negatively condition the generation process based on a specific image resolution. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). For more information, refer to this issue thread: https://github.com/huggingface/diffusers/issues/4208. negative_crops_coords_top_left (`Tuple[int]`, *optional*, defaults to (0, 0)): To negatively condition the generation process based on a specific crop coordinates. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). For more information, refer to this issue thread: https://github.com/huggingface/diffusers/issues/4208. negative_target_size (`Tuple[int]`, *optional*, defaults to (1024, 1024)): To negatively condition the generation process based on a target image resolution. It should be as same as the `target_size` for most cases. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). For more information, refer to this issue thread: https://github.com/huggingface/diffusers/issues/4208. aesthetic_score (`float`, *optional*, defaults to 6.0): Used to simulate an aesthetic score of the generated image by influencing the positive text condition. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). negative_aesthetic_score (`float`, *optional*, defaults to 2.5): Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). Can be used to simulate an aesthetic score of the generated image by influencing the negative text condition. clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. callback_on_step_end (`Callable`, *optional*): A function that calls at the end of each denoising steps during the inference. The function is called with the following arguments: `callback_on_step_end(self: DiffusionPipeline, step: int, timestep: int, callback_kwargs: Dict)`. `callback_kwargs` will include a list of all tensors as specified by `callback_on_step_end_tensor_inputs`. callback_on_step_end_tensor_inputs (`List`, *optional*): The list of tensor inputs for the `callback_on_step_end` function. The tensors specified in the list will be passed as `callback_kwargs` argument. You will only be able to include variables listed in the `._callback_tensor_inputs` attribute of your pipeine class. Examples: Returns: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] or `tuple`: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] if `return_dict` is True, otherwise a `tuple` containing the output images. """ callback = kwargs.pop("callback", None) callback_steps = kwargs.pop("callback_steps", None) if callback is not None: deprecate( "callback", "1.0.0", "Passing `callback` as an input argument to `__call__` is deprecated, consider using `callback_on_step_end`", ) if callback_steps is not None: deprecate( "callback_steps", "1.0.0", "Passing `callback_steps` as an input argument to `__call__` is deprecated, consider using `callback_on_step_end`", ) controlnet = self.controlnet._orig_mod if is_compiled_module(self.controlnet) else self.controlnet # align format for control guidance if not isinstance(control_guidance_start, list) and isinstance(control_guidance_end, list): control_guidance_start = len(control_guidance_end) * [control_guidance_start] elif not isinstance(control_guidance_end, list) and isinstance(control_guidance_start, list): control_guidance_end = len(control_guidance_start) * [control_guidance_end] elif not isinstance(control_guidance_start, list) and not isinstance(control_guidance_end, list): mult = len(controlnet.nets) if isinstance(controlnet, MultiControlNetModel) else 1 control_guidance_start, control_guidance_end = ( mult * [control_guidance_start], mult * [control_guidance_end], ) # 1. Check inputs. Raise error if not correct self.check_inputs( prompt, prompt_2, control_image, strength, num_inference_steps, callback_steps, negative_prompt, negative_prompt_2, prompt_embeds, negative_prompt_embeds, pooled_prompt_embeds, negative_pooled_prompt_embeds, controlnet_conditioning_scale, control_guidance_start, control_guidance_end, callback_on_step_end_tensor_inputs, ) self._guidance_scale = guidance_scale self._clip_skip = clip_skip self._cross_attention_kwargs = cross_attention_kwargs # 2. Define call parameters if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] device = self._execution_device if isinstance(controlnet, MultiControlNetModel) and isinstance(controlnet_conditioning_scale, float): controlnet_conditioning_scale = [controlnet_conditioning_scale] * len(controlnet.nets) global_pool_conditions = ( controlnet.config.global_pool_conditions if isinstance(controlnet, ControlNetModel) else controlnet.nets[0].config.global_pool_conditions ) guess_mode = guess_mode or global_pool_conditions # 3.1. Encode input prompt text_encoder_lora_scale = ( self.cross_attention_kwargs.get("scale", None) if self.cross_attention_kwargs is not None else None ) ( prompt_embeds, negative_prompt_embeds, pooled_prompt_embeds, negative_pooled_prompt_embeds, ) = self.encode_prompt( prompt, prompt_2, device, num_images_per_prompt, self.do_classifier_free_guidance, negative_prompt, negative_prompt_2, prompt_embeds=prompt_embeds, negative_prompt_embeds=negative_prompt_embeds, pooled_prompt_embeds=pooled_prompt_embeds, negative_pooled_prompt_embeds=negative_pooled_prompt_embeds, lora_scale=text_encoder_lora_scale, clip_skip=self.clip_skip, ) # 3.2 Encode ip_adapter_image if ip_adapter_image is not None: image_embeds = self.prepare_ip_adapter_image_embeds( ip_adapter_image, device, batch_size * num_images_per_prompt ) # 4. Prepare image and controlnet_conditioning_image image = self.image_processor.preprocess(image, height=height, width=width).to(dtype=torch.float32) if isinstance(controlnet, ControlNetModel): control_image = self.prepare_control_image( image=control_image, width=width, height=height, batch_size=batch_size * num_images_per_prompt, num_images_per_prompt=num_images_per_prompt, device=device, dtype=controlnet.dtype, do_classifier_free_guidance=self.do_classifier_free_guidance, guess_mode=guess_mode, ) height, width = control_image.shape[-2:] elif isinstance(controlnet, MultiControlNetModel): control_images = [] for control_image_ in control_image: control_image_ = self.prepare_control_image( image=control_image_, width=width, height=height, batch_size=batch_size * num_images_per_prompt, num_images_per_prompt=num_images_per_prompt, device=device, dtype=controlnet.dtype, do_classifier_free_guidance=self.do_classifier_free_guidance, guess_mode=guess_mode, ) control_images.append(control_image_) control_image = control_images height, width = control_image[0].shape[-2:] else: assert False # 5. Prepare timesteps self.scheduler.set_timesteps(num_inference_steps, device=device) timesteps, num_inference_steps = self.get_timesteps(num_inference_steps, strength, device) latent_timestep = timesteps[:1].repeat(batch_size * num_images_per_prompt) self._num_timesteps = len(timesteps) # 6. Prepare latent variables latents = self.prepare_latents( image, latent_timestep, batch_size, num_images_per_prompt, prompt_embeds.dtype, device, generator, True, ) # 7. Prepare extra step kwargs. TODO: Logic should ideally just be moved out of the pipeline extra_step_kwargs = self.prepare_extra_step_kwargs(generator, eta) # 7.1 Create tensor stating which controlnets to keep controlnet_keep = [] for i in range(len(timesteps)): keeps = [ 1.0 - float(i / len(timesteps) < s or (i + 1) / len(timesteps) > e) for s, e in zip(control_guidance_start, control_guidance_end) ] controlnet_keep.append(keeps[0] if isinstance(controlnet, ControlNetModel) else keeps) # 7.2 Prepare added time ids & embeddings if isinstance(control_image, list): original_size = original_size or control_image[0].shape[-2:] else: original_size = original_size or control_image.shape[-2:] target_size = target_size or (height, width) if negative_original_size is None: negative_original_size = original_size if negative_target_size is None: negative_target_size = target_size add_text_embeds = pooled_prompt_embeds if self.text_encoder_2 is None: text_encoder_projection_dim = int(pooled_prompt_embeds.shape[-1]) else: text_encoder_projection_dim = self.text_encoder_2.config.projection_dim add_time_ids, add_neg_time_ids = self._get_add_time_ids( original_size, crops_coords_top_left, target_size, aesthetic_score, negative_aesthetic_score, negative_original_size, negative_crops_coords_top_left, negative_target_size, dtype=prompt_embeds.dtype, text_encoder_projection_dim=text_encoder_projection_dim, ) add_time_ids = add_time_ids.repeat(batch_size * num_images_per_prompt, 1) if self.do_classifier_free_guidance: prompt_embeds = torch.cat([negative_prompt_embeds, prompt_embeds], dim=0) add_text_embeds = torch.cat([negative_pooled_prompt_embeds, add_text_embeds], dim=0) add_neg_time_ids = add_neg_time_ids.repeat(batch_size * num_images_per_prompt, 1) add_time_ids = torch.cat([add_neg_time_ids, add_time_ids], dim=0) prompt_embeds = prompt_embeds.to(device) add_text_embeds = add_text_embeds.to(device) add_time_ids = add_time_ids.to(device) # 8. Denoising loop num_warmup_steps = len(timesteps) - num_inference_steps * self.scheduler.order with self.progress_bar(total=num_inference_steps) as progress_bar: for i, t in enumerate(timesteps): # expand the latents if we are doing classifier free guidance latent_model_input = torch.cat([latents] * 2) if self.do_classifier_free_guidance else latents latent_model_input = self.scheduler.scale_model_input(latent_model_input, t) added_cond_kwargs = {"text_embeds": add_text_embeds, "time_ids": add_time_ids} # controlnet(s) inference if guess_mode and self.do_classifier_free_guidance: # Infer ControlNet only for the conditional batch. control_model_input = latents control_model_input = self.scheduler.scale_model_input(control_model_input, t) controlnet_prompt_embeds = prompt_embeds.chunk(2)[1] controlnet_added_cond_kwargs = { "text_embeds": add_text_embeds.chunk(2)[1], "time_ids": add_time_ids.chunk(2)[1], } else: control_model_input = latent_model_input controlnet_prompt_embeds = prompt_embeds controlnet_added_cond_kwargs = added_cond_kwargs if isinstance(controlnet_keep[i], list): cond_scale = [c * s for c, s in zip(controlnet_conditioning_scale, controlnet_keep[i])] else: controlnet_cond_scale = controlnet_conditioning_scale if isinstance(controlnet_cond_scale, list): controlnet_cond_scale = controlnet_cond_scale[0] cond_scale = controlnet_cond_scale * controlnet_keep[i] down_block_res_samples, mid_block_res_sample = self.controlnet( control_model_input, t, encoder_hidden_states=controlnet_prompt_embeds, controlnet_cond=control_image, conditioning_scale=cond_scale, guess_mode=guess_mode, added_cond_kwargs=controlnet_added_cond_kwargs, return_dict=False, ) if guess_mode and self.do_classifier_free_guidance: # Infered ControlNet only for the conditional batch. # To apply the output of ControlNet to both the unconditional and conditional batches, # add 0 to the unconditional batch to keep it unchanged. down_block_res_samples = [torch.cat([torch.zeros_like(d), d]) for d in down_block_res_samples] mid_block_res_sample = torch.cat([torch.zeros_like(mid_block_res_sample), mid_block_res_sample]) if ip_adapter_image is not None: added_cond_kwargs["image_embeds"] = image_embeds # predict the noise residual noise_pred = self.unet( latent_model_input, t, encoder_hidden_states=prompt_embeds, cross_attention_kwargs=self.cross_attention_kwargs, down_block_additional_residuals=down_block_res_samples, mid_block_additional_residual=mid_block_res_sample, added_cond_kwargs=added_cond_kwargs, return_dict=False, )[0] # perform guidance if self.do_classifier_free_guidance: noise_pred_uncond, noise_pred_text = noise_pred.chunk(2) noise_pred = noise_pred_uncond + guidance_scale * (noise_pred_text - noise_pred_uncond) # compute the previous noisy sample x_t -> x_t-1 latents = self.scheduler.step(noise_pred, t, latents, **extra_step_kwargs, return_dict=False)[0] if callback_on_step_end is not None: callback_kwargs = {} for k in callback_on_step_end_tensor_inputs: callback_kwargs[k] = locals()[k] callback_outputs = callback_on_step_end(self, i, t, callback_kwargs) latents = callback_outputs.pop("latents", latents) prompt_embeds = callback_outputs.pop("prompt_embeds", prompt_embeds) negative_prompt_embeds = callback_outputs.pop("negative_prompt_embeds", negative_prompt_embeds) # call the callback, if provided if i == len(timesteps) - 1 or ((i + 1) > num_warmup_steps and (i + 1) % self.scheduler.order == 0): progress_bar.update() if callback is not None and i % callback_steps == 0: step_idx = i // getattr(self.scheduler, "order", 1) callback(step_idx, t, latents) # If we do sequential model offloading, let's offload unet and controlnet # manually for max memory savings if hasattr(self, "final_offload_hook") and self.final_offload_hook is not None: self.unet.to("cpu") self.controlnet.to("cpu") torch.cuda.empty_cache() if not output_type == "latent": # make sure the VAE is in float32 mode, as it overflows in float16 needs_upcasting = self.vae.dtype == torch.float16 and self.vae.config.force_upcast if needs_upcasting: self.upcast_vae() latents = latents.to(next(iter(self.vae.post_quant_conv.parameters())).dtype) image = self.vae.decode(latents / self.vae.config.scaling_factor, return_dict=False)[0] # cast back to fp16 if needed if needs_upcasting: self.vae.to(dtype=torch.float16) else: image = latents return StableDiffusionXLPipelineOutput(images=image) # apply watermark if available if self.watermark is not None: image = self.watermark.apply_watermark(image) image = self.image_processor.postprocess(image, output_type=output_type) # Offload all models self.maybe_free_model_hooks() if not return_dict: return (image,) return StableDiffusionXLPipelineOutput(images=image)
diffusers/src/diffusers/pipelines/controlnet/pipeline_controlnet_sd_xl_img2img.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/controlnet/pipeline_controlnet_sd_xl_img2img.py", "repo_id": "diffusers", "token_count": 37327 }
116
import numpy as np import torch import torch.nn as nn from transformers import CLIPConfig, CLIPVisionModelWithProjection, PreTrainedModel from ...utils import logging logger = logging.get_logger(__name__) class IFSafetyChecker(PreTrainedModel): config_class = CLIPConfig _no_split_modules = ["CLIPEncoderLayer"] def __init__(self, config: CLIPConfig): super().__init__(config) self.vision_model = CLIPVisionModelWithProjection(config.vision_config) self.p_head = nn.Linear(config.vision_config.projection_dim, 1) self.w_head = nn.Linear(config.vision_config.projection_dim, 1) @torch.no_grad() def forward(self, clip_input, images, p_threshold=0.5, w_threshold=0.5): image_embeds = self.vision_model(clip_input)[0] nsfw_detected = self.p_head(image_embeds) nsfw_detected = nsfw_detected.flatten() nsfw_detected = nsfw_detected > p_threshold nsfw_detected = nsfw_detected.tolist() if any(nsfw_detected): logger.warning( "Potential NSFW content was detected in one or more images. A black image will be returned instead." " Try again with a different prompt and/or seed." ) for idx, nsfw_detected_ in enumerate(nsfw_detected): if nsfw_detected_: images[idx] = np.zeros(images[idx].shape) watermark_detected = self.w_head(image_embeds) watermark_detected = watermark_detected.flatten() watermark_detected = watermark_detected > w_threshold watermark_detected = watermark_detected.tolist() if any(watermark_detected): logger.warning( "Potential watermarked content was detected in one or more images. A black image will be returned instead." " Try again with a different prompt and/or seed." ) for idx, watermark_detected_ in enumerate(watermark_detected): if watermark_detected_: images[idx] = np.zeros(images[idx].shape) return images, nsfw_detected, watermark_detected
diffusers/src/diffusers/pipelines/deepfloyd_if/safety_checker.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/deepfloyd_if/safety_checker.py", "repo_id": "diffusers", "token_count": 913 }
117
# Copyright 2023 Pix2Pix Zero Authors and The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import inspect from dataclasses import dataclass from typing import Any, Callable, Dict, List, Optional, Union import numpy as np import PIL.Image import torch import torch.nn.functional as F from transformers import ( BlipForConditionalGeneration, BlipProcessor, CLIPImageProcessor, CLIPTextModel, CLIPTokenizer, ) from ....image_processor import PipelineImageInput, VaeImageProcessor from ....loaders import LoraLoaderMixin, TextualInversionLoaderMixin from ....models import AutoencoderKL, UNet2DConditionModel from ....models.attention_processor import Attention from ....models.lora import adjust_lora_scale_text_encoder from ....schedulers import DDIMScheduler, DDPMScheduler, EulerAncestralDiscreteScheduler, LMSDiscreteScheduler from ....schedulers.scheduling_ddim_inverse import DDIMInverseScheduler from ....utils import ( PIL_INTERPOLATION, USE_PEFT_BACKEND, BaseOutput, deprecate, logging, replace_example_docstring, scale_lora_layers, unscale_lora_layers, ) from ....utils.torch_utils import randn_tensor from ...pipeline_utils import DiffusionPipeline from ...stable_diffusion.pipeline_output import StableDiffusionPipelineOutput from ...stable_diffusion.safety_checker import StableDiffusionSafetyChecker logger = logging.get_logger(__name__) # pylint: disable=invalid-name @dataclass class Pix2PixInversionPipelineOutput(BaseOutput, TextualInversionLoaderMixin): """ Output class for Stable Diffusion pipelines. Args: latents (`torch.FloatTensor`) inverted latents tensor images (`List[PIL.Image.Image]` or `np.ndarray`) List of denoised PIL images of length `batch_size` or numpy array of shape `(batch_size, height, width, num_channels)`. PIL images or numpy array present the denoised images of the diffusion pipeline. """ latents: torch.FloatTensor images: Union[List[PIL.Image.Image], np.ndarray] EXAMPLE_DOC_STRING = """ Examples: ```py >>> import requests >>> import torch >>> from diffusers import DDIMScheduler, StableDiffusionPix2PixZeroPipeline >>> def download(embedding_url, local_filepath): ... r = requests.get(embedding_url) ... with open(local_filepath, "wb") as f: ... f.write(r.content) >>> model_ckpt = "CompVis/stable-diffusion-v1-4" >>> pipeline = StableDiffusionPix2PixZeroPipeline.from_pretrained(model_ckpt, torch_dtype=torch.float16) >>> pipeline.scheduler = DDIMScheduler.from_config(pipeline.scheduler.config) >>> pipeline.to("cuda") >>> prompt = "a high resolution painting of a cat in the style of van gough" >>> source_emb_url = "https://hf.co/datasets/sayakpaul/sample-datasets/resolve/main/cat.pt" >>> target_emb_url = "https://hf.co/datasets/sayakpaul/sample-datasets/resolve/main/dog.pt" >>> for url in [source_emb_url, target_emb_url]: ... download(url, url.split("/")[-1]) >>> src_embeds = torch.load(source_emb_url.split("/")[-1]) >>> target_embeds = torch.load(target_emb_url.split("/")[-1]) >>> images = pipeline( ... prompt, ... source_embeds=src_embeds, ... target_embeds=target_embeds, ... num_inference_steps=50, ... cross_attention_guidance_amount=0.15, ... ).images >>> images[0].save("edited_image_dog.png") ``` """ EXAMPLE_INVERT_DOC_STRING = """ Examples: ```py >>> import torch >>> from transformers import BlipForConditionalGeneration, BlipProcessor >>> from diffusers import DDIMScheduler, DDIMInverseScheduler, StableDiffusionPix2PixZeroPipeline >>> import requests >>> from PIL import Image >>> captioner_id = "Salesforce/blip-image-captioning-base" >>> processor = BlipProcessor.from_pretrained(captioner_id) >>> model = BlipForConditionalGeneration.from_pretrained( ... captioner_id, torch_dtype=torch.float16, low_cpu_mem_usage=True ... ) >>> sd_model_ckpt = "CompVis/stable-diffusion-v1-4" >>> pipeline = StableDiffusionPix2PixZeroPipeline.from_pretrained( ... sd_model_ckpt, ... caption_generator=model, ... caption_processor=processor, ... torch_dtype=torch.float16, ... safety_checker=None, ... ) >>> pipeline.scheduler = DDIMScheduler.from_config(pipeline.scheduler.config) >>> pipeline.inverse_scheduler = DDIMInverseScheduler.from_config(pipeline.scheduler.config) >>> pipeline.enable_model_cpu_offload() >>> img_url = "https://github.com/pix2pixzero/pix2pix-zero/raw/main/assets/test_images/cats/cat_6.png" >>> raw_image = Image.open(requests.get(img_url, stream=True).raw).convert("RGB").resize((512, 512)) >>> # generate caption >>> caption = pipeline.generate_caption(raw_image) >>> # "a photography of a cat with flowers and dai dai daie - daie - daie kasaii" >>> inv_latents = pipeline.invert(caption, image=raw_image).latents >>> # we need to generate source and target embeds >>> source_prompts = ["a cat sitting on the street", "a cat playing in the field", "a face of a cat"] >>> target_prompts = ["a dog sitting on the street", "a dog playing in the field", "a face of a dog"] >>> source_embeds = pipeline.get_embeds(source_prompts) >>> target_embeds = pipeline.get_embeds(target_prompts) >>> # the latents can then be used to edit a real image >>> # when using Stable Diffusion 2 or other models that use v-prediction >>> # set `cross_attention_guidance_amount` to 0.01 or less to avoid input latent gradient explosion >>> image = pipeline( ... caption, ... source_embeds=source_embeds, ... target_embeds=target_embeds, ... num_inference_steps=50, ... cross_attention_guidance_amount=0.15, ... generator=generator, ... latents=inv_latents, ... negative_prompt=caption, ... ).images[0] >>> image.save("edited_image.png") ``` """ # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion_img2img.preprocess def preprocess(image): deprecation_message = "The preprocess method is deprecated and will be removed in diffusers 1.0.0. Please use VaeImageProcessor.preprocess(...) instead" deprecate("preprocess", "1.0.0", deprecation_message, standard_warn=False) if isinstance(image, torch.Tensor): return image elif isinstance(image, PIL.Image.Image): image = [image] if isinstance(image[0], PIL.Image.Image): w, h = image[0].size w, h = (x - x % 8 for x in (w, h)) # resize to integer multiple of 8 image = [np.array(i.resize((w, h), resample=PIL_INTERPOLATION["lanczos"]))[None, :] for i in image] image = np.concatenate(image, axis=0) image = np.array(image).astype(np.float32) / 255.0 image = image.transpose(0, 3, 1, 2) image = 2.0 * image - 1.0 image = torch.from_numpy(image) elif isinstance(image[0], torch.Tensor): image = torch.cat(image, dim=0) return image def prepare_unet(unet: UNet2DConditionModel): """Modifies the UNet (`unet`) to perform Pix2Pix Zero optimizations.""" pix2pix_zero_attn_procs = {} for name in unet.attn_processors.keys(): module_name = name.replace(".processor", "") module = unet.get_submodule(module_name) if "attn2" in name: pix2pix_zero_attn_procs[name] = Pix2PixZeroAttnProcessor(is_pix2pix_zero=True) module.requires_grad_(True) else: pix2pix_zero_attn_procs[name] = Pix2PixZeroAttnProcessor(is_pix2pix_zero=False) module.requires_grad_(False) unet.set_attn_processor(pix2pix_zero_attn_procs) return unet class Pix2PixZeroL2Loss: def __init__(self): self.loss = 0.0 def compute_loss(self, predictions, targets): self.loss += ((predictions - targets) ** 2).sum((1, 2)).mean(0) class Pix2PixZeroAttnProcessor: """An attention processor class to store the attention weights. In Pix2Pix Zero, it happens during computations in the cross-attention blocks.""" def __init__(self, is_pix2pix_zero=False): self.is_pix2pix_zero = is_pix2pix_zero if self.is_pix2pix_zero: self.reference_cross_attn_map = {} def __call__( self, attn: Attention, hidden_states, encoder_hidden_states=None, attention_mask=None, timestep=None, loss=None, ): batch_size, sequence_length, _ = hidden_states.shape attention_mask = attn.prepare_attention_mask(attention_mask, sequence_length, batch_size) query = attn.to_q(hidden_states) if encoder_hidden_states is None: encoder_hidden_states = hidden_states elif attn.norm_cross: encoder_hidden_states = attn.norm_encoder_hidden_states(encoder_hidden_states) key = attn.to_k(encoder_hidden_states) value = attn.to_v(encoder_hidden_states) query = attn.head_to_batch_dim(query) key = attn.head_to_batch_dim(key) value = attn.head_to_batch_dim(value) attention_probs = attn.get_attention_scores(query, key, attention_mask) if self.is_pix2pix_zero and timestep is not None: # new bookkeeping to save the attention weights. if loss is None: self.reference_cross_attn_map[timestep.item()] = attention_probs.detach().cpu() # compute loss elif loss is not None: prev_attn_probs = self.reference_cross_attn_map.pop(timestep.item()) loss.compute_loss(attention_probs, prev_attn_probs.to(attention_probs.device)) hidden_states = torch.bmm(attention_probs, value) hidden_states = attn.batch_to_head_dim(hidden_states) # linear proj hidden_states = attn.to_out[0](hidden_states) # dropout hidden_states = attn.to_out[1](hidden_states) return hidden_states class StableDiffusionPix2PixZeroPipeline(DiffusionPipeline): r""" Pipeline for pixel-level image editing using Pix2Pix Zero. Based on Stable Diffusion. This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods the library implements for all the pipelines (such as downloading or saving, running on a particular device, etc.) Args: vae ([`AutoencoderKL`]): Variational Auto-Encoder (VAE) Model to encode and decode images to and from latent representations. text_encoder ([`CLIPTextModel`]): Frozen text-encoder. Stable Diffusion uses the text portion of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip#transformers.CLIPTextModel), specifically the [clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14) variant. tokenizer (`CLIPTokenizer`): Tokenizer of class [CLIPTokenizer](https://huggingface.co/docs/transformers/v4.21.0/en/model_doc/clip#transformers.CLIPTokenizer). unet ([`UNet2DConditionModel`]): Conditional U-Net architecture to denoise the encoded image latents. scheduler ([`SchedulerMixin`]): A scheduler to be used in combination with `unet` to denoise the encoded image latents. Can be one of [`DDIMScheduler`], [`LMSDiscreteScheduler`], [`EulerAncestralDiscreteScheduler`], or [`DDPMScheduler`]. safety_checker ([`StableDiffusionSafetyChecker`]): Classification module that estimates whether generated images could be considered offensive or harmful. Please, refer to the [model card](https://huggingface.co/runwayml/stable-diffusion-v1-5) for details. feature_extractor ([`CLIPImageProcessor`]): Model that extracts features from generated images to be used as inputs for the `safety_checker`. requires_safety_checker (bool): Whether the pipeline requires a safety checker. We recommend setting it to True if you're using the pipeline publicly. """ model_cpu_offload_seq = "text_encoder->unet->vae" _optional_components = [ "safety_checker", "feature_extractor", "caption_generator", "caption_processor", "inverse_scheduler", ] _exclude_from_cpu_offload = ["safety_checker"] def __init__( self, vae: AutoencoderKL, text_encoder: CLIPTextModel, tokenizer: CLIPTokenizer, unet: UNet2DConditionModel, scheduler: Union[DDPMScheduler, DDIMScheduler, EulerAncestralDiscreteScheduler, LMSDiscreteScheduler], feature_extractor: CLIPImageProcessor, safety_checker: StableDiffusionSafetyChecker, inverse_scheduler: DDIMInverseScheduler, caption_generator: BlipForConditionalGeneration, caption_processor: BlipProcessor, requires_safety_checker: bool = True, ): super().__init__() if safety_checker is None and requires_safety_checker: logger.warning( f"You have disabled the safety checker for {self.__class__} by passing `safety_checker=None`. Ensure" " that you abide to the conditions of the Stable Diffusion license and do not expose unfiltered" " results in services or applications open to the public. Both the diffusers team and Hugging Face" " strongly recommend to keep the safety filter enabled in all public facing circumstances, disabling" " it only for use-cases that involve analyzing network behavior or auditing its results. For more" " information, please have a look at https://github.com/huggingface/diffusers/pull/254 ." ) if safety_checker is not None and feature_extractor is None: raise ValueError( "Make sure to define a feature extractor when loading {self.__class__} if you want to use the safety" " checker. If you do not want to use the safety checker, you can pass `'safety_checker=None'` instead." ) self.register_modules( vae=vae, text_encoder=text_encoder, tokenizer=tokenizer, unet=unet, scheduler=scheduler, safety_checker=safety_checker, feature_extractor=feature_extractor, caption_processor=caption_processor, caption_generator=caption_generator, inverse_scheduler=inverse_scheduler, ) self.vae_scale_factor = 2 ** (len(self.vae.config.block_out_channels) - 1) self.image_processor = VaeImageProcessor(vae_scale_factor=self.vae_scale_factor) self.register_to_config(requires_safety_checker=requires_safety_checker) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline._encode_prompt def _encode_prompt( self, prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt=None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, **kwargs, ): deprecation_message = "`_encode_prompt()` is deprecated and it will be removed in a future version. Use `encode_prompt()` instead. Also, be aware that the output format changed from a concatenated tensor to a tuple." deprecate("_encode_prompt()", "1.0.0", deprecation_message, standard_warn=False) prompt_embeds_tuple = self.encode_prompt( prompt=prompt, device=device, num_images_per_prompt=num_images_per_prompt, do_classifier_free_guidance=do_classifier_free_guidance, negative_prompt=negative_prompt, prompt_embeds=prompt_embeds, negative_prompt_embeds=negative_prompt_embeds, lora_scale=lora_scale, **kwargs, ) # concatenate for backwards comp prompt_embeds = torch.cat([prompt_embeds_tuple[1], prompt_embeds_tuple[0]]) return prompt_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.encode_prompt def encode_prompt( self, prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt=None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, clip_skip: Optional[int] = None, ): r""" Encodes the prompt into text encoder hidden states. Args: prompt (`str` or `List[str]`, *optional*): prompt to be encoded device: (`torch.device`): torch device num_images_per_prompt (`int`): number of images that should be generated per prompt do_classifier_free_guidance (`bool`): whether to use classifier free guidance or not negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. lora_scale (`float`, *optional*): A LoRA scale that will be applied to all LoRA layers of the text encoder if LoRA layers are loaded. clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. """ # set lora scale so that monkey patched LoRA # function of text encoder can correctly access it if lora_scale is not None and isinstance(self, LoraLoaderMixin): self._lora_scale = lora_scale # dynamically adjust the LoRA scale if not USE_PEFT_BACKEND: adjust_lora_scale_text_encoder(self.text_encoder, lora_scale) else: scale_lora_layers(self.text_encoder, lora_scale) if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if prompt_embeds is None: # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): prompt = self.maybe_convert_prompt(prompt, self.tokenizer) text_inputs = self.tokenizer( prompt, padding="max_length", max_length=self.tokenizer.model_max_length, truncation=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = self.tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal( text_input_ids, untruncated_ids ): removed_text = self.tokenizer.batch_decode( untruncated_ids[:, self.tokenizer.model_max_length - 1 : -1] ) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {self.tokenizer.model_max_length} tokens: {removed_text}" ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = text_inputs.attention_mask.to(device) else: attention_mask = None if clip_skip is None: prompt_embeds = self.text_encoder(text_input_ids.to(device), attention_mask=attention_mask) prompt_embeds = prompt_embeds[0] else: prompt_embeds = self.text_encoder( text_input_ids.to(device), attention_mask=attention_mask, output_hidden_states=True ) # Access the `hidden_states` first, that contains a tuple of # all the hidden states from the encoder layers. Then index into # the tuple to access the hidden states from the desired layer. prompt_embeds = prompt_embeds[-1][-(clip_skip + 1)] # We also need to apply the final LayerNorm here to not mess with the # representations. The `last_hidden_states` that we typically use for # obtaining the final prompt representations passes through the LayerNorm # layer. prompt_embeds = self.text_encoder.text_model.final_layer_norm(prompt_embeds) if self.text_encoder is not None: prompt_embeds_dtype = self.text_encoder.dtype elif self.unet is not None: prompt_embeds_dtype = self.unet.dtype else: prompt_embeds_dtype = prompt_embeds.dtype prompt_embeds = prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) bs_embed, seq_len, _ = prompt_embeds.shape # duplicate text embeddings for each generation per prompt, using mps friendly method prompt_embeds = prompt_embeds.repeat(1, num_images_per_prompt, 1) prompt_embeds = prompt_embeds.view(bs_embed * num_images_per_prompt, seq_len, -1) # get unconditional embeddings for classifier free guidance if do_classifier_free_guidance and negative_prompt_embeds is None: uncond_tokens: List[str] if negative_prompt is None: uncond_tokens = [""] * batch_size elif prompt is not None and type(prompt) is not type(negative_prompt): raise TypeError( f"`negative_prompt` should be the same type to `prompt`, but got {type(negative_prompt)} !=" f" {type(prompt)}." ) elif isinstance(negative_prompt, str): uncond_tokens = [negative_prompt] elif batch_size != len(negative_prompt): raise ValueError( f"`negative_prompt`: {negative_prompt} has batch size {len(negative_prompt)}, but `prompt`:" f" {prompt} has batch size {batch_size}. Please make sure that passed `negative_prompt` matches" " the batch size of `prompt`." ) else: uncond_tokens = negative_prompt # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): uncond_tokens = self.maybe_convert_prompt(uncond_tokens, self.tokenizer) max_length = prompt_embeds.shape[1] uncond_input = self.tokenizer( uncond_tokens, padding="max_length", max_length=max_length, truncation=True, return_tensors="pt", ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = uncond_input.attention_mask.to(device) else: attention_mask = None negative_prompt_embeds = self.text_encoder( uncond_input.input_ids.to(device), attention_mask=attention_mask, ) negative_prompt_embeds = negative_prompt_embeds[0] if do_classifier_free_guidance: # duplicate unconditional embeddings for each generation per prompt, using mps friendly method seq_len = negative_prompt_embeds.shape[1] negative_prompt_embeds = negative_prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) negative_prompt_embeds = negative_prompt_embeds.repeat(1, num_images_per_prompt, 1) negative_prompt_embeds = negative_prompt_embeds.view(batch_size * num_images_per_prompt, seq_len, -1) if isinstance(self, LoraLoaderMixin) and USE_PEFT_BACKEND: # Retrieve the original scale by scaling back the LoRA layers unscale_lora_layers(self.text_encoder, lora_scale) return prompt_embeds, negative_prompt_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.run_safety_checker def run_safety_checker(self, image, device, dtype): if self.safety_checker is None: has_nsfw_concept = None else: if torch.is_tensor(image): feature_extractor_input = self.image_processor.postprocess(image, output_type="pil") else: feature_extractor_input = self.image_processor.numpy_to_pil(image) safety_checker_input = self.feature_extractor(feature_extractor_input, return_tensors="pt").to(device) image, has_nsfw_concept = self.safety_checker( images=image, clip_input=safety_checker_input.pixel_values.to(dtype) ) return image, has_nsfw_concept # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.decode_latents def decode_latents(self, latents): deprecation_message = "The decode_latents method is deprecated and will be removed in 1.0.0. Please use VaeImageProcessor.postprocess(...) instead" deprecate("decode_latents", "1.0.0", deprecation_message, standard_warn=False) latents = 1 / self.vae.config.scaling_factor * latents image = self.vae.decode(latents, return_dict=False)[0] image = (image / 2 + 0.5).clamp(0, 1) # we always cast to float32 as this does not cause significant overhead and is compatible with bfloat16 image = image.cpu().permute(0, 2, 3, 1).float().numpy() return image # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_extra_step_kwargs def prepare_extra_step_kwargs(self, generator, eta): # prepare extra kwargs for the scheduler step, since not all schedulers have the same signature # eta (ฮท) is only used with the DDIMScheduler, it will be ignored for other schedulers. # eta corresponds to ฮท in DDIM paper: https://arxiv.org/abs/2010.02502 # and should be between [0, 1] accepts_eta = "eta" in set(inspect.signature(self.scheduler.step).parameters.keys()) extra_step_kwargs = {} if accepts_eta: extra_step_kwargs["eta"] = eta # check if the scheduler accepts generator accepts_generator = "generator" in set(inspect.signature(self.scheduler.step).parameters.keys()) if accepts_generator: extra_step_kwargs["generator"] = generator return extra_step_kwargs def check_inputs( self, prompt, source_embeds, target_embeds, callback_steps, prompt_embeds=None, ): if (callback_steps is None) or ( callback_steps is not None and (not isinstance(callback_steps, int) or callback_steps <= 0) ): raise ValueError( f"`callback_steps` has to be a positive integer but is {callback_steps} of type" f" {type(callback_steps)}." ) if source_embeds is None and target_embeds is None: raise ValueError("`source_embeds` and `target_embeds` cannot be undefined.") if prompt is not None and prompt_embeds is not None: raise ValueError( f"Cannot forward both `prompt`: {prompt} and `prompt_embeds`: {prompt_embeds}. Please make sure to" " only forward one of the two." ) elif prompt is None and prompt_embeds is None: raise ValueError( "Provide either `prompt` or `prompt_embeds`. Cannot leave both `prompt` and `prompt_embeds` undefined." ) elif prompt is not None and (not isinstance(prompt, str) and not isinstance(prompt, list)): raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_latents def prepare_latents(self, batch_size, num_channels_latents, height, width, dtype, device, generator, latents=None): shape = (batch_size, num_channels_latents, height // self.vae_scale_factor, width // self.vae_scale_factor) if isinstance(generator, list) and len(generator) != batch_size: raise ValueError( f"You have passed a list of generators of length {len(generator)}, but requested an effective batch" f" size of {batch_size}. Make sure the batch size matches the length of the generators." ) if latents is None: latents = randn_tensor(shape, generator=generator, device=device, dtype=dtype) else: latents = latents.to(device) # scale the initial noise by the standard deviation required by the scheduler latents = latents * self.scheduler.init_noise_sigma return latents @torch.no_grad() def generate_caption(self, images): """Generates caption for a given image.""" text = "a photography of" prev_device = self.caption_generator.device device = self._execution_device inputs = self.caption_processor(images, text, return_tensors="pt").to( device=device, dtype=self.caption_generator.dtype ) self.caption_generator.to(device) outputs = self.caption_generator.generate(**inputs, max_new_tokens=128) # offload caption generator self.caption_generator.to(prev_device) caption = self.caption_processor.batch_decode(outputs, skip_special_tokens=True)[0] return caption def construct_direction(self, embs_source: torch.Tensor, embs_target: torch.Tensor): """Constructs the edit direction to steer the image generation process semantically.""" return (embs_target.mean(0) - embs_source.mean(0)).unsqueeze(0) @torch.no_grad() def get_embeds(self, prompt: List[str], batch_size: int = 16) -> torch.FloatTensor: num_prompts = len(prompt) embeds = [] for i in range(0, num_prompts, batch_size): prompt_slice = prompt[i : i + batch_size] input_ids = self.tokenizer( prompt_slice, padding="max_length", max_length=self.tokenizer.model_max_length, truncation=True, return_tensors="pt", ).input_ids input_ids = input_ids.to(self.text_encoder.device) embeds.append(self.text_encoder(input_ids)[0]) return torch.cat(embeds, dim=0).mean(0)[None] def prepare_image_latents(self, image, batch_size, dtype, device, generator=None): if not isinstance(image, (torch.Tensor, PIL.Image.Image, list)): raise ValueError( f"`image` has to be of type `torch.Tensor`, `PIL.Image.Image` or list but is {type(image)}" ) image = image.to(device=device, dtype=dtype) if image.shape[1] == 4: latents = image else: if isinstance(generator, list) and len(generator) != batch_size: raise ValueError( f"You have passed a list of generators of length {len(generator)}, but requested an effective batch" f" size of {batch_size}. Make sure the batch size matches the length of the generators." ) if isinstance(generator, list): latents = [ self.vae.encode(image[i : i + 1]).latent_dist.sample(generator[i]) for i in range(batch_size) ] latents = torch.cat(latents, dim=0) else: latents = self.vae.encode(image).latent_dist.sample(generator) latents = self.vae.config.scaling_factor * latents if batch_size != latents.shape[0]: if batch_size % latents.shape[0] == 0: # expand image_latents for batch_size deprecation_message = ( f"You have passed {batch_size} text prompts (`prompt`), but only {latents.shape[0]} initial" " images (`image`). Initial images are now duplicating to match the number of text prompts. Note" " that this behavior is deprecated and will be removed in a version 1.0.0. Please make sure to update" " your script to pass as many initial images as text prompts to suppress this warning." ) deprecate("len(prompt) != len(image)", "1.0.0", deprecation_message, standard_warn=False) additional_latents_per_image = batch_size // latents.shape[0] latents = torch.cat([latents] * additional_latents_per_image, dim=0) else: raise ValueError( f"Cannot duplicate `image` of batch size {latents.shape[0]} to {batch_size} text prompts." ) else: latents = torch.cat([latents], dim=0) return latents def get_epsilon(self, model_output: torch.Tensor, sample: torch.Tensor, timestep: int): pred_type = self.inverse_scheduler.config.prediction_type alpha_prod_t = self.inverse_scheduler.alphas_cumprod[timestep] beta_prod_t = 1 - alpha_prod_t if pred_type == "epsilon": return model_output elif pred_type == "sample": return (sample - alpha_prod_t ** (0.5) * model_output) / beta_prod_t ** (0.5) elif pred_type == "v_prediction": return (alpha_prod_t**0.5) * model_output + (beta_prod_t**0.5) * sample else: raise ValueError( f"prediction_type given as {pred_type} must be one of `epsilon`, `sample`, or `v_prediction`" ) def auto_corr_loss(self, hidden_states, generator=None): reg_loss = 0.0 for i in range(hidden_states.shape[0]): for j in range(hidden_states.shape[1]): noise = hidden_states[i : i + 1, j : j + 1, :, :] while True: roll_amount = torch.randint(noise.shape[2] // 2, (1,), generator=generator).item() reg_loss += (noise * torch.roll(noise, shifts=roll_amount, dims=2)).mean() ** 2 reg_loss += (noise * torch.roll(noise, shifts=roll_amount, dims=3)).mean() ** 2 if noise.shape[2] <= 8: break noise = F.avg_pool2d(noise, kernel_size=2) return reg_loss def kl_divergence(self, hidden_states): mean = hidden_states.mean() var = hidden_states.var() return var + mean**2 - 1 - torch.log(var + 1e-7) @torch.no_grad() @replace_example_docstring(EXAMPLE_DOC_STRING) def __call__( self, prompt: Optional[Union[str, List[str]]] = None, source_embeds: torch.Tensor = None, target_embeds: torch.Tensor = None, height: Optional[int] = None, width: Optional[int] = None, num_inference_steps: int = 50, guidance_scale: float = 7.5, negative_prompt: Optional[Union[str, List[str]]] = None, num_images_per_prompt: Optional[int] = 1, eta: float = 0.0, generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, latents: Optional[torch.FloatTensor] = None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, cross_attention_guidance_amount: float = 0.1, output_type: Optional[str] = "pil", return_dict: bool = True, callback: Optional[Callable[[int, int, torch.FloatTensor], None]] = None, callback_steps: Optional[int] = 1, cross_attention_kwargs: Optional[Dict[str, Any]] = None, clip_skip: Optional[int] = None, ): r""" Function invoked when calling the pipeline for generation. Args: prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide the image generation. If not defined, one has to pass `prompt_embeds`. instead. source_embeds (`torch.Tensor`): Source concept embeddings. Generation of the embeddings as per the [original paper](https://arxiv.org/abs/2302.03027). Used in discovering the edit direction. target_embeds (`torch.Tensor`): Target concept embeddings. Generation of the embeddings as per the [original paper](https://arxiv.org/abs/2302.03027). Used in discovering the edit direction. height (`int`, *optional*, defaults to self.unet.config.sample_size * self.vae_scale_factor): The height in pixels of the generated image. width (`int`, *optional*, defaults to self.unet.config.sample_size * self.vae_scale_factor): The width in pixels of the generated image. num_inference_steps (`int`, *optional*, defaults to 50): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. guidance_scale (`float`, *optional*, defaults to 7.5): Guidance scale as defined in [Classifier-Free Diffusion Guidance](https://arxiv.org/abs/2207.12598). `guidance_scale` is defined as `w` of equation 2. of [Imagen Paper](https://arxiv.org/pdf/2205.11487.pdf). Guidance scale is enabled by setting `guidance_scale > 1`. Higher guidance scale encourages to generate images that are closely linked to the text `prompt`, usually at the expense of lower image quality. negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). num_images_per_prompt (`int`, *optional*, defaults to 1): The number of images to generate per prompt. eta (`float`, *optional*, defaults to 0.0): Corresponds to parameter eta (ฮท) in the DDIM paper: https://arxiv.org/abs/2010.02502. Only applies to [`schedulers.DDIMScheduler`], will be ignored for others. generator (`torch.Generator` or `List[torch.Generator]`, *optional*): One or a list of [torch generator(s)](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents, sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor will ge generated by sampling using the supplied random `generator`. prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. cross_attention_guidance_amount (`float`, defaults to 0.1): Amount of guidance needed from the reference cross-attention maps. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generate image. Choose between [PIL](https://pillow.readthedocs.io/en/stable/): `PIL.Image.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] instead of a plain tuple. callback (`Callable`, *optional*): A function that will be called every `callback_steps` steps during inference. The function will be called with the following arguments: `callback(step: int, timestep: int, latents: torch.FloatTensor)`. callback_steps (`int`, *optional*, defaults to 1): The frequency at which the `callback` function will be called. If not specified, the callback will be called at every step. clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. Examples: Returns: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] or `tuple`: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] if `return_dict` is True, otherwise a `tuple. When returning a tuple, the first element is a list with the generated images, and the second element is a list of `bool`s denoting whether the corresponding generated image likely represents "not-safe-for-work" (nsfw) content, according to the `safety_checker`. """ # 0. Define the spatial resolutions. height = height or self.unet.config.sample_size * self.vae_scale_factor width = width or self.unet.config.sample_size * self.vae_scale_factor # 1. Check inputs. Raise error if not correct self.check_inputs( prompt, source_embeds, target_embeds, callback_steps, prompt_embeds, ) # 3. Define call parameters if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if cross_attention_kwargs is None: cross_attention_kwargs = {} device = self._execution_device # here `guidance_scale` is defined analog to the guidance weight `w` of equation (2) # of the Imagen paper: https://arxiv.org/pdf/2205.11487.pdf . `guidance_scale = 1` # corresponds to doing no classifier free guidance. do_classifier_free_guidance = guidance_scale > 1.0 # 3. Encode input prompt prompt_embeds, negative_prompt_embeds = self.encode_prompt( prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt, prompt_embeds=prompt_embeds, negative_prompt_embeds=negative_prompt_embeds, clip_skip=clip_skip, ) # For classifier free guidance, we need to do two forward passes. # Here we concatenate the unconditional and text embeddings into a single batch # to avoid doing two forward passes if do_classifier_free_guidance: prompt_embeds = torch.cat([negative_prompt_embeds, prompt_embeds]) # 4. Prepare timesteps self.scheduler.set_timesteps(num_inference_steps, device=device) timesteps = self.scheduler.timesteps # 5. Generate the inverted noise from the input image or any other image # generated from the input prompt. num_channels_latents = self.unet.config.in_channels latents = self.prepare_latents( batch_size * num_images_per_prompt, num_channels_latents, height, width, prompt_embeds.dtype, device, generator, latents, ) latents_init = latents.clone() # 6. Prepare extra step kwargs. TODO: Logic should ideally just be moved out of the pipeline extra_step_kwargs = self.prepare_extra_step_kwargs(generator, eta) # 8. Rejig the UNet so that we can obtain the cross-attenion maps and # use them for guiding the subsequent image generation. self.unet = prepare_unet(self.unet) # 7. Denoising loop where we obtain the cross-attention maps. num_warmup_steps = len(timesteps) - num_inference_steps * self.scheduler.order with self.progress_bar(total=num_inference_steps) as progress_bar: for i, t in enumerate(timesteps): # expand the latents if we are doing classifier free guidance latent_model_input = torch.cat([latents] * 2) if do_classifier_free_guidance else latents latent_model_input = self.scheduler.scale_model_input(latent_model_input, t) # predict the noise residual noise_pred = self.unet( latent_model_input, t, encoder_hidden_states=prompt_embeds, cross_attention_kwargs={"timestep": t}, ).sample # perform guidance if do_classifier_free_guidance: noise_pred_uncond, noise_pred_text = noise_pred.chunk(2) noise_pred = noise_pred_uncond + guidance_scale * (noise_pred_text - noise_pred_uncond) # compute the previous noisy sample x_t -> x_t-1 latents = self.scheduler.step(noise_pred, t, latents, **extra_step_kwargs).prev_sample # call the callback, if provided if i == len(timesteps) - 1 or ((i + 1) > num_warmup_steps and (i + 1) % self.scheduler.order == 0): progress_bar.update() if callback is not None and i % callback_steps == 0: step_idx = i // getattr(self.scheduler, "order", 1) callback(step_idx, t, latents) # 8. Compute the edit directions. edit_direction = self.construct_direction(source_embeds, target_embeds).to(prompt_embeds.device) # 9. Edit the prompt embeddings as per the edit directions discovered. prompt_embeds_edit = prompt_embeds.clone() prompt_embeds_edit[1:2] += edit_direction # 10. Second denoising loop to generate the edited image. self.scheduler.set_timesteps(num_inference_steps, device=device) timesteps = self.scheduler.timesteps latents = latents_init num_warmup_steps = len(timesteps) - num_inference_steps * self.scheduler.order with self.progress_bar(total=num_inference_steps) as progress_bar: for i, t in enumerate(timesteps): # expand the latents if we are doing classifier free guidance latent_model_input = torch.cat([latents] * 2) if do_classifier_free_guidance else latents latent_model_input = self.scheduler.scale_model_input(latent_model_input, t) # we want to learn the latent such that it steers the generation # process towards the edited direction, so make the make initial # noise learnable x_in = latent_model_input.detach().clone() x_in.requires_grad = True # optimizer opt = torch.optim.SGD([x_in], lr=cross_attention_guidance_amount) with torch.enable_grad(): # initialize loss loss = Pix2PixZeroL2Loss() # predict the noise residual noise_pred = self.unet( x_in, t, encoder_hidden_states=prompt_embeds_edit.detach(), cross_attention_kwargs={"timestep": t, "loss": loss}, ).sample loss.loss.backward(retain_graph=False) opt.step() # recompute the noise noise_pred = self.unet( x_in.detach(), t, encoder_hidden_states=prompt_embeds_edit, cross_attention_kwargs={"timestep": None}, ).sample latents = x_in.detach().chunk(2)[0] # perform guidance if do_classifier_free_guidance: noise_pred_uncond, noise_pred_text = noise_pred.chunk(2) noise_pred = noise_pred_uncond + guidance_scale * (noise_pred_text - noise_pred_uncond) # compute the previous noisy sample x_t -> x_t-1 latents = self.scheduler.step(noise_pred, t, latents, **extra_step_kwargs).prev_sample # call the callback, if provided if i == len(timesteps) - 1 or ((i + 1) > num_warmup_steps and (i + 1) % self.scheduler.order == 0): progress_bar.update() if not output_type == "latent": image = self.vae.decode(latents / self.vae.config.scaling_factor, return_dict=False)[0] image, has_nsfw_concept = self.run_safety_checker(image, device, prompt_embeds.dtype) else: image = latents has_nsfw_concept = None if has_nsfw_concept is None: do_denormalize = [True] * image.shape[0] else: do_denormalize = [not has_nsfw for has_nsfw in has_nsfw_concept] image = self.image_processor.postprocess(image, output_type=output_type, do_denormalize=do_denormalize) # Offload all models self.maybe_free_model_hooks() if not return_dict: return (image, has_nsfw_concept) return StableDiffusionPipelineOutput(images=image, nsfw_content_detected=has_nsfw_concept) @torch.no_grad() @replace_example_docstring(EXAMPLE_INVERT_DOC_STRING) def invert( self, prompt: Optional[str] = None, image: PipelineImageInput = None, num_inference_steps: int = 50, guidance_scale: float = 1, generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, latents: Optional[torch.FloatTensor] = None, prompt_embeds: Optional[torch.FloatTensor] = None, cross_attention_guidance_amount: float = 0.1, output_type: Optional[str] = "pil", return_dict: bool = True, callback: Optional[Callable[[int, int, torch.FloatTensor], None]] = None, callback_steps: Optional[int] = 1, cross_attention_kwargs: Optional[Dict[str, Any]] = None, lambda_auto_corr: float = 20.0, lambda_kl: float = 20.0, num_reg_steps: int = 5, num_auto_corr_rolls: int = 5, ): r""" Function used to generate inverted latents given a prompt and image. Args: prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide the image generation. If not defined, one has to pass `prompt_embeds`. instead. image (`torch.FloatTensor` `np.ndarray`, `PIL.Image.Image`, `List[torch.FloatTensor]`, `List[PIL.Image.Image]`, or `List[np.ndarray]`): `Image`, or tensor representing an image batch which will be used for conditioning. Can also accept image latents as `image`, if passing latents directly, it will not be encoded again. num_inference_steps (`int`, *optional*, defaults to 50): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. guidance_scale (`float`, *optional*, defaults to 1): Guidance scale as defined in [Classifier-Free Diffusion Guidance](https://arxiv.org/abs/2207.12598). `guidance_scale` is defined as `w` of equation 2. of [Imagen Paper](https://arxiv.org/pdf/2205.11487.pdf). Guidance scale is enabled by setting `guidance_scale > 1`. Higher guidance scale encourages to generate images that are closely linked to the text `prompt`, usually at the expense of lower image quality. generator (`torch.Generator` or `List[torch.Generator]`, *optional*): One or a list of [torch generator(s)](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents, sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor will ge generated by sampling using the supplied random `generator`. prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. cross_attention_guidance_amount (`float`, defaults to 0.1): Amount of guidance needed from the reference cross-attention maps. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generate image. Choose between [PIL](https://pillow.readthedocs.io/en/stable/): `PIL.Image.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] instead of a plain tuple. callback (`Callable`, *optional*): A function that will be called every `callback_steps` steps during inference. The function will be called with the following arguments: `callback(step: int, timestep: int, latents: torch.FloatTensor)`. callback_steps (`int`, *optional*, defaults to 1): The frequency at which the `callback` function will be called. If not specified, the callback will be called at every step. lambda_auto_corr (`float`, *optional*, defaults to 20.0): Lambda parameter to control auto correction lambda_kl (`float`, *optional*, defaults to 20.0): Lambda parameter to control Kullbackโ€“Leibler divergence output num_reg_steps (`int`, *optional*, defaults to 5): Number of regularization loss steps num_auto_corr_rolls (`int`, *optional*, defaults to 5): Number of auto correction roll steps Examples: Returns: [`~pipelines.stable_diffusion.pipeline_stable_diffusion_pix2pix_zero.Pix2PixInversionPipelineOutput`] or `tuple`: [`~pipelines.stable_diffusion.pipeline_stable_diffusion_pix2pix_zero.Pix2PixInversionPipelineOutput`] if `return_dict` is True, otherwise a `tuple. When returning a tuple, the first element is the inverted latents tensor and then second is the corresponding decoded image. """ # 1. Define call parameters if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if cross_attention_kwargs is None: cross_attention_kwargs = {} device = self._execution_device # here `guidance_scale` is defined analog to the guidance weight `w` of equation (2) # of the Imagen paper: https://arxiv.org/pdf/2205.11487.pdf . `guidance_scale = 1` # corresponds to doing no classifier free guidance. do_classifier_free_guidance = guidance_scale > 1.0 # 3. Preprocess image image = self.image_processor.preprocess(image) # 4. Prepare latent variables latents = self.prepare_image_latents(image, batch_size, self.vae.dtype, device, generator) # 5. Encode input prompt num_images_per_prompt = 1 prompt_embeds, negative_prompt_embeds = self.encode_prompt( prompt, device, num_images_per_prompt, do_classifier_free_guidance, prompt_embeds=prompt_embeds, ) # For classifier free guidance, we need to do two forward passes. # Here we concatenate the unconditional and text embeddings into a single batch # to avoid doing two forward passes if do_classifier_free_guidance: prompt_embeds = torch.cat([negative_prompt_embeds, prompt_embeds]) # 4. Prepare timesteps self.inverse_scheduler.set_timesteps(num_inference_steps, device=device) timesteps = self.inverse_scheduler.timesteps # 6. Rejig the UNet so that we can obtain the cross-attenion maps and # use them for guiding the subsequent image generation. self.unet = prepare_unet(self.unet) # 7. Denoising loop where we obtain the cross-attention maps. num_warmup_steps = len(timesteps) - num_inference_steps * self.inverse_scheduler.order with self.progress_bar(total=num_inference_steps) as progress_bar: for i, t in enumerate(timesteps): # expand the latents if we are doing classifier free guidance latent_model_input = torch.cat([latents] * 2) if do_classifier_free_guidance else latents latent_model_input = self.inverse_scheduler.scale_model_input(latent_model_input, t) # predict the noise residual noise_pred = self.unet( latent_model_input, t, encoder_hidden_states=prompt_embeds, cross_attention_kwargs={"timestep": t}, ).sample # perform guidance if do_classifier_free_guidance: noise_pred_uncond, noise_pred_text = noise_pred.chunk(2) noise_pred = noise_pred_uncond + guidance_scale * (noise_pred_text - noise_pred_uncond) # regularization of the noise prediction with torch.enable_grad(): for _ in range(num_reg_steps): if lambda_auto_corr > 0: for _ in range(num_auto_corr_rolls): var = torch.autograd.Variable(noise_pred.detach().clone(), requires_grad=True) # Derive epsilon from model output before regularizing to IID standard normal var_epsilon = self.get_epsilon(var, latent_model_input.detach(), t) l_ac = self.auto_corr_loss(var_epsilon, generator=generator) l_ac.backward() grad = var.grad.detach() / num_auto_corr_rolls noise_pred = noise_pred - lambda_auto_corr * grad if lambda_kl > 0: var = torch.autograd.Variable(noise_pred.detach().clone(), requires_grad=True) # Derive epsilon from model output before regularizing to IID standard normal var_epsilon = self.get_epsilon(var, latent_model_input.detach(), t) l_kld = self.kl_divergence(var_epsilon) l_kld.backward() grad = var.grad.detach() noise_pred = noise_pred - lambda_kl * grad noise_pred = noise_pred.detach() # compute the previous noisy sample x_t -> x_t-1 latents = self.inverse_scheduler.step(noise_pred, t, latents).prev_sample # call the callback, if provided if i == len(timesteps) - 1 or ( (i + 1) > num_warmup_steps and (i + 1) % self.inverse_scheduler.order == 0 ): progress_bar.update() if callback is not None and i % callback_steps == 0: step_idx = i // getattr(self.scheduler, "order", 1) callback(step_idx, t, latents) inverted_latents = latents.detach().clone() # 8. Post-processing image = self.vae.decode(latents / self.vae.config.scaling_factor, return_dict=False)[0] image = self.image_processor.postprocess(image, output_type=output_type) # Offload all models self.maybe_free_model_hooks() if not return_dict: return (inverted_latents, image) return Pix2PixInversionPipelineOutput(latents=inverted_latents, images=image)
diffusers/src/diffusers/pipelines/deprecated/stable_diffusion_variants/pipeline_stable_diffusion_pix2pix_zero.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/deprecated/stable_diffusion_variants/pipeline_stable_diffusion_pix2pix_zero.py", "repo_id": "diffusers", "token_count": 28101 }
118
# Copyright 2023 The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from typing import Callable, List, Optional, Union import torch from transformers import ( XLMRobertaTokenizer, ) from ...models import UNet2DConditionModel, VQModel from ...schedulers import DDIMScheduler, DDPMScheduler from ...utils import ( logging, replace_example_docstring, ) from ...utils.torch_utils import randn_tensor from ..pipeline_utils import DiffusionPipeline, ImagePipelineOutput from .text_encoder import MultilingualCLIP logger = logging.get_logger(__name__) # pylint: disable=invalid-name EXAMPLE_DOC_STRING = """ Examples: ```py >>> from diffusers import KandinskyPipeline, KandinskyPriorPipeline >>> import torch >>> pipe_prior = KandinskyPriorPipeline.from_pretrained("kandinsky-community/Kandinsky-2-1-prior") >>> pipe_prior.to("cuda") >>> prompt = "red cat, 4k photo" >>> out = pipe_prior(prompt) >>> image_emb = out.image_embeds >>> negative_image_emb = out.negative_image_embeds >>> pipe = KandinskyPipeline.from_pretrained("kandinsky-community/kandinsky-2-1") >>> pipe.to("cuda") >>> image = pipe( ... prompt, ... image_embeds=image_emb, ... negative_image_embeds=negative_image_emb, ... height=768, ... width=768, ... num_inference_steps=100, ... ).images >>> image[0].save("cat.png") ``` """ def get_new_h_w(h, w, scale_factor=8): new_h = h // scale_factor**2 if h % scale_factor**2 != 0: new_h += 1 new_w = w // scale_factor**2 if w % scale_factor**2 != 0: new_w += 1 return new_h * scale_factor, new_w * scale_factor class KandinskyPipeline(DiffusionPipeline): """ Pipeline for text-to-image generation using Kandinsky This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods the library implements for all the pipelines (such as downloading or saving, running on a particular device, etc.) Args: text_encoder ([`MultilingualCLIP`]): Frozen text-encoder. tokenizer ([`XLMRobertaTokenizer`]): Tokenizer of class scheduler (Union[`DDIMScheduler`,`DDPMScheduler`]): A scheduler to be used in combination with `unet` to generate image latents. unet ([`UNet2DConditionModel`]): Conditional U-Net architecture to denoise the image embedding. movq ([`VQModel`]): MoVQ Decoder to generate the image from the latents. """ model_cpu_offload_seq = "text_encoder->unet->movq" def __init__( self, text_encoder: MultilingualCLIP, tokenizer: XLMRobertaTokenizer, unet: UNet2DConditionModel, scheduler: Union[DDIMScheduler, DDPMScheduler], movq: VQModel, ): super().__init__() self.register_modules( text_encoder=text_encoder, tokenizer=tokenizer, unet=unet, scheduler=scheduler, movq=movq, ) self.movq_scale_factor = 2 ** (len(self.movq.config.block_out_channels) - 1) # Copied from diffusers.pipelines.unclip.pipeline_unclip.UnCLIPPipeline.prepare_latents def prepare_latents(self, shape, dtype, device, generator, latents, scheduler): if latents is None: latents = randn_tensor(shape, generator=generator, device=device, dtype=dtype) else: if latents.shape != shape: raise ValueError(f"Unexpected latents shape, got {latents.shape}, expected {shape}") latents = latents.to(device) latents = latents * scheduler.init_noise_sigma return latents def _encode_prompt( self, prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt=None, ): batch_size = len(prompt) if isinstance(prompt, list) else 1 # get prompt text embeddings text_inputs = self.tokenizer( prompt, padding="max_length", truncation=True, max_length=77, return_attention_mask=True, add_special_tokens=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = self.tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal(text_input_ids, untruncated_ids): removed_text = self.tokenizer.batch_decode(untruncated_ids[:, self.tokenizer.model_max_length - 1 : -1]) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {self.tokenizer.model_max_length} tokens: {removed_text}" ) text_input_ids = text_input_ids.to(device) text_mask = text_inputs.attention_mask.to(device) prompt_embeds, text_encoder_hidden_states = self.text_encoder( input_ids=text_input_ids, attention_mask=text_mask ) prompt_embeds = prompt_embeds.repeat_interleave(num_images_per_prompt, dim=0) text_encoder_hidden_states = text_encoder_hidden_states.repeat_interleave(num_images_per_prompt, dim=0) text_mask = text_mask.repeat_interleave(num_images_per_prompt, dim=0) if do_classifier_free_guidance: uncond_tokens: List[str] if negative_prompt is None: uncond_tokens = [""] * batch_size elif type(prompt) is not type(negative_prompt): raise TypeError( f"`negative_prompt` should be the same type to `prompt`, but got {type(negative_prompt)} !=" f" {type(prompt)}." ) elif isinstance(negative_prompt, str): uncond_tokens = [negative_prompt] elif batch_size != len(negative_prompt): raise ValueError( f"`negative_prompt`: {negative_prompt} has batch size {len(negative_prompt)}, but `prompt`:" f" {prompt} has batch size {batch_size}. Please make sure that passed `negative_prompt` matches" " the batch size of `prompt`." ) else: uncond_tokens = negative_prompt uncond_input = self.tokenizer( uncond_tokens, padding="max_length", max_length=77, truncation=True, return_attention_mask=True, add_special_tokens=True, return_tensors="pt", ) uncond_text_input_ids = uncond_input.input_ids.to(device) uncond_text_mask = uncond_input.attention_mask.to(device) negative_prompt_embeds, uncond_text_encoder_hidden_states = self.text_encoder( input_ids=uncond_text_input_ids, attention_mask=uncond_text_mask ) # duplicate unconditional embeddings for each generation per prompt, using mps friendly method seq_len = negative_prompt_embeds.shape[1] negative_prompt_embeds = negative_prompt_embeds.repeat(1, num_images_per_prompt) negative_prompt_embeds = negative_prompt_embeds.view(batch_size * num_images_per_prompt, seq_len) seq_len = uncond_text_encoder_hidden_states.shape[1] uncond_text_encoder_hidden_states = uncond_text_encoder_hidden_states.repeat(1, num_images_per_prompt, 1) uncond_text_encoder_hidden_states = uncond_text_encoder_hidden_states.view( batch_size * num_images_per_prompt, seq_len, -1 ) uncond_text_mask = uncond_text_mask.repeat_interleave(num_images_per_prompt, dim=0) # done duplicates # For classifier free guidance, we need to do two forward passes. # Here we concatenate the unconditional and text embeddings into a single batch # to avoid doing two forward passes prompt_embeds = torch.cat([negative_prompt_embeds, prompt_embeds]) text_encoder_hidden_states = torch.cat([uncond_text_encoder_hidden_states, text_encoder_hidden_states]) text_mask = torch.cat([uncond_text_mask, text_mask]) return prompt_embeds, text_encoder_hidden_states, text_mask @torch.no_grad() @replace_example_docstring(EXAMPLE_DOC_STRING) def __call__( self, prompt: Union[str, List[str]], image_embeds: Union[torch.FloatTensor, List[torch.FloatTensor]], negative_image_embeds: Union[torch.FloatTensor, List[torch.FloatTensor]], negative_prompt: Optional[Union[str, List[str]]] = None, height: int = 512, width: int = 512, num_inference_steps: int = 100, guidance_scale: float = 4.0, num_images_per_prompt: int = 1, generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, latents: Optional[torch.FloatTensor] = None, output_type: Optional[str] = "pil", callback: Optional[Callable[[int, int, torch.FloatTensor], None]] = None, callback_steps: int = 1, return_dict: bool = True, ): """ Function invoked when calling the pipeline for generation. Args: prompt (`str` or `List[str]`): The prompt or prompts to guide the image generation. image_embeds (`torch.FloatTensor` or `List[torch.FloatTensor]`): The clip image embeddings for text prompt, that will be used to condition the image generation. negative_image_embeds (`torch.FloatTensor` or `List[torch.FloatTensor]`): The clip image embeddings for negative text prompt, will be used to condition the image generation. negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). height (`int`, *optional*, defaults to 512): The height in pixels of the generated image. width (`int`, *optional*, defaults to 512): The width in pixels of the generated image. num_inference_steps (`int`, *optional*, defaults to 100): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. guidance_scale (`float`, *optional*, defaults to 4.0): Guidance scale as defined in [Classifier-Free Diffusion Guidance](https://arxiv.org/abs/2207.12598). `guidance_scale` is defined as `w` of equation 2. of [Imagen Paper](https://arxiv.org/pdf/2205.11487.pdf). Guidance scale is enabled by setting `guidance_scale > 1`. Higher guidance scale encourages to generate images that are closely linked to the text `prompt`, usually at the expense of lower image quality. num_images_per_prompt (`int`, *optional*, defaults to 1): The number of images to generate per prompt. generator (`torch.Generator` or `List[torch.Generator]`, *optional*): One or a list of [torch generator(s)](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents, sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor will ge generated by sampling using the supplied random `generator`. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generate image. Choose between: `"pil"` (`PIL.Image.Image`), `"np"` (`np.array`) or `"pt"` (`torch.Tensor`). callback (`Callable`, *optional*): A function that calls every `callback_steps` steps during inference. The function is called with the following arguments: `callback(step: int, timestep: int, latents: torch.FloatTensor)`. callback_steps (`int`, *optional*, defaults to 1): The frequency at which the `callback` function is called. If not specified, the callback is called at every step. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.ImagePipelineOutput`] instead of a plain tuple. Examples: Returns: [`~pipelines.ImagePipelineOutput`] or `tuple` """ if isinstance(prompt, str): batch_size = 1 elif isinstance(prompt, list): batch_size = len(prompt) else: raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") device = self._execution_device batch_size = batch_size * num_images_per_prompt do_classifier_free_guidance = guidance_scale > 1.0 prompt_embeds, text_encoder_hidden_states, _ = self._encode_prompt( prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt ) if isinstance(image_embeds, list): image_embeds = torch.cat(image_embeds, dim=0) if isinstance(negative_image_embeds, list): negative_image_embeds = torch.cat(negative_image_embeds, dim=0) if do_classifier_free_guidance: image_embeds = image_embeds.repeat_interleave(num_images_per_prompt, dim=0) negative_image_embeds = negative_image_embeds.repeat_interleave(num_images_per_prompt, dim=0) image_embeds = torch.cat([negative_image_embeds, image_embeds], dim=0).to( dtype=prompt_embeds.dtype, device=device ) self.scheduler.set_timesteps(num_inference_steps, device=device) timesteps_tensor = self.scheduler.timesteps num_channels_latents = self.unet.config.in_channels height, width = get_new_h_w(height, width, self.movq_scale_factor) # create initial latent latents = self.prepare_latents( (batch_size, num_channels_latents, height, width), text_encoder_hidden_states.dtype, device, generator, latents, self.scheduler, ) for i, t in enumerate(self.progress_bar(timesteps_tensor)): # expand the latents if we are doing classifier free guidance latent_model_input = torch.cat([latents] * 2) if do_classifier_free_guidance else latents added_cond_kwargs = {"text_embeds": prompt_embeds, "image_embeds": image_embeds} noise_pred = self.unet( sample=latent_model_input, timestep=t, encoder_hidden_states=text_encoder_hidden_states, added_cond_kwargs=added_cond_kwargs, return_dict=False, )[0] if do_classifier_free_guidance: noise_pred, variance_pred = noise_pred.split(latents.shape[1], dim=1) noise_pred_uncond, noise_pred_text = noise_pred.chunk(2) _, variance_pred_text = variance_pred.chunk(2) noise_pred = noise_pred_uncond + guidance_scale * (noise_pred_text - noise_pred_uncond) noise_pred = torch.cat([noise_pred, variance_pred_text], dim=1) if not ( hasattr(self.scheduler.config, "variance_type") and self.scheduler.config.variance_type in ["learned", "learned_range"] ): noise_pred, _ = noise_pred.split(latents.shape[1], dim=1) # compute the previous noisy sample x_t -> x_t-1 latents = self.scheduler.step( noise_pred, t, latents, generator=generator, ).prev_sample if callback is not None and i % callback_steps == 0: step_idx = i // getattr(self.scheduler, "order", 1) callback(step_idx, t, latents) # post-processing image = self.movq.decode(latents, force_not_quantize=True)["sample"] self.maybe_free_model_hooks() if output_type not in ["pt", "np", "pil"]: raise ValueError(f"Only the output types `pt`, `pil` and `np` are supported not output_type={output_type}") if output_type in ["np", "pil"]: image = image * 0.5 + 0.5 image = image.clamp(0, 1) image = image.cpu().permute(0, 2, 3, 1).float().numpy() if output_type == "pil": image = self.numpy_to_pil(image) if not return_dict: return (image,) return ImagePipelineOutput(images=image)
diffusers/src/diffusers/pipelines/kandinsky/pipeline_kandinsky.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/kandinsky/pipeline_kandinsky.py", "repo_id": "diffusers", "token_count": 7950 }
119
# coding=utf-8 # Copyright 2023 The HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """ Conversion script for the Stable Diffusion checkpoints.""" import re from contextlib import nullcontext from io import BytesIO from typing import Dict, Optional, Union import requests import torch import yaml from transformers import ( AutoFeatureExtractor, BertTokenizerFast, CLIPImageProcessor, CLIPTextConfig, CLIPTextModel, CLIPTextModelWithProjection, CLIPTokenizer, CLIPVisionConfig, CLIPVisionModelWithProjection, ) from ...models import ( AutoencoderKL, ControlNetModel, PriorTransformer, UNet2DConditionModel, ) from ...schedulers import ( DDIMScheduler, DDPMScheduler, DPMSolverMultistepScheduler, EulerAncestralDiscreteScheduler, EulerDiscreteScheduler, HeunDiscreteScheduler, LMSDiscreteScheduler, PNDMScheduler, UnCLIPScheduler, ) from ...utils import is_accelerate_available, logging from ..latent_diffusion.pipeline_latent_diffusion import LDMBertConfig, LDMBertModel from ..paint_by_example import PaintByExampleImageEncoder from ..pipeline_utils import DiffusionPipeline from .safety_checker import StableDiffusionSafetyChecker from .stable_unclip_image_normalizer import StableUnCLIPImageNormalizer if is_accelerate_available(): from accelerate import init_empty_weights from accelerate.utils import set_module_tensor_to_device logger = logging.get_logger(__name__) # pylint: disable=invalid-name def shave_segments(path, n_shave_prefix_segments=1): """ Removes segments. Positive values shave the first segments, negative shave the last segments. """ if n_shave_prefix_segments >= 0: return ".".join(path.split(".")[n_shave_prefix_segments:]) else: return ".".join(path.split(".")[:n_shave_prefix_segments]) def renew_resnet_paths(old_list, n_shave_prefix_segments=0): """ Updates paths inside resnets to the new naming scheme (local renaming) """ mapping = [] for old_item in old_list: new_item = old_item.replace("in_layers.0", "norm1") new_item = new_item.replace("in_layers.2", "conv1") new_item = new_item.replace("out_layers.0", "norm2") new_item = new_item.replace("out_layers.3", "conv2") new_item = new_item.replace("emb_layers.1", "time_emb_proj") new_item = new_item.replace("skip_connection", "conv_shortcut") new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping def renew_vae_resnet_paths(old_list, n_shave_prefix_segments=0): """ Updates paths inside resnets to the new naming scheme (local renaming) """ mapping = [] for old_item in old_list: new_item = old_item new_item = new_item.replace("nin_shortcut", "conv_shortcut") new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping def renew_attention_paths(old_list, n_shave_prefix_segments=0): """ Updates paths inside attentions to the new naming scheme (local renaming) """ mapping = [] for old_item in old_list: new_item = old_item # new_item = new_item.replace('norm.weight', 'group_norm.weight') # new_item = new_item.replace('norm.bias', 'group_norm.bias') # new_item = new_item.replace('proj_out.weight', 'proj_attn.weight') # new_item = new_item.replace('proj_out.bias', 'proj_attn.bias') # new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping def renew_vae_attention_paths(old_list, n_shave_prefix_segments=0): """ Updates paths inside attentions to the new naming scheme (local renaming) """ mapping = [] for old_item in old_list: new_item = old_item new_item = new_item.replace("norm.weight", "group_norm.weight") new_item = new_item.replace("norm.bias", "group_norm.bias") new_item = new_item.replace("q.weight", "to_q.weight") new_item = new_item.replace("q.bias", "to_q.bias") new_item = new_item.replace("k.weight", "to_k.weight") new_item = new_item.replace("k.bias", "to_k.bias") new_item = new_item.replace("v.weight", "to_v.weight") new_item = new_item.replace("v.bias", "to_v.bias") new_item = new_item.replace("proj_out.weight", "to_out.0.weight") new_item = new_item.replace("proj_out.bias", "to_out.0.bias") new_item = shave_segments(new_item, n_shave_prefix_segments=n_shave_prefix_segments) mapping.append({"old": old_item, "new": new_item}) return mapping def assign_to_checkpoint( paths, checkpoint, old_checkpoint, attention_paths_to_split=None, additional_replacements=None, config=None ): """ This does the final conversion step: take locally converted weights and apply a global renaming to them. It splits attention layers, and takes into account additional replacements that may arise. Assigns the weights to the new checkpoint. """ assert isinstance(paths, list), "Paths should be a list of dicts containing 'old' and 'new' keys." # Splits the attention layers into three variables. if attention_paths_to_split is not None: for path, path_map in attention_paths_to_split.items(): old_tensor = old_checkpoint[path] channels = old_tensor.shape[0] // 3 target_shape = (-1, channels) if len(old_tensor.shape) == 3 else (-1) num_heads = old_tensor.shape[0] // config["num_head_channels"] // 3 old_tensor = old_tensor.reshape((num_heads, 3 * channels // num_heads) + old_tensor.shape[1:]) query, key, value = old_tensor.split(channels // num_heads, dim=1) checkpoint[path_map["query"]] = query.reshape(target_shape) checkpoint[path_map["key"]] = key.reshape(target_shape) checkpoint[path_map["value"]] = value.reshape(target_shape) for path in paths: new_path = path["new"] # These have already been assigned if attention_paths_to_split is not None and new_path in attention_paths_to_split: continue # Global renaming happens here new_path = new_path.replace("middle_block.0", "mid_block.resnets.0") new_path = new_path.replace("middle_block.1", "mid_block.attentions.0") new_path = new_path.replace("middle_block.2", "mid_block.resnets.1") if additional_replacements is not None: for replacement in additional_replacements: new_path = new_path.replace(replacement["old"], replacement["new"]) # proj_attn.weight has to be converted from conv 1D to linear is_attn_weight = "proj_attn.weight" in new_path or ("attentions" in new_path and "to_" in new_path) shape = old_checkpoint[path["old"]].shape if is_attn_weight and len(shape) == 3: checkpoint[new_path] = old_checkpoint[path["old"]][:, :, 0] elif is_attn_weight and len(shape) == 4: checkpoint[new_path] = old_checkpoint[path["old"]][:, :, 0, 0] else: checkpoint[new_path] = old_checkpoint[path["old"]] def conv_attn_to_linear(checkpoint): keys = list(checkpoint.keys()) attn_keys = ["query.weight", "key.weight", "value.weight"] for key in keys: if ".".join(key.split(".")[-2:]) in attn_keys: if checkpoint[key].ndim > 2: checkpoint[key] = checkpoint[key][:, :, 0, 0] elif "proj_attn.weight" in key: if checkpoint[key].ndim > 2: checkpoint[key] = checkpoint[key][:, :, 0] def create_unet_diffusers_config(original_config, image_size: int, controlnet=False): """ Creates a config for the diffusers based on the config of the LDM model. """ if controlnet: unet_params = original_config["model"]["params"]["control_stage_config"]["params"] else: if ( "unet_config" in original_config["model"]["params"] and original_config["model"]["params"]["unet_config"] is not None ): unet_params = original_config["model"]["params"]["unet_config"]["params"] else: unet_params = original_config["model"]["params"]["network_config"]["params"] vae_params = original_config["model"]["params"]["first_stage_config"]["params"]["ddconfig"] block_out_channels = [unet_params["model_channels"] * mult for mult in unet_params["channel_mult"]] down_block_types = [] resolution = 1 for i in range(len(block_out_channels)): block_type = "CrossAttnDownBlock2D" if resolution in unet_params["attention_resolutions"] else "DownBlock2D" down_block_types.append(block_type) if i != len(block_out_channels) - 1: resolution *= 2 up_block_types = [] for i in range(len(block_out_channels)): block_type = "CrossAttnUpBlock2D" if resolution in unet_params["attention_resolutions"] else "UpBlock2D" up_block_types.append(block_type) resolution //= 2 if unet_params["transformer_depth"] is not None: transformer_layers_per_block = ( unet_params["transformer_depth"] if isinstance(unet_params["transformer_depth"], int) else list(unet_params["transformer_depth"]) ) else: transformer_layers_per_block = 1 vae_scale_factor = 2 ** (len(vae_params["ch_mult"]) - 1) head_dim = unet_params["num_heads"] if "num_heads" in unet_params else None use_linear_projection = ( unet_params["use_linear_in_transformer"] if "use_linear_in_transformer" in unet_params else False ) if use_linear_projection: # stable diffusion 2-base-512 and 2-768 if head_dim is None: head_dim_mult = unet_params["model_channels"] // unet_params["num_head_channels"] head_dim = [head_dim_mult * c for c in list(unet_params["channel_mult"])] class_embed_type = None addition_embed_type = None addition_time_embed_dim = None projection_class_embeddings_input_dim = None context_dim = None if unet_params["context_dim"] is not None: context_dim = ( unet_params["context_dim"] if isinstance(unet_params["context_dim"], int) else unet_params["context_dim"][0] ) if "num_classes" in unet_params: if unet_params["num_classes"] == "sequential": if context_dim in [2048, 1280]: # SDXL addition_embed_type = "text_time" addition_time_embed_dim = 256 else: class_embed_type = "projection" assert "adm_in_channels" in unet_params projection_class_embeddings_input_dim = unet_params["adm_in_channels"] config = { "sample_size": image_size // vae_scale_factor, "in_channels": unet_params["in_channels"], "down_block_types": tuple(down_block_types), "block_out_channels": tuple(block_out_channels), "layers_per_block": unet_params["num_res_blocks"], "cross_attention_dim": context_dim, "attention_head_dim": head_dim, "use_linear_projection": use_linear_projection, "class_embed_type": class_embed_type, "addition_embed_type": addition_embed_type, "addition_time_embed_dim": addition_time_embed_dim, "projection_class_embeddings_input_dim": projection_class_embeddings_input_dim, "transformer_layers_per_block": transformer_layers_per_block, } if "disable_self_attentions" in unet_params: config["only_cross_attention"] = unet_params["disable_self_attentions"] if "num_classes" in unet_params and isinstance(unet_params["num_classes"], int): config["num_class_embeds"] = unet_params["num_classes"] if controlnet: config["conditioning_channels"] = unet_params["hint_channels"] else: config["out_channels"] = unet_params["out_channels"] config["up_block_types"] = tuple(up_block_types) return config def create_vae_diffusers_config(original_config, image_size: int): """ Creates a config for the diffusers based on the config of the LDM model. """ vae_params = original_config["model"]["params"]["first_stage_config"]["params"]["ddconfig"] _ = original_config["model"]["params"]["first_stage_config"]["params"]["embed_dim"] block_out_channels = [vae_params["ch"] * mult for mult in vae_params["ch_mult"]] down_block_types = ["DownEncoderBlock2D"] * len(block_out_channels) up_block_types = ["UpDecoderBlock2D"] * len(block_out_channels) config = { "sample_size": image_size, "in_channels": vae_params["in_channels"], "out_channels": vae_params["out_ch"], "down_block_types": tuple(down_block_types), "up_block_types": tuple(up_block_types), "block_out_channels": tuple(block_out_channels), "latent_channels": vae_params["z_channels"], "layers_per_block": vae_params["num_res_blocks"], } return config def create_diffusers_schedular(original_config): schedular = DDIMScheduler( num_train_timesteps=original_config["model"]["params"]["timesteps"], beta_start=original_config["model"]["params"]["linear_start"], beta_end=original_config["model"]["params"]["linear_end"], beta_schedule="scaled_linear", ) return schedular def create_ldm_bert_config(original_config): bert_params = original_config["model"]["params"]["cond_stage_config"]["params"] config = LDMBertConfig( d_model=bert_params.n_embed, encoder_layers=bert_params.n_layer, encoder_ffn_dim=bert_params.n_embed * 4, ) return config def convert_ldm_unet_checkpoint( checkpoint, config, path=None, extract_ema=False, controlnet=False, skip_extract_state_dict=False ): """ Takes a state dict and a config, and returns a converted checkpoint. """ if skip_extract_state_dict: unet_state_dict = checkpoint else: # extract state_dict for UNet unet_state_dict = {} keys = list(checkpoint.keys()) if controlnet: unet_key = "control_model." else: unet_key = "model.diffusion_model." # at least a 100 parameters have to start with `model_ema` in order for the checkpoint to be EMA if sum(k.startswith("model_ema") for k in keys) > 100 and extract_ema: logger.warning(f"Checkpoint {path} has both EMA and non-EMA weights.") logger.warning( "In this conversion only the EMA weights are extracted. If you want to instead extract the non-EMA" " weights (useful to continue fine-tuning), please make sure to remove the `--extract_ema` flag." ) for key in keys: if key.startswith("model.diffusion_model"): flat_ema_key = "model_ema." + "".join(key.split(".")[1:]) unet_state_dict[key.replace(unet_key, "")] = checkpoint.pop(flat_ema_key) else: if sum(k.startswith("model_ema") for k in keys) > 100: logger.warning( "In this conversion only the non-EMA weights are extracted. If you want to instead extract the EMA" " weights (usually better for inference), please make sure to add the `--extract_ema` flag." ) for key in keys: if key.startswith(unet_key): unet_state_dict[key.replace(unet_key, "")] = checkpoint.pop(key) new_checkpoint = {} new_checkpoint["time_embedding.linear_1.weight"] = unet_state_dict["time_embed.0.weight"] new_checkpoint["time_embedding.linear_1.bias"] = unet_state_dict["time_embed.0.bias"] new_checkpoint["time_embedding.linear_2.weight"] = unet_state_dict["time_embed.2.weight"] new_checkpoint["time_embedding.linear_2.bias"] = unet_state_dict["time_embed.2.bias"] if config["class_embed_type"] is None: # No parameters to port ... elif config["class_embed_type"] == "timestep" or config["class_embed_type"] == "projection": new_checkpoint["class_embedding.linear_1.weight"] = unet_state_dict["label_emb.0.0.weight"] new_checkpoint["class_embedding.linear_1.bias"] = unet_state_dict["label_emb.0.0.bias"] new_checkpoint["class_embedding.linear_2.weight"] = unet_state_dict["label_emb.0.2.weight"] new_checkpoint["class_embedding.linear_2.bias"] = unet_state_dict["label_emb.0.2.bias"] else: raise NotImplementedError(f"Not implemented `class_embed_type`: {config['class_embed_type']}") if config["addition_embed_type"] == "text_time": new_checkpoint["add_embedding.linear_1.weight"] = unet_state_dict["label_emb.0.0.weight"] new_checkpoint["add_embedding.linear_1.bias"] = unet_state_dict["label_emb.0.0.bias"] new_checkpoint["add_embedding.linear_2.weight"] = unet_state_dict["label_emb.0.2.weight"] new_checkpoint["add_embedding.linear_2.bias"] = unet_state_dict["label_emb.0.2.bias"] # Relevant to StableDiffusionUpscalePipeline if "num_class_embeds" in config: if (config["num_class_embeds"] is not None) and ("label_emb.weight" in unet_state_dict): new_checkpoint["class_embedding.weight"] = unet_state_dict["label_emb.weight"] new_checkpoint["conv_in.weight"] = unet_state_dict["input_blocks.0.0.weight"] new_checkpoint["conv_in.bias"] = unet_state_dict["input_blocks.0.0.bias"] if not controlnet: new_checkpoint["conv_norm_out.weight"] = unet_state_dict["out.0.weight"] new_checkpoint["conv_norm_out.bias"] = unet_state_dict["out.0.bias"] new_checkpoint["conv_out.weight"] = unet_state_dict["out.2.weight"] new_checkpoint["conv_out.bias"] = unet_state_dict["out.2.bias"] # Retrieves the keys for the input blocks only num_input_blocks = len({".".join(layer.split(".")[:2]) for layer in unet_state_dict if "input_blocks" in layer}) input_blocks = { layer_id: [key for key in unet_state_dict if f"input_blocks.{layer_id}" in key] for layer_id in range(num_input_blocks) } # Retrieves the keys for the middle blocks only num_middle_blocks = len({".".join(layer.split(".")[:2]) for layer in unet_state_dict if "middle_block" in layer}) middle_blocks = { layer_id: [key for key in unet_state_dict if f"middle_block.{layer_id}" in key] for layer_id in range(num_middle_blocks) } # Retrieves the keys for the output blocks only num_output_blocks = len({".".join(layer.split(".")[:2]) for layer in unet_state_dict if "output_blocks" in layer}) output_blocks = { layer_id: [key for key in unet_state_dict if f"output_blocks.{layer_id}" in key] for layer_id in range(num_output_blocks) } for i in range(1, num_input_blocks): block_id = (i - 1) // (config["layers_per_block"] + 1) layer_in_block_id = (i - 1) % (config["layers_per_block"] + 1) resnets = [ key for key in input_blocks[i] if f"input_blocks.{i}.0" in key and f"input_blocks.{i}.0.op" not in key ] attentions = [key for key in input_blocks[i] if f"input_blocks.{i}.1" in key] if f"input_blocks.{i}.0.op.weight" in unet_state_dict: new_checkpoint[f"down_blocks.{block_id}.downsamplers.0.conv.weight"] = unet_state_dict.pop( f"input_blocks.{i}.0.op.weight" ) new_checkpoint[f"down_blocks.{block_id}.downsamplers.0.conv.bias"] = unet_state_dict.pop( f"input_blocks.{i}.0.op.bias" ) paths = renew_resnet_paths(resnets) meta_path = {"old": f"input_blocks.{i}.0", "new": f"down_blocks.{block_id}.resnets.{layer_in_block_id}"} assign_to_checkpoint( paths, new_checkpoint, unet_state_dict, additional_replacements=[meta_path], config=config ) if len(attentions): paths = renew_attention_paths(attentions) meta_path = {"old": f"input_blocks.{i}.1", "new": f"down_blocks.{block_id}.attentions.{layer_in_block_id}"} assign_to_checkpoint( paths, new_checkpoint, unet_state_dict, additional_replacements=[meta_path], config=config ) resnet_0 = middle_blocks[0] attentions = middle_blocks[1] resnet_1 = middle_blocks[2] resnet_0_paths = renew_resnet_paths(resnet_0) assign_to_checkpoint(resnet_0_paths, new_checkpoint, unet_state_dict, config=config) resnet_1_paths = renew_resnet_paths(resnet_1) assign_to_checkpoint(resnet_1_paths, new_checkpoint, unet_state_dict, config=config) attentions_paths = renew_attention_paths(attentions) meta_path = {"old": "middle_block.1", "new": "mid_block.attentions.0"} assign_to_checkpoint( attentions_paths, new_checkpoint, unet_state_dict, additional_replacements=[meta_path], config=config ) for i in range(num_output_blocks): block_id = i // (config["layers_per_block"] + 1) layer_in_block_id = i % (config["layers_per_block"] + 1) output_block_layers = [shave_segments(name, 2) for name in output_blocks[i]] output_block_list = {} for layer in output_block_layers: layer_id, layer_name = layer.split(".")[0], shave_segments(layer, 1) if layer_id in output_block_list: output_block_list[layer_id].append(layer_name) else: output_block_list[layer_id] = [layer_name] if len(output_block_list) > 1: resnets = [key for key in output_blocks[i] if f"output_blocks.{i}.0" in key] attentions = [key for key in output_blocks[i] if f"output_blocks.{i}.1" in key] resnet_0_paths = renew_resnet_paths(resnets) paths = renew_resnet_paths(resnets) meta_path = {"old": f"output_blocks.{i}.0", "new": f"up_blocks.{block_id}.resnets.{layer_in_block_id}"} assign_to_checkpoint( paths, new_checkpoint, unet_state_dict, additional_replacements=[meta_path], config=config ) output_block_list = {k: sorted(v) for k, v in output_block_list.items()} if ["conv.bias", "conv.weight"] in output_block_list.values(): index = list(output_block_list.values()).index(["conv.bias", "conv.weight"]) new_checkpoint[f"up_blocks.{block_id}.upsamplers.0.conv.weight"] = unet_state_dict[ f"output_blocks.{i}.{index}.conv.weight" ] new_checkpoint[f"up_blocks.{block_id}.upsamplers.0.conv.bias"] = unet_state_dict[ f"output_blocks.{i}.{index}.conv.bias" ] # Clear attentions as they have been attributed above. if len(attentions) == 2: attentions = [] if len(attentions): paths = renew_attention_paths(attentions) meta_path = { "old": f"output_blocks.{i}.1", "new": f"up_blocks.{block_id}.attentions.{layer_in_block_id}", } assign_to_checkpoint( paths, new_checkpoint, unet_state_dict, additional_replacements=[meta_path], config=config ) else: resnet_0_paths = renew_resnet_paths(output_block_layers, n_shave_prefix_segments=1) for path in resnet_0_paths: old_path = ".".join(["output_blocks", str(i), path["old"]]) new_path = ".".join(["up_blocks", str(block_id), "resnets", str(layer_in_block_id), path["new"]]) new_checkpoint[new_path] = unet_state_dict[old_path] if controlnet: # conditioning embedding orig_index = 0 new_checkpoint["controlnet_cond_embedding.conv_in.weight"] = unet_state_dict.pop( f"input_hint_block.{orig_index}.weight" ) new_checkpoint["controlnet_cond_embedding.conv_in.bias"] = unet_state_dict.pop( f"input_hint_block.{orig_index}.bias" ) orig_index += 2 diffusers_index = 0 while diffusers_index < 6: new_checkpoint[f"controlnet_cond_embedding.blocks.{diffusers_index}.weight"] = unet_state_dict.pop( f"input_hint_block.{orig_index}.weight" ) new_checkpoint[f"controlnet_cond_embedding.blocks.{diffusers_index}.bias"] = unet_state_dict.pop( f"input_hint_block.{orig_index}.bias" ) diffusers_index += 1 orig_index += 2 new_checkpoint["controlnet_cond_embedding.conv_out.weight"] = unet_state_dict.pop( f"input_hint_block.{orig_index}.weight" ) new_checkpoint["controlnet_cond_embedding.conv_out.bias"] = unet_state_dict.pop( f"input_hint_block.{orig_index}.bias" ) # down blocks for i in range(num_input_blocks): new_checkpoint[f"controlnet_down_blocks.{i}.weight"] = unet_state_dict.pop(f"zero_convs.{i}.0.weight") new_checkpoint[f"controlnet_down_blocks.{i}.bias"] = unet_state_dict.pop(f"zero_convs.{i}.0.bias") # mid block new_checkpoint["controlnet_mid_block.weight"] = unet_state_dict.pop("middle_block_out.0.weight") new_checkpoint["controlnet_mid_block.bias"] = unet_state_dict.pop("middle_block_out.0.bias") return new_checkpoint def convert_ldm_vae_checkpoint(checkpoint, config): # extract state dict for VAE vae_state_dict = {} keys = list(checkpoint.keys()) vae_key = "first_stage_model." if any(k.startswith("first_stage_model.") for k in keys) else "" for key in keys: if key.startswith(vae_key): vae_state_dict[key.replace(vae_key, "")] = checkpoint.get(key) new_checkpoint = {} new_checkpoint["encoder.conv_in.weight"] = vae_state_dict["encoder.conv_in.weight"] new_checkpoint["encoder.conv_in.bias"] = vae_state_dict["encoder.conv_in.bias"] new_checkpoint["encoder.conv_out.weight"] = vae_state_dict["encoder.conv_out.weight"] new_checkpoint["encoder.conv_out.bias"] = vae_state_dict["encoder.conv_out.bias"] new_checkpoint["encoder.conv_norm_out.weight"] = vae_state_dict["encoder.norm_out.weight"] new_checkpoint["encoder.conv_norm_out.bias"] = vae_state_dict["encoder.norm_out.bias"] new_checkpoint["decoder.conv_in.weight"] = vae_state_dict["decoder.conv_in.weight"] new_checkpoint["decoder.conv_in.bias"] = vae_state_dict["decoder.conv_in.bias"] new_checkpoint["decoder.conv_out.weight"] = vae_state_dict["decoder.conv_out.weight"] new_checkpoint["decoder.conv_out.bias"] = vae_state_dict["decoder.conv_out.bias"] new_checkpoint["decoder.conv_norm_out.weight"] = vae_state_dict["decoder.norm_out.weight"] new_checkpoint["decoder.conv_norm_out.bias"] = vae_state_dict["decoder.norm_out.bias"] new_checkpoint["quant_conv.weight"] = vae_state_dict["quant_conv.weight"] new_checkpoint["quant_conv.bias"] = vae_state_dict["quant_conv.bias"] new_checkpoint["post_quant_conv.weight"] = vae_state_dict["post_quant_conv.weight"] new_checkpoint["post_quant_conv.bias"] = vae_state_dict["post_quant_conv.bias"] # Retrieves the keys for the encoder down blocks only num_down_blocks = len({".".join(layer.split(".")[:3]) for layer in vae_state_dict if "encoder.down" in layer}) down_blocks = { layer_id: [key for key in vae_state_dict if f"down.{layer_id}" in key] for layer_id in range(num_down_blocks) } # Retrieves the keys for the decoder up blocks only num_up_blocks = len({".".join(layer.split(".")[:3]) for layer in vae_state_dict if "decoder.up" in layer}) up_blocks = { layer_id: [key for key in vae_state_dict if f"up.{layer_id}" in key] for layer_id in range(num_up_blocks) } for i in range(num_down_blocks): resnets = [key for key in down_blocks[i] if f"down.{i}" in key and f"down.{i}.downsample" not in key] if f"encoder.down.{i}.downsample.conv.weight" in vae_state_dict: new_checkpoint[f"encoder.down_blocks.{i}.downsamplers.0.conv.weight"] = vae_state_dict.pop( f"encoder.down.{i}.downsample.conv.weight" ) new_checkpoint[f"encoder.down_blocks.{i}.downsamplers.0.conv.bias"] = vae_state_dict.pop( f"encoder.down.{i}.downsample.conv.bias" ) paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"down.{i}.block", "new": f"down_blocks.{i}.resnets"} assign_to_checkpoint(paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], config=config) mid_resnets = [key for key in vae_state_dict if "encoder.mid.block" in key] num_mid_res_blocks = 2 for i in range(1, num_mid_res_blocks + 1): resnets = [key for key in mid_resnets if f"encoder.mid.block_{i}" in key] paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"mid.block_{i}", "new": f"mid_block.resnets.{i - 1}"} assign_to_checkpoint(paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], config=config) mid_attentions = [key for key in vae_state_dict if "encoder.mid.attn" in key] paths = renew_vae_attention_paths(mid_attentions) meta_path = {"old": "mid.attn_1", "new": "mid_block.attentions.0"} assign_to_checkpoint(paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], config=config) conv_attn_to_linear(new_checkpoint) for i in range(num_up_blocks): block_id = num_up_blocks - 1 - i resnets = [ key for key in up_blocks[block_id] if f"up.{block_id}" in key and f"up.{block_id}.upsample" not in key ] if f"decoder.up.{block_id}.upsample.conv.weight" in vae_state_dict: new_checkpoint[f"decoder.up_blocks.{i}.upsamplers.0.conv.weight"] = vae_state_dict[ f"decoder.up.{block_id}.upsample.conv.weight" ] new_checkpoint[f"decoder.up_blocks.{i}.upsamplers.0.conv.bias"] = vae_state_dict[ f"decoder.up.{block_id}.upsample.conv.bias" ] paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"up.{block_id}.block", "new": f"up_blocks.{i}.resnets"} assign_to_checkpoint(paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], config=config) mid_resnets = [key for key in vae_state_dict if "decoder.mid.block" in key] num_mid_res_blocks = 2 for i in range(1, num_mid_res_blocks + 1): resnets = [key for key in mid_resnets if f"decoder.mid.block_{i}" in key] paths = renew_vae_resnet_paths(resnets) meta_path = {"old": f"mid.block_{i}", "new": f"mid_block.resnets.{i - 1}"} assign_to_checkpoint(paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], config=config) mid_attentions = [key for key in vae_state_dict if "decoder.mid.attn" in key] paths = renew_vae_attention_paths(mid_attentions) meta_path = {"old": "mid.attn_1", "new": "mid_block.attentions.0"} assign_to_checkpoint(paths, new_checkpoint, vae_state_dict, additional_replacements=[meta_path], config=config) conv_attn_to_linear(new_checkpoint) return new_checkpoint def convert_ldm_bert_checkpoint(checkpoint, config): def _copy_attn_layer(hf_attn_layer, pt_attn_layer): hf_attn_layer.q_proj.weight.data = pt_attn_layer.to_q.weight hf_attn_layer.k_proj.weight.data = pt_attn_layer.to_k.weight hf_attn_layer.v_proj.weight.data = pt_attn_layer.to_v.weight hf_attn_layer.out_proj.weight = pt_attn_layer.to_out.weight hf_attn_layer.out_proj.bias = pt_attn_layer.to_out.bias def _copy_linear(hf_linear, pt_linear): hf_linear.weight = pt_linear.weight hf_linear.bias = pt_linear.bias def _copy_layer(hf_layer, pt_layer): # copy layer norms _copy_linear(hf_layer.self_attn_layer_norm, pt_layer[0][0]) _copy_linear(hf_layer.final_layer_norm, pt_layer[1][0]) # copy attn _copy_attn_layer(hf_layer.self_attn, pt_layer[0][1]) # copy MLP pt_mlp = pt_layer[1][1] _copy_linear(hf_layer.fc1, pt_mlp.net[0][0]) _copy_linear(hf_layer.fc2, pt_mlp.net[2]) def _copy_layers(hf_layers, pt_layers): for i, hf_layer in enumerate(hf_layers): if i != 0: i += i pt_layer = pt_layers[i : i + 2] _copy_layer(hf_layer, pt_layer) hf_model = LDMBertModel(config).eval() # copy embeds hf_model.model.embed_tokens.weight = checkpoint.transformer.token_emb.weight hf_model.model.embed_positions.weight.data = checkpoint.transformer.pos_emb.emb.weight # copy layer norm _copy_linear(hf_model.model.layer_norm, checkpoint.transformer.norm) # copy hidden layers _copy_layers(hf_model.model.layers, checkpoint.transformer.attn_layers.layers) _copy_linear(hf_model.to_logits, checkpoint.transformer.to_logits) return hf_model def convert_ldm_clip_checkpoint(checkpoint, local_files_only=False, text_encoder=None): if text_encoder is None: config_name = "openai/clip-vit-large-patch14" try: config = CLIPTextConfig.from_pretrained(config_name, local_files_only=local_files_only) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the configuration in the following path: 'openai/clip-vit-large-patch14'." ) ctx = init_empty_weights if is_accelerate_available() else nullcontext with ctx(): text_model = CLIPTextModel(config) else: text_model = text_encoder keys = list(checkpoint.keys()) text_model_dict = {} remove_prefixes = ["cond_stage_model.transformer", "conditioner.embedders.0.transformer"] for key in keys: for prefix in remove_prefixes: if key.startswith(prefix): text_model_dict[key[len(prefix + ".") :]] = checkpoint[key] if is_accelerate_available(): for param_name, param in text_model_dict.items(): set_module_tensor_to_device(text_model, param_name, "cpu", value=param) else: if not (hasattr(text_model, "embeddings") and hasattr(text_model.embeddings.position_ids)): text_model_dict.pop("text_model.embeddings.position_ids", None) text_model.load_state_dict(text_model_dict) return text_model textenc_conversion_lst = [ ("positional_embedding", "text_model.embeddings.position_embedding.weight"), ("token_embedding.weight", "text_model.embeddings.token_embedding.weight"), ("ln_final.weight", "text_model.final_layer_norm.weight"), ("ln_final.bias", "text_model.final_layer_norm.bias"), ("text_projection", "text_projection.weight"), ] textenc_conversion_map = {x[0]: x[1] for x in textenc_conversion_lst} textenc_transformer_conversion_lst = [ # (stable-diffusion, HF Diffusers) ("resblocks.", "text_model.encoder.layers."), ("ln_1", "layer_norm1"), ("ln_2", "layer_norm2"), (".c_fc.", ".fc1."), (".c_proj.", ".fc2."), (".attn", ".self_attn"), ("ln_final.", "transformer.text_model.final_layer_norm."), ("token_embedding.weight", "transformer.text_model.embeddings.token_embedding.weight"), ("positional_embedding", "transformer.text_model.embeddings.position_embedding.weight"), ] protected = {re.escape(x[0]): x[1] for x in textenc_transformer_conversion_lst} textenc_pattern = re.compile("|".join(protected.keys())) def convert_paint_by_example_checkpoint(checkpoint, local_files_only=False): config = CLIPVisionConfig.from_pretrained("openai/clip-vit-large-patch14", local_files_only=local_files_only) model = PaintByExampleImageEncoder(config) keys = list(checkpoint.keys()) text_model_dict = {} for key in keys: if key.startswith("cond_stage_model.transformer"): text_model_dict[key[len("cond_stage_model.transformer.") :]] = checkpoint[key] # load clip vision model.model.load_state_dict(text_model_dict) # load mapper keys_mapper = { k[len("cond_stage_model.mapper.res") :]: v for k, v in checkpoint.items() if k.startswith("cond_stage_model.mapper") } MAPPING = { "attn.c_qkv": ["attn1.to_q", "attn1.to_k", "attn1.to_v"], "attn.c_proj": ["attn1.to_out.0"], "ln_1": ["norm1"], "ln_2": ["norm3"], "mlp.c_fc": ["ff.net.0.proj"], "mlp.c_proj": ["ff.net.2"], } mapped_weights = {} for key, value in keys_mapper.items(): prefix = key[: len("blocks.i")] suffix = key.split(prefix)[-1].split(".")[-1] name = key.split(prefix)[-1].split(suffix)[0][1:-1] mapped_names = MAPPING[name] num_splits = len(mapped_names) for i, mapped_name in enumerate(mapped_names): new_name = ".".join([prefix, mapped_name, suffix]) shape = value.shape[0] // num_splits mapped_weights[new_name] = value[i * shape : (i + 1) * shape] model.mapper.load_state_dict(mapped_weights) # load final layer norm model.final_layer_norm.load_state_dict( { "bias": checkpoint["cond_stage_model.final_ln.bias"], "weight": checkpoint["cond_stage_model.final_ln.weight"], } ) # load final proj model.proj_out.load_state_dict( { "bias": checkpoint["proj_out.bias"], "weight": checkpoint["proj_out.weight"], } ) # load uncond vector model.uncond_vector.data = torch.nn.Parameter(checkpoint["learnable_vector"]) return model def convert_open_clip_checkpoint( checkpoint, config_name, prefix="cond_stage_model.model.", has_projection=False, local_files_only=False, **config_kwargs, ): # text_model = CLIPTextModel.from_pretrained("stabilityai/stable-diffusion-2", subfolder="text_encoder") # text_model = CLIPTextModelWithProjection.from_pretrained( # "laion/CLIP-ViT-bigG-14-laion2B-39B-b160k", projection_dim=1280 # ) try: config = CLIPTextConfig.from_pretrained(config_name, **config_kwargs, local_files_only=local_files_only) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the configuration in the following path: '{config_name}'." ) ctx = init_empty_weights if is_accelerate_available() else nullcontext with ctx(): text_model = CLIPTextModelWithProjection(config) if has_projection else CLIPTextModel(config) keys = list(checkpoint.keys()) keys_to_ignore = [] if config_name == "stabilityai/stable-diffusion-2" and config.num_hidden_layers == 23: # make sure to remove all keys > 22 keys_to_ignore += [k for k in keys if k.startswith("cond_stage_model.model.transformer.resblocks.23")] keys_to_ignore += ["cond_stage_model.model.text_projection"] text_model_dict = {} if prefix + "text_projection" in checkpoint: d_model = int(checkpoint[prefix + "text_projection"].shape[0]) else: d_model = 1024 text_model_dict["text_model.embeddings.position_ids"] = text_model.text_model.embeddings.get_buffer("position_ids") for key in keys: if key in keys_to_ignore: continue if key[len(prefix) :] in textenc_conversion_map: if key.endswith("text_projection"): value = checkpoint[key].T.contiguous() else: value = checkpoint[key] text_model_dict[textenc_conversion_map[key[len(prefix) :]]] = value if key.startswith(prefix + "transformer."): new_key = key[len(prefix + "transformer.") :] if new_key.endswith(".in_proj_weight"): new_key = new_key[: -len(".in_proj_weight")] new_key = textenc_pattern.sub(lambda m: protected[re.escape(m.group(0))], new_key) text_model_dict[new_key + ".q_proj.weight"] = checkpoint[key][:d_model, :] text_model_dict[new_key + ".k_proj.weight"] = checkpoint[key][d_model : d_model * 2, :] text_model_dict[new_key + ".v_proj.weight"] = checkpoint[key][d_model * 2 :, :] elif new_key.endswith(".in_proj_bias"): new_key = new_key[: -len(".in_proj_bias")] new_key = textenc_pattern.sub(lambda m: protected[re.escape(m.group(0))], new_key) text_model_dict[new_key + ".q_proj.bias"] = checkpoint[key][:d_model] text_model_dict[new_key + ".k_proj.bias"] = checkpoint[key][d_model : d_model * 2] text_model_dict[new_key + ".v_proj.bias"] = checkpoint[key][d_model * 2 :] else: new_key = textenc_pattern.sub(lambda m: protected[re.escape(m.group(0))], new_key) text_model_dict[new_key] = checkpoint[key] if is_accelerate_available(): for param_name, param in text_model_dict.items(): set_module_tensor_to_device(text_model, param_name, "cpu", value=param) else: if not (hasattr(text_model, "embeddings") and hasattr(text_model.embeddings.position_ids)): text_model_dict.pop("text_model.embeddings.position_ids", None) text_model.load_state_dict(text_model_dict) return text_model def stable_unclip_image_encoder(original_config, local_files_only=False): """ Returns the image processor and clip image encoder for the img2img unclip pipeline. We currently know of two types of stable unclip models which separately use the clip and the openclip image encoders. """ image_embedder_config = original_config["model"]["params"]["embedder_config"] sd_clip_image_embedder_class = image_embedder_config["target"] sd_clip_image_embedder_class = sd_clip_image_embedder_class.split(".")[-1] if sd_clip_image_embedder_class == "ClipImageEmbedder": clip_model_name = image_embedder_config.params.model if clip_model_name == "ViT-L/14": feature_extractor = CLIPImageProcessor() image_encoder = CLIPVisionModelWithProjection.from_pretrained( "openai/clip-vit-large-patch14", local_files_only=local_files_only ) else: raise NotImplementedError(f"Unknown CLIP checkpoint name in stable diffusion checkpoint {clip_model_name}") elif sd_clip_image_embedder_class == "FrozenOpenCLIPImageEmbedder": feature_extractor = CLIPImageProcessor() image_encoder = CLIPVisionModelWithProjection.from_pretrained( "laion/CLIP-ViT-H-14-laion2B-s32B-b79K", local_files_only=local_files_only ) else: raise NotImplementedError( f"Unknown CLIP image embedder class in stable diffusion checkpoint {sd_clip_image_embedder_class}" ) return feature_extractor, image_encoder def stable_unclip_image_noising_components( original_config, clip_stats_path: Optional[str] = None, device: Optional[str] = None ): """ Returns the noising components for the img2img and txt2img unclip pipelines. Converts the stability noise augmentor into 1. a `StableUnCLIPImageNormalizer` for holding the CLIP stats 2. a `DDPMScheduler` for holding the noise schedule If the noise augmentor config specifies a clip stats path, the `clip_stats_path` must be provided. """ noise_aug_config = original_config["model"]["params"]["noise_aug_config"] noise_aug_class = noise_aug_config["target"] noise_aug_class = noise_aug_class.split(".")[-1] if noise_aug_class == "CLIPEmbeddingNoiseAugmentation": noise_aug_config = noise_aug_config.params embedding_dim = noise_aug_config.timestep_dim max_noise_level = noise_aug_config.noise_schedule_config.timesteps beta_schedule = noise_aug_config.noise_schedule_config.beta_schedule image_normalizer = StableUnCLIPImageNormalizer(embedding_dim=embedding_dim) image_noising_scheduler = DDPMScheduler(num_train_timesteps=max_noise_level, beta_schedule=beta_schedule) if "clip_stats_path" in noise_aug_config: if clip_stats_path is None: raise ValueError("This stable unclip config requires a `clip_stats_path`") clip_mean, clip_std = torch.load(clip_stats_path, map_location=device) clip_mean = clip_mean[None, :] clip_std = clip_std[None, :] clip_stats_state_dict = { "mean": clip_mean, "std": clip_std, } image_normalizer.load_state_dict(clip_stats_state_dict) else: raise NotImplementedError(f"Unknown noise augmentor class: {noise_aug_class}") return image_normalizer, image_noising_scheduler def convert_controlnet_checkpoint( checkpoint, original_config, checkpoint_path, image_size, upcast_attention, extract_ema, use_linear_projection=None, cross_attention_dim=None, ): ctrlnet_config = create_unet_diffusers_config(original_config, image_size=image_size, controlnet=True) ctrlnet_config["upcast_attention"] = upcast_attention ctrlnet_config.pop("sample_size") if use_linear_projection is not None: ctrlnet_config["use_linear_projection"] = use_linear_projection if cross_attention_dim is not None: ctrlnet_config["cross_attention_dim"] = cross_attention_dim ctx = init_empty_weights if is_accelerate_available() else nullcontext with ctx(): controlnet = ControlNetModel(**ctrlnet_config) # Some controlnet ckpt files are distributed independently from the rest of the # model components i.e. https://huggingface.co/thibaud/controlnet-sd21/ if "time_embed.0.weight" in checkpoint: skip_extract_state_dict = True else: skip_extract_state_dict = False converted_ctrl_checkpoint = convert_ldm_unet_checkpoint( checkpoint, ctrlnet_config, path=checkpoint_path, extract_ema=extract_ema, controlnet=True, skip_extract_state_dict=skip_extract_state_dict, ) if is_accelerate_available(): for param_name, param in converted_ctrl_checkpoint.items(): set_module_tensor_to_device(controlnet, param_name, "cpu", value=param) else: controlnet.load_state_dict(converted_ctrl_checkpoint) return controlnet def download_from_original_stable_diffusion_ckpt( checkpoint_path_or_dict: Union[str, Dict[str, torch.Tensor]], original_config_file: str = None, image_size: Optional[int] = None, prediction_type: str = None, model_type: str = None, extract_ema: bool = False, scheduler_type: str = "pndm", num_in_channels: Optional[int] = None, upcast_attention: Optional[bool] = None, device: str = None, from_safetensors: bool = False, stable_unclip: Optional[str] = None, stable_unclip_prior: Optional[str] = None, clip_stats_path: Optional[str] = None, controlnet: Optional[bool] = None, adapter: Optional[bool] = None, load_safety_checker: bool = True, pipeline_class: DiffusionPipeline = None, local_files_only=False, vae_path=None, vae=None, text_encoder=None, text_encoder_2=None, tokenizer=None, tokenizer_2=None, config_files=None, ) -> DiffusionPipeline: """ Load a Stable Diffusion pipeline object from a CompVis-style `.ckpt`/`.safetensors` file and (ideally) a `.yaml` config file. Although many of the arguments can be automatically inferred, some of these rely on brittle checks against the global step count, which will likely fail for models that have undergone further fine-tuning. Therefore, it is recommended that you override the default values and/or supply an `original_config_file` wherever possible. Args: checkpoint_path_or_dict (`str` or `dict`): Path to `.ckpt` file, or the state dict. original_config_file (`str`): Path to `.yaml` config file corresponding to the original architecture. If `None`, will be automatically inferred by looking for a key that only exists in SD2.0 models. image_size (`int`, *optional*, defaults to 512): The image size that the model was trained on. Use 512 for Stable Diffusion v1.X and Stable Diffusion v2 Base. Use 768 for Stable Diffusion v2. prediction_type (`str`, *optional*): The prediction type that the model was trained on. Use `'epsilon'` for Stable Diffusion v1.X and Stable Diffusion v2 Base. Use `'v_prediction'` for Stable Diffusion v2. num_in_channels (`int`, *optional*, defaults to None): The number of input channels. If `None`, it will be automatically inferred. scheduler_type (`str`, *optional*, defaults to 'pndm'): Type of scheduler to use. Should be one of `["pndm", "lms", "heun", "euler", "euler-ancestral", "dpm", "ddim"]`. model_type (`str`, *optional*, defaults to `None`): The pipeline type. `None` to automatically infer, or one of `["FrozenOpenCLIPEmbedder", "FrozenCLIPEmbedder", "PaintByExample"]`. is_img2img (`bool`, *optional*, defaults to `False`): Whether the model should be loaded as an img2img pipeline. extract_ema (`bool`, *optional*, defaults to `False`): Only relevant for checkpoints that have both EMA and non-EMA weights. Whether to extract the EMA weights or not. Defaults to `False`. Pass `True` to extract the EMA weights. EMA weights usually yield higher quality images for inference. Non-EMA weights are usually better to continue fine-tuning. upcast_attention (`bool`, *optional*, defaults to `None`): Whether the attention computation should always be upcasted. This is necessary when running stable diffusion 2.1. device (`str`, *optional*, defaults to `None`): The device to use. Pass `None` to determine automatically. from_safetensors (`str`, *optional*, defaults to `False`): If `checkpoint_path` is in `safetensors` format, load checkpoint with safetensors instead of PyTorch. load_safety_checker (`bool`, *optional*, defaults to `True`): Whether to load the safety checker or not. Defaults to `True`. pipeline_class (`str`, *optional*, defaults to `None`): The pipeline class to use. Pass `None` to determine automatically. local_files_only (`bool`, *optional*, defaults to `False`): Whether or not to only look at local files (i.e., do not try to download the model). vae (`AutoencoderKL`, *optional*, defaults to `None`): Variational Auto-Encoder (VAE) Model to encode and decode images to and from latent representations. If this parameter is `None`, the function will load a new instance of [CLIP] by itself, if needed. text_encoder (`CLIPTextModel`, *optional*, defaults to `None`): An instance of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip#transformers.CLIPTextModel) to use, specifically the [clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14) variant. If this parameter is `None`, the function will load a new instance of [CLIP] by itself, if needed. tokenizer (`CLIPTokenizer`, *optional*, defaults to `None`): An instance of [CLIPTokenizer](https://huggingface.co/docs/transformers/v4.21.0/en/model_doc/clip#transformers.CLIPTokenizer) to use. If this parameter is `None`, the function will load a new instance of [CLIPTokenizer] by itself, if needed. config_files (`Dict[str, str]`, *optional*, defaults to `None`): A dictionary mapping from config file names to their contents. If this parameter is `None`, the function will load the config files by itself, if needed. Valid keys are: - `v1`: Config file for Stable Diffusion v1 - `v2`: Config file for Stable Diffusion v2 - `xl`: Config file for Stable Diffusion XL - `xl_refiner`: Config file for Stable Diffusion XL Refiner return: A StableDiffusionPipeline object representing the passed-in `.ckpt`/`.safetensors` file. """ # import pipelines here to avoid circular import error when using from_single_file method from diffusers import ( LDMTextToImagePipeline, PaintByExamplePipeline, StableDiffusionControlNetPipeline, StableDiffusionInpaintPipeline, StableDiffusionPipeline, StableDiffusionUpscalePipeline, StableDiffusionXLControlNetInpaintPipeline, StableDiffusionXLImg2ImgPipeline, StableDiffusionXLInpaintPipeline, StableDiffusionXLPipeline, StableUnCLIPImg2ImgPipeline, StableUnCLIPPipeline, ) if prediction_type == "v-prediction": prediction_type = "v_prediction" if isinstance(checkpoint_path_or_dict, str): if from_safetensors: from safetensors.torch import load_file as safe_load checkpoint = safe_load(checkpoint_path_or_dict, device="cpu") else: if device is None: device = "cuda" if torch.cuda.is_available() else "cpu" checkpoint = torch.load(checkpoint_path_or_dict, map_location=device) else: checkpoint = torch.load(checkpoint_path_or_dict, map_location=device) elif isinstance(checkpoint_path_or_dict, dict): checkpoint = checkpoint_path_or_dict # Sometimes models don't have the global_step item if "global_step" in checkpoint: global_step = checkpoint["global_step"] else: logger.debug("global_step key not found in model") global_step = None # NOTE: this while loop isn't great but this controlnet checkpoint has one additional # "state_dict" key https://huggingface.co/thibaud/controlnet-canny-sd21 while "state_dict" in checkpoint: checkpoint = checkpoint["state_dict"] if original_config_file is None: key_name_v2_1 = "model.diffusion_model.input_blocks.2.1.transformer_blocks.0.attn2.to_k.weight" key_name_sd_xl_base = "conditioner.embedders.1.model.transformer.resblocks.9.mlp.c_proj.bias" key_name_sd_xl_refiner = "conditioner.embedders.0.model.transformer.resblocks.9.mlp.c_proj.bias" is_upscale = pipeline_class == StableDiffusionUpscalePipeline config_url = None # model_type = "v1" if config_files is not None and "v1" in config_files: original_config_file = config_files["v1"] else: config_url = "https://raw.githubusercontent.com/CompVis/stable-diffusion/main/configs/stable-diffusion/v1-inference.yaml" if key_name_v2_1 in checkpoint and checkpoint[key_name_v2_1].shape[-1] == 1024: # model_type = "v2" if config_files is not None and "v2" in config_files: original_config_file = config_files["v2"] else: config_url = "https://raw.githubusercontent.com/Stability-AI/stablediffusion/main/configs/stable-diffusion/v2-inference-v.yaml" if global_step == 110000: # v2.1 needs to upcast attention upcast_attention = True elif key_name_sd_xl_base in checkpoint: # only base xl has two text embedders if config_files is not None and "xl" in config_files: original_config_file = config_files["xl"] else: config_url = "https://raw.githubusercontent.com/Stability-AI/generative-models/main/configs/inference/sd_xl_base.yaml" elif key_name_sd_xl_refiner in checkpoint: # only refiner xl has embedder and one text embedders if config_files is not None and "xl_refiner" in config_files: original_config_file = config_files["xl_refiner"] else: config_url = "https://raw.githubusercontent.com/Stability-AI/generative-models/main/configs/inference/sd_xl_refiner.yaml" if is_upscale: config_url = "https://raw.githubusercontent.com/Stability-AI/stablediffusion/main/configs/stable-diffusion/x4-upscaling.yaml" if config_url is not None: original_config_file = BytesIO(requests.get(config_url).content) else: with open(original_config_file, "r") as f: original_config_file = f.read() original_config = yaml.safe_load(original_config_file) # Convert the text model. if ( model_type is None and "cond_stage_config" in original_config["model"]["params"] and original_config["model"]["params"]["cond_stage_config"] is not None ): model_type = original_config["model"]["params"]["cond_stage_config"]["target"].split(".")[-1] logger.debug(f"no `model_type` given, `model_type` inferred as: {model_type}") elif model_type is None and original_config["model"]["params"]["network_config"] is not None: if original_config["model"]["params"]["network_config"]["params"]["context_dim"] == 2048: model_type = "SDXL" else: model_type = "SDXL-Refiner" if image_size is None: image_size = 1024 if pipeline_class is None: # Check if we have a SDXL or SD model and initialize default pipeline if model_type not in ["SDXL", "SDXL-Refiner"]: pipeline_class = StableDiffusionPipeline if not controlnet else StableDiffusionControlNetPipeline else: pipeline_class = StableDiffusionXLPipeline if model_type == "SDXL" else StableDiffusionXLImg2ImgPipeline if num_in_channels is None and pipeline_class in [ StableDiffusionInpaintPipeline, StableDiffusionXLInpaintPipeline, StableDiffusionXLControlNetInpaintPipeline, ]: num_in_channels = 9 if num_in_channels is None and pipeline_class == StableDiffusionUpscalePipeline: num_in_channels = 7 elif num_in_channels is None: num_in_channels = 4 if "unet_config" in original_config["model"]["params"]: original_config["model"]["params"]["unet_config"]["params"]["in_channels"] = num_in_channels if ( "parameterization" in original_config["model"]["params"] and original_config["model"]["params"]["parameterization"] == "v" ): if prediction_type is None: # NOTE: For stable diffusion 2 base it is recommended to pass `prediction_type=="epsilon"` # as it relies on a brittle global step parameter here prediction_type = "epsilon" if global_step == 875000 else "v_prediction" if image_size is None: # NOTE: For stable diffusion 2 base one has to pass `image_size==512` # as it relies on a brittle global step parameter here image_size = 512 if global_step == 875000 else 768 else: if prediction_type is None: prediction_type = "epsilon" if image_size is None: image_size = 512 if controlnet is None and "control_stage_config" in original_config["model"]["params"]: path = checkpoint_path_or_dict if isinstance(checkpoint_path_or_dict, str) else "" controlnet = convert_controlnet_checkpoint( checkpoint, original_config, path, image_size, upcast_attention, extract_ema ) if "timesteps" in original_config["model"]["params"]: num_train_timesteps = original_config["model"]["params"]["timesteps"] else: num_train_timesteps = 1000 if model_type in ["SDXL", "SDXL-Refiner"]: scheduler_dict = { "beta_schedule": "scaled_linear", "beta_start": 0.00085, "beta_end": 0.012, "interpolation_type": "linear", "num_train_timesteps": num_train_timesteps, "prediction_type": "epsilon", "sample_max_value": 1.0, "set_alpha_to_one": False, "skip_prk_steps": True, "steps_offset": 1, "timestep_spacing": "leading", } scheduler = EulerDiscreteScheduler.from_config(scheduler_dict) scheduler_type = "euler" else: if "linear_start" in original_config["model"]["params"]: beta_start = original_config["model"]["params"]["linear_start"] else: beta_start = 0.02 if "linear_end" in original_config["model"]["params"]: beta_end = original_config["model"]["params"]["linear_end"] else: beta_end = 0.085 scheduler = DDIMScheduler( beta_end=beta_end, beta_schedule="scaled_linear", beta_start=beta_start, num_train_timesteps=num_train_timesteps, steps_offset=1, clip_sample=False, set_alpha_to_one=False, prediction_type=prediction_type, ) # make sure scheduler works correctly with DDIM scheduler.register_to_config(clip_sample=False) if scheduler_type == "pndm": config = dict(scheduler.config) config["skip_prk_steps"] = True scheduler = PNDMScheduler.from_config(config) elif scheduler_type == "lms": scheduler = LMSDiscreteScheduler.from_config(scheduler.config) elif scheduler_type == "heun": scheduler = HeunDiscreteScheduler.from_config(scheduler.config) elif scheduler_type == "euler": scheduler = EulerDiscreteScheduler.from_config(scheduler.config) elif scheduler_type == "euler-ancestral": scheduler = EulerAncestralDiscreteScheduler.from_config(scheduler.config) elif scheduler_type == "dpm": scheduler = DPMSolverMultistepScheduler.from_config(scheduler.config) elif scheduler_type == "ddim": scheduler = scheduler else: raise ValueError(f"Scheduler of type {scheduler_type} doesn't exist!") if pipeline_class == StableDiffusionUpscalePipeline: image_size = original_config["model"]["params"]["unet_config"]["params"]["image_size"] # Convert the UNet2DConditionModel model. unet_config = create_unet_diffusers_config(original_config, image_size=image_size) unet_config["upcast_attention"] = upcast_attention path = checkpoint_path_or_dict if isinstance(checkpoint_path_or_dict, str) else "" converted_unet_checkpoint = convert_ldm_unet_checkpoint( checkpoint, unet_config, path=path, extract_ema=extract_ema ) ctx = init_empty_weights if is_accelerate_available() else nullcontext with ctx(): unet = UNet2DConditionModel(**unet_config) if is_accelerate_available(): if model_type not in ["SDXL", "SDXL-Refiner"]: # SBM Delay this. for param_name, param in converted_unet_checkpoint.items(): set_module_tensor_to_device(unet, param_name, "cpu", value=param) else: unet.load_state_dict(converted_unet_checkpoint) # Convert the VAE model. if vae_path is None and vae is None: vae_config = create_vae_diffusers_config(original_config, image_size=image_size) converted_vae_checkpoint = convert_ldm_vae_checkpoint(checkpoint, vae_config) if ( "model" in original_config and "params" in original_config["model"] and "scale_factor" in original_config["model"]["params"] ): vae_scaling_factor = original_config["model"]["params"]["scale_factor"] else: vae_scaling_factor = 0.18215 # default SD scaling factor vae_config["scaling_factor"] = vae_scaling_factor ctx = init_empty_weights if is_accelerate_available() else nullcontext with ctx(): vae = AutoencoderKL(**vae_config) if is_accelerate_available(): for param_name, param in converted_vae_checkpoint.items(): set_module_tensor_to_device(vae, param_name, "cpu", value=param) else: vae.load_state_dict(converted_vae_checkpoint) elif vae is None: vae = AutoencoderKL.from_pretrained(vae_path, local_files_only=local_files_only) if model_type == "FrozenOpenCLIPEmbedder": config_name = "stabilityai/stable-diffusion-2" config_kwargs = {"subfolder": "text_encoder"} if text_encoder is None: text_model = convert_open_clip_checkpoint( checkpoint, config_name, local_files_only=local_files_only, **config_kwargs ) else: text_model = text_encoder try: tokenizer = CLIPTokenizer.from_pretrained( "stabilityai/stable-diffusion-2", subfolder="tokenizer", local_files_only=local_files_only ) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the tokenizer in the following path: 'stabilityai/stable-diffusion-2'." ) if stable_unclip is None: if controlnet: pipe = pipeline_class( vae=vae, text_encoder=text_model, tokenizer=tokenizer, unet=unet, scheduler=scheduler, controlnet=controlnet, safety_checker=None, feature_extractor=None, ) if hasattr(pipe, "requires_safety_checker"): pipe.requires_safety_checker = False elif pipeline_class == StableDiffusionUpscalePipeline: scheduler = DDIMScheduler.from_pretrained( "stabilityai/stable-diffusion-x4-upscaler", subfolder="scheduler" ) low_res_scheduler = DDPMScheduler.from_pretrained( "stabilityai/stable-diffusion-x4-upscaler", subfolder="low_res_scheduler" ) pipe = pipeline_class( vae=vae, text_encoder=text_model, tokenizer=tokenizer, unet=unet, scheduler=scheduler, low_res_scheduler=low_res_scheduler, safety_checker=None, feature_extractor=None, ) else: pipe = pipeline_class( vae=vae, text_encoder=text_model, tokenizer=tokenizer, unet=unet, scheduler=scheduler, safety_checker=None, feature_extractor=None, ) if hasattr(pipe, "requires_safety_checker"): pipe.requires_safety_checker = False else: image_normalizer, image_noising_scheduler = stable_unclip_image_noising_components( original_config, clip_stats_path=clip_stats_path, device=device ) if stable_unclip == "img2img": feature_extractor, image_encoder = stable_unclip_image_encoder(original_config) pipe = StableUnCLIPImg2ImgPipeline( # image encoding components feature_extractor=feature_extractor, image_encoder=image_encoder, # image noising components image_normalizer=image_normalizer, image_noising_scheduler=image_noising_scheduler, # regular denoising components tokenizer=tokenizer, text_encoder=text_model, unet=unet, scheduler=scheduler, # vae vae=vae, ) elif stable_unclip == "txt2img": if stable_unclip_prior is None or stable_unclip_prior == "karlo": karlo_model = "kakaobrain/karlo-v1-alpha" prior = PriorTransformer.from_pretrained( karlo_model, subfolder="prior", local_files_only=local_files_only ) try: prior_tokenizer = CLIPTokenizer.from_pretrained( "openai/clip-vit-large-patch14", local_files_only=local_files_only ) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the tokenizer in the following path: 'openai/clip-vit-large-patch14'." ) prior_text_model = CLIPTextModelWithProjection.from_pretrained( "openai/clip-vit-large-patch14", local_files_only=local_files_only ) prior_scheduler = UnCLIPScheduler.from_pretrained( karlo_model, subfolder="prior_scheduler", local_files_only=local_files_only ) prior_scheduler = DDPMScheduler.from_config(prior_scheduler.config) else: raise NotImplementedError(f"unknown prior for stable unclip model: {stable_unclip_prior}") pipe = StableUnCLIPPipeline( # prior components prior_tokenizer=prior_tokenizer, prior_text_encoder=prior_text_model, prior=prior, prior_scheduler=prior_scheduler, # image noising components image_normalizer=image_normalizer, image_noising_scheduler=image_noising_scheduler, # regular denoising components tokenizer=tokenizer, text_encoder=text_model, unet=unet, scheduler=scheduler, # vae vae=vae, ) else: raise NotImplementedError(f"unknown `stable_unclip` type: {stable_unclip}") elif model_type == "PaintByExample": vision_model = convert_paint_by_example_checkpoint(checkpoint) try: tokenizer = CLIPTokenizer.from_pretrained( "openai/clip-vit-large-patch14", local_files_only=local_files_only ) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the tokenizer in the following path: 'openai/clip-vit-large-patch14'." ) try: feature_extractor = AutoFeatureExtractor.from_pretrained( "CompVis/stable-diffusion-safety-checker", local_files_only=local_files_only ) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the feature_extractor in the following path: 'CompVis/stable-diffusion-safety-checker'." ) pipe = PaintByExamplePipeline( vae=vae, image_encoder=vision_model, unet=unet, scheduler=scheduler, safety_checker=None, feature_extractor=feature_extractor, ) elif model_type == "FrozenCLIPEmbedder": text_model = convert_ldm_clip_checkpoint( checkpoint, local_files_only=local_files_only, text_encoder=text_encoder ) try: tokenizer = ( CLIPTokenizer.from_pretrained("openai/clip-vit-large-patch14", local_files_only=local_files_only) if tokenizer is None else tokenizer ) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the tokenizer in the following path: 'openai/clip-vit-large-patch14'." ) if load_safety_checker: safety_checker = StableDiffusionSafetyChecker.from_pretrained( "CompVis/stable-diffusion-safety-checker", local_files_only=local_files_only ) feature_extractor = AutoFeatureExtractor.from_pretrained( "CompVis/stable-diffusion-safety-checker", local_files_only=local_files_only ) else: safety_checker = None feature_extractor = None if controlnet: pipe = pipeline_class( vae=vae, text_encoder=text_model, tokenizer=tokenizer, unet=unet, controlnet=controlnet, scheduler=scheduler, safety_checker=safety_checker, feature_extractor=feature_extractor, ) else: pipe = pipeline_class( vae=vae, text_encoder=text_model, tokenizer=tokenizer, unet=unet, scheduler=scheduler, safety_checker=safety_checker, feature_extractor=feature_extractor, ) elif model_type in ["SDXL", "SDXL-Refiner"]: is_refiner = model_type == "SDXL-Refiner" if (is_refiner is False) and (tokenizer is None): try: tokenizer = CLIPTokenizer.from_pretrained( "openai/clip-vit-large-patch14", local_files_only=local_files_only ) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the tokenizer in the following path: 'openai/clip-vit-large-patch14'." ) if (is_refiner is False) and (text_encoder is None): text_encoder = convert_ldm_clip_checkpoint(checkpoint, local_files_only=local_files_only) if tokenizer_2 is None: try: tokenizer_2 = CLIPTokenizer.from_pretrained( "laion/CLIP-ViT-bigG-14-laion2B-39B-b160k", pad_token="!", local_files_only=local_files_only ) except Exception: raise ValueError( f"With local_files_only set to {local_files_only}, you must first locally save the tokenizer in the following path: 'laion/CLIP-ViT-bigG-14-laion2B-39B-b160k' with `pad_token` set to '!'." ) if text_encoder_2 is None: config_name = "laion/CLIP-ViT-bigG-14-laion2B-39B-b160k" config_kwargs = {"projection_dim": 1280} prefix = "conditioner.embedders.0.model." if is_refiner else "conditioner.embedders.1.model." text_encoder_2 = convert_open_clip_checkpoint( checkpoint, config_name, prefix=prefix, has_projection=True, local_files_only=local_files_only, **config_kwargs, ) if is_accelerate_available(): # SBM Now move model to cpu. for param_name, param in converted_unet_checkpoint.items(): set_module_tensor_to_device(unet, param_name, "cpu", value=param) if controlnet: pipe = pipeline_class( vae=vae, text_encoder=text_encoder, tokenizer=tokenizer, text_encoder_2=text_encoder_2, tokenizer_2=tokenizer_2, unet=unet, controlnet=controlnet, scheduler=scheduler, force_zeros_for_empty_prompt=True, ) elif adapter: pipe = pipeline_class( vae=vae, text_encoder=text_encoder, tokenizer=tokenizer, text_encoder_2=text_encoder_2, tokenizer_2=tokenizer_2, unet=unet, adapter=adapter, scheduler=scheduler, force_zeros_for_empty_prompt=True, ) else: pipeline_kwargs = { "vae": vae, "text_encoder": text_encoder, "tokenizer": tokenizer, "text_encoder_2": text_encoder_2, "tokenizer_2": tokenizer_2, "unet": unet, "scheduler": scheduler, } if (pipeline_class == StableDiffusionXLImg2ImgPipeline) or ( pipeline_class == StableDiffusionXLInpaintPipeline ): pipeline_kwargs.update({"requires_aesthetics_score": is_refiner}) if is_refiner: pipeline_kwargs.update({"force_zeros_for_empty_prompt": False}) pipe = pipeline_class(**pipeline_kwargs) else: text_config = create_ldm_bert_config(original_config) text_model = convert_ldm_bert_checkpoint(checkpoint, text_config) tokenizer = BertTokenizerFast.from_pretrained("bert-base-uncased", local_files_only=local_files_only) pipe = LDMTextToImagePipeline(vqvae=vae, bert=text_model, tokenizer=tokenizer, unet=unet, scheduler=scheduler) return pipe def download_controlnet_from_original_ckpt( checkpoint_path: str, original_config_file: str, image_size: int = 512, extract_ema: bool = False, num_in_channels: Optional[int] = None, upcast_attention: Optional[bool] = None, device: str = None, from_safetensors: bool = False, use_linear_projection: Optional[bool] = None, cross_attention_dim: Optional[bool] = None, ) -> DiffusionPipeline: if from_safetensors: from safetensors import safe_open checkpoint = {} with safe_open(checkpoint_path, framework="pt", device="cpu") as f: for key in f.keys(): checkpoint[key] = f.get_tensor(key) else: if device is None: device = "cuda" if torch.cuda.is_available() else "cpu" checkpoint = torch.load(checkpoint_path, map_location=device) else: checkpoint = torch.load(checkpoint_path, map_location=device) # NOTE: this while loop isn't great but this controlnet checkpoint has one additional # "state_dict" key https://huggingface.co/thibaud/controlnet-canny-sd21 while "state_dict" in checkpoint: checkpoint = checkpoint["state_dict"] original_config = yaml.safe_load(original_config_file) if num_in_channels is not None: original_config["model"]["params"]["unet_config"]["params"]["in_channels"] = num_in_channels if "control_stage_config" not in original_config["model"]["params"]: raise ValueError("`control_stage_config` not present in original config") controlnet = convert_controlnet_checkpoint( checkpoint, original_config, checkpoint_path, image_size, upcast_attention, extract_ema, use_linear_projection=use_linear_projection, cross_attention_dim=cross_attention_dim, ) return controlnet
diffusers/src/diffusers/pipelines/stable_diffusion/convert_from_ckpt.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/stable_diffusion/convert_from_ckpt.py", "repo_id": "diffusers", "token_count": 36006 }
120
# Copyright 2023 The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import inspect import warnings from typing import Any, Callable, Dict, List, Optional, Union import numpy as np import PIL.Image import torch from transformers import CLIPImageProcessor, CLIPTextModel, CLIPTokenizer from ...image_processor import PipelineImageInput, VaeImageProcessor from ...loaders import FromSingleFileMixin, LoraLoaderMixin, TextualInversionLoaderMixin from ...models import AutoencoderKL, UNet2DConditionModel from ...models.attention_processor import ( AttnProcessor2_0, LoRAAttnProcessor2_0, LoRAXFormersAttnProcessor, XFormersAttnProcessor, ) from ...models.lora import adjust_lora_scale_text_encoder from ...schedulers import DDPMScheduler, KarrasDiffusionSchedulers from ...utils import USE_PEFT_BACKEND, deprecate, logging, scale_lora_layers, unscale_lora_layers from ...utils.torch_utils import randn_tensor from ..pipeline_utils import DiffusionPipeline from . import StableDiffusionPipelineOutput logger = logging.get_logger(__name__) # pylint: disable=invalid-name def preprocess(image): warnings.warn( "The preprocess method is deprecated and will be removed in a future version. Please" " use VaeImageProcessor.preprocess instead", FutureWarning, ) if isinstance(image, torch.Tensor): return image elif isinstance(image, PIL.Image.Image): image = [image] if isinstance(image[0], PIL.Image.Image): w, h = image[0].size w, h = (x - x % 64 for x in (w, h)) # resize to integer multiple of 64 image = [np.array(i.resize((w, h)))[None, :] for i in image] image = np.concatenate(image, axis=0) image = np.array(image).astype(np.float32) / 255.0 image = image.transpose(0, 3, 1, 2) image = 2.0 * image - 1.0 image = torch.from_numpy(image) elif isinstance(image[0], torch.Tensor): image = torch.cat(image, dim=0) return image class StableDiffusionUpscalePipeline( DiffusionPipeline, TextualInversionLoaderMixin, LoraLoaderMixin, FromSingleFileMixin ): r""" Pipeline for text-guided image super-resolution using Stable Diffusion 2. This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods implemented for all pipelines (downloading, saving, running on a particular device, etc.). The pipeline also inherits the following loading methods: - [`~loaders.TextualInversionLoaderMixin.load_textual_inversion`] for loading textual inversion embeddings - [`~loaders.LoraLoaderMixin.load_lora_weights`] for loading LoRA weights - [`~loaders.LoraLoaderMixin.save_lora_weights`] for saving LoRA weights - [`~loaders.FromSingleFileMixin.from_single_file`] for loading `.ckpt` files Args: vae ([`AutoencoderKL`]): Variational Auto-Encoder (VAE) model to encode and decode images to and from latent representations. text_encoder ([`~transformers.CLIPTextModel`]): Frozen text-encoder ([clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14)). tokenizer ([`~transformers.CLIPTokenizer`]): A `CLIPTokenizer` to tokenize text. unet ([`UNet2DConditionModel`]): A `UNet2DConditionModel` to denoise the encoded image latents. low_res_scheduler ([`SchedulerMixin`]): A scheduler used to add initial noise to the low resolution conditioning image. It must be an instance of [`DDPMScheduler`]. scheduler ([`SchedulerMixin`]): A scheduler to be used in combination with `unet` to denoise the encoded image latents. Can be one of [`DDIMScheduler`], [`LMSDiscreteScheduler`], or [`PNDMScheduler`]. """ model_cpu_offload_seq = "text_encoder->unet->vae" _optional_components = ["watermarker", "safety_checker", "feature_extractor"] _exclude_from_cpu_offload = ["safety_checker"] def __init__( self, vae: AutoencoderKL, text_encoder: CLIPTextModel, tokenizer: CLIPTokenizer, unet: UNet2DConditionModel, low_res_scheduler: DDPMScheduler, scheduler: KarrasDiffusionSchedulers, safety_checker: Optional[Any] = None, feature_extractor: Optional[CLIPImageProcessor] = None, watermarker: Optional[Any] = None, max_noise_level: int = 350, ): super().__init__() if hasattr( vae, "config" ): # check if vae has a config attribute `scaling_factor` and if it is set to 0.08333, else set it to 0.08333 and deprecate is_vae_scaling_factor_set_to_0_08333 = ( hasattr(vae.config, "scaling_factor") and vae.config.scaling_factor == 0.08333 ) if not is_vae_scaling_factor_set_to_0_08333: deprecation_message = ( "The configuration file of the vae does not contain `scaling_factor` or it is set to" f" {vae.config.scaling_factor}, which seems highly unlikely. If your checkpoint is a fine-tuned" " version of `stabilityai/stable-diffusion-x4-upscaler` you should change 'scaling_factor' to" " 0.08333 Please make sure to update the config accordingly, as not doing so might lead to" " incorrect results in future versions. If you have downloaded this checkpoint from the Hugging" " Face Hub, it would be very nice if you could open a Pull Request for the `vae/config.json` file" ) deprecate("wrong scaling_factor", "1.0.0", deprecation_message, standard_warn=False) vae.register_to_config(scaling_factor=0.08333) self.register_modules( vae=vae, text_encoder=text_encoder, tokenizer=tokenizer, unet=unet, low_res_scheduler=low_res_scheduler, scheduler=scheduler, safety_checker=safety_checker, watermarker=watermarker, feature_extractor=feature_extractor, ) self.vae_scale_factor = 2 ** (len(self.vae.config.block_out_channels) - 1) self.image_processor = VaeImageProcessor(vae_scale_factor=self.vae_scale_factor, resample="bicubic") self.register_to_config(max_noise_level=max_noise_level) def run_safety_checker(self, image, device, dtype): if self.safety_checker is not None: feature_extractor_input = self.image_processor.postprocess(image, output_type="pil") safety_checker_input = self.feature_extractor(feature_extractor_input, return_tensors="pt").to(device) image, nsfw_detected, watermark_detected = self.safety_checker( images=image, clip_input=safety_checker_input.pixel_values.to(dtype=dtype), ) else: nsfw_detected = None watermark_detected = None if hasattr(self, "unet_offload_hook") and self.unet_offload_hook is not None: self.unet_offload_hook.offload() return image, nsfw_detected, watermark_detected # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline._encode_prompt def _encode_prompt( self, prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt=None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, **kwargs, ): deprecation_message = "`_encode_prompt()` is deprecated and it will be removed in a future version. Use `encode_prompt()` instead. Also, be aware that the output format changed from a concatenated tensor to a tuple." deprecate("_encode_prompt()", "1.0.0", deprecation_message, standard_warn=False) prompt_embeds_tuple = self.encode_prompt( prompt=prompt, device=device, num_images_per_prompt=num_images_per_prompt, do_classifier_free_guidance=do_classifier_free_guidance, negative_prompt=negative_prompt, prompt_embeds=prompt_embeds, negative_prompt_embeds=negative_prompt_embeds, lora_scale=lora_scale, **kwargs, ) # concatenate for backwards comp prompt_embeds = torch.cat([prompt_embeds_tuple[1], prompt_embeds_tuple[0]]) return prompt_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.encode_prompt def encode_prompt( self, prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt=None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, clip_skip: Optional[int] = None, ): r""" Encodes the prompt into text encoder hidden states. Args: prompt (`str` or `List[str]`, *optional*): prompt to be encoded device: (`torch.device`): torch device num_images_per_prompt (`int`): number of images that should be generated per prompt do_classifier_free_guidance (`bool`): whether to use classifier free guidance or not negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. lora_scale (`float`, *optional*): A LoRA scale that will be applied to all LoRA layers of the text encoder if LoRA layers are loaded. clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. """ # set lora scale so that monkey patched LoRA # function of text encoder can correctly access it if lora_scale is not None and isinstance(self, LoraLoaderMixin): self._lora_scale = lora_scale # dynamically adjust the LoRA scale if not USE_PEFT_BACKEND: adjust_lora_scale_text_encoder(self.text_encoder, lora_scale) else: scale_lora_layers(self.text_encoder, lora_scale) if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if prompt_embeds is None: # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): prompt = self.maybe_convert_prompt(prompt, self.tokenizer) text_inputs = self.tokenizer( prompt, padding="max_length", max_length=self.tokenizer.model_max_length, truncation=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = self.tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal( text_input_ids, untruncated_ids ): removed_text = self.tokenizer.batch_decode( untruncated_ids[:, self.tokenizer.model_max_length - 1 : -1] ) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {self.tokenizer.model_max_length} tokens: {removed_text}" ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = text_inputs.attention_mask.to(device) else: attention_mask = None if clip_skip is None: prompt_embeds = self.text_encoder(text_input_ids.to(device), attention_mask=attention_mask) prompt_embeds = prompt_embeds[0] else: prompt_embeds = self.text_encoder( text_input_ids.to(device), attention_mask=attention_mask, output_hidden_states=True ) # Access the `hidden_states` first, that contains a tuple of # all the hidden states from the encoder layers. Then index into # the tuple to access the hidden states from the desired layer. prompt_embeds = prompt_embeds[-1][-(clip_skip + 1)] # We also need to apply the final LayerNorm here to not mess with the # representations. The `last_hidden_states` that we typically use for # obtaining the final prompt representations passes through the LayerNorm # layer. prompt_embeds = self.text_encoder.text_model.final_layer_norm(prompt_embeds) if self.text_encoder is not None: prompt_embeds_dtype = self.text_encoder.dtype elif self.unet is not None: prompt_embeds_dtype = self.unet.dtype else: prompt_embeds_dtype = prompt_embeds.dtype prompt_embeds = prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) bs_embed, seq_len, _ = prompt_embeds.shape # duplicate text embeddings for each generation per prompt, using mps friendly method prompt_embeds = prompt_embeds.repeat(1, num_images_per_prompt, 1) prompt_embeds = prompt_embeds.view(bs_embed * num_images_per_prompt, seq_len, -1) # get unconditional embeddings for classifier free guidance if do_classifier_free_guidance and negative_prompt_embeds is None: uncond_tokens: List[str] if negative_prompt is None: uncond_tokens = [""] * batch_size elif prompt is not None and type(prompt) is not type(negative_prompt): raise TypeError( f"`negative_prompt` should be the same type to `prompt`, but got {type(negative_prompt)} !=" f" {type(prompt)}." ) elif isinstance(negative_prompt, str): uncond_tokens = [negative_prompt] elif batch_size != len(negative_prompt): raise ValueError( f"`negative_prompt`: {negative_prompt} has batch size {len(negative_prompt)}, but `prompt`:" f" {prompt} has batch size {batch_size}. Please make sure that passed `negative_prompt` matches" " the batch size of `prompt`." ) else: uncond_tokens = negative_prompt # textual inversion: procecss multi-vector tokens if necessary if isinstance(self, TextualInversionLoaderMixin): uncond_tokens = self.maybe_convert_prompt(uncond_tokens, self.tokenizer) max_length = prompt_embeds.shape[1] uncond_input = self.tokenizer( uncond_tokens, padding="max_length", max_length=max_length, truncation=True, return_tensors="pt", ) if hasattr(self.text_encoder.config, "use_attention_mask") and self.text_encoder.config.use_attention_mask: attention_mask = uncond_input.attention_mask.to(device) else: attention_mask = None negative_prompt_embeds = self.text_encoder( uncond_input.input_ids.to(device), attention_mask=attention_mask, ) negative_prompt_embeds = negative_prompt_embeds[0] if do_classifier_free_guidance: # duplicate unconditional embeddings for each generation per prompt, using mps friendly method seq_len = negative_prompt_embeds.shape[1] negative_prompt_embeds = negative_prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) negative_prompt_embeds = negative_prompt_embeds.repeat(1, num_images_per_prompt, 1) negative_prompt_embeds = negative_prompt_embeds.view(batch_size * num_images_per_prompt, seq_len, -1) if isinstance(self, LoraLoaderMixin) and USE_PEFT_BACKEND: # Retrieve the original scale by scaling back the LoRA layers unscale_lora_layers(self.text_encoder, lora_scale) return prompt_embeds, negative_prompt_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_extra_step_kwargs def prepare_extra_step_kwargs(self, generator, eta): # prepare extra kwargs for the scheduler step, since not all schedulers have the same signature # eta (ฮท) is only used with the DDIMScheduler, it will be ignored for other schedulers. # eta corresponds to ฮท in DDIM paper: https://arxiv.org/abs/2010.02502 # and should be between [0, 1] accepts_eta = "eta" in set(inspect.signature(self.scheduler.step).parameters.keys()) extra_step_kwargs = {} if accepts_eta: extra_step_kwargs["eta"] = eta # check if the scheduler accepts generator accepts_generator = "generator" in set(inspect.signature(self.scheduler.step).parameters.keys()) if accepts_generator: extra_step_kwargs["generator"] = generator return extra_step_kwargs # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.decode_latents def decode_latents(self, latents): deprecation_message = "The decode_latents method is deprecated and will be removed in 1.0.0. Please use VaeImageProcessor.postprocess(...) instead" deprecate("decode_latents", "1.0.0", deprecation_message, standard_warn=False) latents = 1 / self.vae.config.scaling_factor * latents image = self.vae.decode(latents, return_dict=False)[0] image = (image / 2 + 0.5).clamp(0, 1) # we always cast to float32 as this does not cause significant overhead and is compatible with bfloat16 image = image.cpu().permute(0, 2, 3, 1).float().numpy() return image def check_inputs( self, prompt, image, noise_level, callback_steps, negative_prompt=None, prompt_embeds=None, negative_prompt_embeds=None, ): if (callback_steps is None) or ( callback_steps is not None and (not isinstance(callback_steps, int) or callback_steps <= 0) ): raise ValueError( f"`callback_steps` has to be a positive integer but is {callback_steps} of type" f" {type(callback_steps)}." ) if prompt is not None and prompt_embeds is not None: raise ValueError( f"Cannot forward both `prompt`: {prompt} and `prompt_embeds`: {prompt_embeds}. Please make sure to" " only forward one of the two." ) elif prompt is None and prompt_embeds is None: raise ValueError( "Provide either `prompt` or `prompt_embeds`. Cannot leave both `prompt` and `prompt_embeds` undefined." ) elif prompt is not None and (not isinstance(prompt, str) and not isinstance(prompt, list)): raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") if negative_prompt is not None and negative_prompt_embeds is not None: raise ValueError( f"Cannot forward both `negative_prompt`: {negative_prompt} and `negative_prompt_embeds`:" f" {negative_prompt_embeds}. Please make sure to only forward one of the two." ) if prompt_embeds is not None and negative_prompt_embeds is not None: if prompt_embeds.shape != negative_prompt_embeds.shape: raise ValueError( "`prompt_embeds` and `negative_prompt_embeds` must have the same shape when passed directly, but" f" got: `prompt_embeds` {prompt_embeds.shape} != `negative_prompt_embeds`" f" {negative_prompt_embeds.shape}." ) if ( not isinstance(image, torch.Tensor) and not isinstance(image, PIL.Image.Image) and not isinstance(image, np.ndarray) and not isinstance(image, list) ): raise ValueError( f"`image` has to be of type `torch.Tensor`, `np.ndarray`, `PIL.Image.Image` or `list` but is {type(image)}" ) # verify batch size of prompt and image are same if image is a list or tensor or numpy array if isinstance(image, list) or isinstance(image, torch.Tensor) or isinstance(image, np.ndarray): if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] if isinstance(image, list): image_batch_size = len(image) else: image_batch_size = image.shape[0] if batch_size != image_batch_size: raise ValueError( f"`prompt` has batch size {batch_size} and `image` has batch size {image_batch_size}." " Please make sure that passed `prompt` matches the batch size of `image`." ) # check noise level if noise_level > self.config.max_noise_level: raise ValueError(f"`noise_level` has to be <= {self.config.max_noise_level} but is {noise_level}") if (callback_steps is None) or ( callback_steps is not None and (not isinstance(callback_steps, int) or callback_steps <= 0) ): raise ValueError( f"`callback_steps` has to be a positive integer but is {callback_steps} of type" f" {type(callback_steps)}." ) def prepare_latents(self, batch_size, num_channels_latents, height, width, dtype, device, generator, latents=None): shape = (batch_size, num_channels_latents, height, width) if latents is None: latents = randn_tensor(shape, generator=generator, device=device, dtype=dtype) else: if latents.shape != shape: raise ValueError(f"Unexpected latents shape, got {latents.shape}, expected {shape}") latents = latents.to(device) # scale the initial noise by the standard deviation required by the scheduler latents = latents * self.scheduler.init_noise_sigma return latents def upcast_vae(self): dtype = self.vae.dtype self.vae.to(dtype=torch.float32) use_torch_2_0_or_xformers = isinstance( self.vae.decoder.mid_block.attentions[0].processor, ( AttnProcessor2_0, XFormersAttnProcessor, LoRAXFormersAttnProcessor, LoRAAttnProcessor2_0, ), ) # if xformers or torch_2_0 is used attention block does not need # to be in float32 which can save lots of memory if use_torch_2_0_or_xformers: self.vae.post_quant_conv.to(dtype) self.vae.decoder.conv_in.to(dtype) self.vae.decoder.mid_block.to(dtype) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_freeu def enable_freeu(self, s1: float, s2: float, b1: float, b2: float): r"""Enables the FreeU mechanism as in https://arxiv.org/abs/2309.11497. The suffixes after the scaling factors represent the stages where they are being applied. Please refer to the [official repository](https://github.com/ChenyangSi/FreeU) for combinations of the values that are known to work well for different pipelines such as Stable Diffusion v1, v2, and Stable Diffusion XL. Args: s1 (`float`): Scaling factor for stage 1 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. s2 (`float`): Scaling factor for stage 2 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. b1 (`float`): Scaling factor for stage 1 to amplify the contributions of backbone features. b2 (`float`): Scaling factor for stage 2 to amplify the contributions of backbone features. """ if not hasattr(self, "unet"): raise ValueError("The pipeline must have `unet` for using FreeU.") self.unet.enable_freeu(s1=s1, s2=s2, b1=b1, b2=b2) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_freeu def disable_freeu(self): """Disables the FreeU mechanism if enabled.""" self.unet.disable_freeu() @torch.no_grad() def __call__( self, prompt: Union[str, List[str]] = None, image: PipelineImageInput = None, num_inference_steps: int = 75, guidance_scale: float = 9.0, noise_level: int = 20, negative_prompt: Optional[Union[str, List[str]]] = None, num_images_per_prompt: Optional[int] = 1, eta: float = 0.0, generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, latents: Optional[torch.FloatTensor] = None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, output_type: Optional[str] = "pil", return_dict: bool = True, callback: Optional[Callable[[int, int, torch.FloatTensor], None]] = None, callback_steps: int = 1, cross_attention_kwargs: Optional[Dict[str, Any]] = None, clip_skip: int = None, ): r""" The call function to the pipeline for generation. Args: prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide image generation. If not defined, you need to pass `prompt_embeds`. image (`torch.FloatTensor`, `PIL.Image.Image`, `np.ndarray`, `List[torch.FloatTensor]`, `List[PIL.Image.Image]`, or `List[np.ndarray]`): `Image` or tensor representing an image batch to be upscaled. num_inference_steps (`int`, *optional*, defaults to 50): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. guidance_scale (`float`, *optional*, defaults to 7.5): A higher guidance scale value encourages the model to generate images closely linked to the text `prompt` at the expense of lower image quality. Guidance scale is enabled when `guidance_scale > 1`. negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide what to not include in image generation. If not defined, you need to pass `negative_prompt_embeds` instead. Ignored when not using guidance (`guidance_scale < 1`). num_images_per_prompt (`int`, *optional*, defaults to 1): The number of images to generate per prompt. eta (`float`, *optional*, defaults to 0.0): Corresponds to parameter eta (ฮท) from the [DDIM](https://arxiv.org/abs/2010.02502) paper. Only applies to the [`~schedulers.DDIMScheduler`], and is ignored in other schedulers. generator (`torch.Generator` or `List[torch.Generator]`, *optional*): A [`torch.Generator`](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor is generated by sampling using the supplied random `generator`. prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs (prompt weighting). If not provided, text embeddings are generated from the `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs (prompt weighting). If not provided, `negative_prompt_embeds` are generated from the `negative_prompt` input argument. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generated image. Choose between `PIL.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] instead of a plain tuple. callback (`Callable`, *optional*): A function that calls every `callback_steps` steps during inference. The function is called with the following arguments: `callback(step: int, timestep: int, latents: torch.FloatTensor)`. callback_steps (`int`, *optional*, defaults to 1): The frequency at which the `callback` function is called. If not specified, the callback is called at every step. cross_attention_kwargs (`dict`, *optional*): A kwargs dictionary that if specified is passed along to the [`AttentionProcessor`] as defined in [`self.processor`](https://github.com/huggingface/diffusers/blob/main/src/diffusers/models/attention_processor.py). clip_skip (`int`, *optional*): Number of layers to be skipped from CLIP while computing the prompt embeddings. A value of 1 means that the output of the pre-final layer will be used for computing the prompt embeddings. Examples: ```py >>> import requests >>> from PIL import Image >>> from io import BytesIO >>> from diffusers import StableDiffusionUpscalePipeline >>> import torch >>> # load model and scheduler >>> model_id = "stabilityai/stable-diffusion-x4-upscaler" >>> pipeline = StableDiffusionUpscalePipeline.from_pretrained( ... model_id, revision="fp16", torch_dtype=torch.float16 ... ) >>> pipeline = pipeline.to("cuda") >>> # let's download an image >>> url = "https://huggingface.co/datasets/hf-internal-testing/diffusers-images/resolve/main/sd2-upscale/low_res_cat.png" >>> response = requests.get(url) >>> low_res_img = Image.open(BytesIO(response.content)).convert("RGB") >>> low_res_img = low_res_img.resize((128, 128)) >>> prompt = "a white cat" >>> upscaled_image = pipeline(prompt=prompt, image=low_res_img).images[0] >>> upscaled_image.save("upsampled_cat.png") ``` Returns: [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] or `tuple`: If `return_dict` is `True`, [`~pipelines.stable_diffusion.StableDiffusionPipelineOutput`] is returned, otherwise a `tuple` is returned where the first element is a list with the generated images and the second element is a list of `bool`s indicating whether the corresponding generated image contains "not-safe-for-work" (nsfw) content. """ # 1. Check inputs self.check_inputs( prompt, image, noise_level, callback_steps, negative_prompt, prompt_embeds, negative_prompt_embeds, ) if image is None: raise ValueError("`image` input cannot be undefined.") # 2. Define call parameters if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] device = self._execution_device # here `guidance_scale` is defined analog to the guidance weight `w` of equation (2) # of the Imagen paper: https://arxiv.org/pdf/2205.11487.pdf . `guidance_scale = 1` # corresponds to doing no classifier free guidance. do_classifier_free_guidance = guidance_scale > 1.0 # 3. Encode input prompt text_encoder_lora_scale = ( cross_attention_kwargs.get("scale", None) if cross_attention_kwargs is not None else None ) prompt_embeds, negative_prompt_embeds = self.encode_prompt( prompt, device, num_images_per_prompt, do_classifier_free_guidance, negative_prompt, prompt_embeds=prompt_embeds, negative_prompt_embeds=negative_prompt_embeds, lora_scale=text_encoder_lora_scale, clip_skip=clip_skip, ) # For classifier free guidance, we need to do two forward passes. # Here we concatenate the unconditional and text embeddings into a single batch # to avoid doing two forward passes if do_classifier_free_guidance: prompt_embeds = torch.cat([negative_prompt_embeds, prompt_embeds]) # 4. Preprocess image image = self.image_processor.preprocess(image) image = image.to(dtype=prompt_embeds.dtype, device=device) # 5. set timesteps self.scheduler.set_timesteps(num_inference_steps, device=device) timesteps = self.scheduler.timesteps # 5. Add noise to image noise_level = torch.tensor([noise_level], dtype=torch.long, device=device) noise = randn_tensor(image.shape, generator=generator, device=device, dtype=prompt_embeds.dtype) image = self.low_res_scheduler.add_noise(image, noise, noise_level) batch_multiplier = 2 if do_classifier_free_guidance else 1 image = torch.cat([image] * batch_multiplier * num_images_per_prompt) noise_level = torch.cat([noise_level] * image.shape[0]) # 6. Prepare latent variables height, width = image.shape[2:] num_channels_latents = self.vae.config.latent_channels latents = self.prepare_latents( batch_size * num_images_per_prompt, num_channels_latents, height, width, prompt_embeds.dtype, device, generator, latents, ) # 7. Check that sizes of image and latents match num_channels_image = image.shape[1] if num_channels_latents + num_channels_image != self.unet.config.in_channels: raise ValueError( f"Incorrect configuration settings! The config of `pipeline.unet`: {self.unet.config} expects" f" {self.unet.config.in_channels} but received `num_channels_latents`: {num_channels_latents} +" f" `num_channels_image`: {num_channels_image} " f" = {num_channels_latents+num_channels_image}. Please verify the config of" " `pipeline.unet` or your `image` input." ) # 8. Prepare extra step kwargs. TODO: Logic should ideally just be moved out of the pipeline extra_step_kwargs = self.prepare_extra_step_kwargs(generator, eta) # 9. Denoising loop num_warmup_steps = len(timesteps) - num_inference_steps * self.scheduler.order with self.progress_bar(total=num_inference_steps) as progress_bar: for i, t in enumerate(timesteps): # expand the latents if we are doing classifier free guidance latent_model_input = torch.cat([latents] * 2) if do_classifier_free_guidance else latents # concat latents, mask, masked_image_latents in the channel dimension latent_model_input = self.scheduler.scale_model_input(latent_model_input, t) latent_model_input = torch.cat([latent_model_input, image], dim=1) # predict the noise residual noise_pred = self.unet( latent_model_input, t, encoder_hidden_states=prompt_embeds, cross_attention_kwargs=cross_attention_kwargs, class_labels=noise_level, return_dict=False, )[0] # perform guidance if do_classifier_free_guidance: noise_pred_uncond, noise_pred_text = noise_pred.chunk(2) noise_pred = noise_pred_uncond + guidance_scale * (noise_pred_text - noise_pred_uncond) # compute the previous noisy sample x_t -> x_t-1 latents = self.scheduler.step(noise_pred, t, latents, **extra_step_kwargs, return_dict=False)[0] # call the callback, if provided if i == len(timesteps) - 1 or ((i + 1) > num_warmup_steps and (i + 1) % self.scheduler.order == 0): progress_bar.update() if callback is not None and i % callback_steps == 0: step_idx = i // getattr(self.scheduler, "order", 1) callback(step_idx, t, latents) if not output_type == "latent": # make sure the VAE is in float32 mode, as it overflows in float16 needs_upcasting = self.vae.dtype == torch.float16 and self.vae.config.force_upcast if needs_upcasting: self.upcast_vae() # Ensure latents are always the same type as the VAE latents = latents.to(next(iter(self.vae.post_quant_conv.parameters())).dtype) image = self.vae.decode(latents / self.vae.config.scaling_factor, return_dict=False)[0] # cast back to fp16 if needed if needs_upcasting: self.vae.to(dtype=torch.float16) image, has_nsfw_concept, _ = self.run_safety_checker(image, device, prompt_embeds.dtype) else: image = latents has_nsfw_concept = None if has_nsfw_concept is None: do_denormalize = [True] * image.shape[0] else: do_denormalize = [not has_nsfw for has_nsfw in has_nsfw_concept] image = self.image_processor.postprocess(image, output_type=output_type, do_denormalize=do_denormalize) # 11. Apply watermark if output_type == "pil" and self.watermarker is not None: image = self.watermarker.apply_watermark(image) # Offload all models self.maybe_free_model_hooks() if not return_dict: return (image, has_nsfw_concept) return StableDiffusionPipelineOutput(images=image, nsfw_content_detected=has_nsfw_concept)
diffusers/src/diffusers/pipelines/stable_diffusion/pipeline_stable_diffusion_upscale.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/stable_diffusion/pipeline_stable_diffusion_upscale.py", "repo_id": "diffusers", "token_count": 18168 }
121
# Copyright 2023 Harutatsu Akiyama and The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import inspect from typing import Any, Callable, Dict, List, Optional, Tuple, Union import PIL.Image import torch from transformers import CLIPTextModel, CLIPTextModelWithProjection, CLIPTokenizer from ...image_processor import PipelineImageInput, VaeImageProcessor from ...loaders import FromSingleFileMixin, StableDiffusionXLLoraLoaderMixin, TextualInversionLoaderMixin from ...models import AutoencoderKL, UNet2DConditionModel from ...models.attention_processor import ( AttnProcessor2_0, FusedAttnProcessor2_0, LoRAAttnProcessor2_0, LoRAXFormersAttnProcessor, XFormersAttnProcessor, ) from ...models.lora import adjust_lora_scale_text_encoder from ...schedulers import KarrasDiffusionSchedulers from ...utils import ( USE_PEFT_BACKEND, deprecate, is_invisible_watermark_available, is_torch_xla_available, logging, replace_example_docstring, scale_lora_layers, ) from ...utils.torch_utils import randn_tensor from ..pipeline_utils import DiffusionPipeline from .pipeline_output import StableDiffusionXLPipelineOutput if is_invisible_watermark_available(): from .watermark import StableDiffusionXLWatermarker if is_torch_xla_available(): import torch_xla.core.xla_model as xm XLA_AVAILABLE = True else: XLA_AVAILABLE = False logger = logging.get_logger(__name__) # pylint: disable=invalid-name EXAMPLE_DOC_STRING = """ Examples: ```py >>> import torch >>> from diffusers import StableDiffusionXLInstructPix2PixPipeline >>> from diffusers.utils import load_image >>> resolution = 768 >>> image = load_image( ... "https://hf.co/datasets/diffusers/diffusers-images-docs/resolve/main/mountain.png" ... ).resize((resolution, resolution)) >>> edit_instruction = "Turn sky into a cloudy one" >>> pipe = StableDiffusionXLInstructPix2PixPipeline.from_pretrained( ... "diffusers/sdxl-instructpix2pix-768", torch_dtype=torch.float16 ... ).to("cuda") >>> edited_image = pipe( ... prompt=edit_instruction, ... image=image, ... height=resolution, ... width=resolution, ... guidance_scale=3.0, ... image_guidance_scale=1.5, ... num_inference_steps=30, ... ).images[0] >>> edited_image ``` """ # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion_img2img.retrieve_latents def retrieve_latents( encoder_output: torch.Tensor, generator: Optional[torch.Generator] = None, sample_mode: str = "sample" ): if hasattr(encoder_output, "latent_dist") and sample_mode == "sample": return encoder_output.latent_dist.sample(generator) elif hasattr(encoder_output, "latent_dist") and sample_mode == "argmax": return encoder_output.latent_dist.mode() elif hasattr(encoder_output, "latents"): return encoder_output.latents else: raise AttributeError("Could not access latents of provided encoder_output") def rescale_noise_cfg(noise_cfg, noise_pred_text, guidance_rescale=0.0): """ Rescale `noise_cfg` according to `guidance_rescale`. Based on findings of [Common Diffusion Noise Schedules and Sample Steps are Flawed](https://arxiv.org/pdf/2305.08891.pdf). See Section 3.4 """ std_text = noise_pred_text.std(dim=list(range(1, noise_pred_text.ndim)), keepdim=True) std_cfg = noise_cfg.std(dim=list(range(1, noise_cfg.ndim)), keepdim=True) # rescale the results from guidance (fixes overexposure) noise_pred_rescaled = noise_cfg * (std_text / std_cfg) # mix with the original results from guidance by factor guidance_rescale to avoid "plain looking" images noise_cfg = guidance_rescale * noise_pred_rescaled + (1 - guidance_rescale) * noise_cfg return noise_cfg class StableDiffusionXLInstructPix2PixPipeline( DiffusionPipeline, TextualInversionLoaderMixin, FromSingleFileMixin, StableDiffusionXLLoraLoaderMixin ): r""" Pipeline for pixel-level image editing by following text instructions. Based on Stable Diffusion XL. This model inherits from [`DiffusionPipeline`]. Check the superclass documentation for the generic methods the library implements for all the pipelines (such as downloading or saving, running on a particular device, etc.) The pipeline also inherits the following loading methods: - [`~loaders.TextualInversionLoaderMixin.load_textual_inversion`] for loading textual inversion embeddings - [`~loaders.FromSingleFileMixin.from_single_file`] for loading `.ckpt` files - [`~loaders.StableDiffusionXLLoraLoaderMixin.load_lora_weights`] for loading LoRA weights - [`~loaders.StableDiffusionXLLoraLoaderMixin.save_lora_weights`] for saving LoRA weights Args: vae ([`AutoencoderKL`]): Variational Auto-Encoder (VAE) Model to encode and decode images to and from latent representations. text_encoder ([`CLIPTextModel`]): Frozen text-encoder. Stable Diffusion XL uses the text portion of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip#transformers.CLIPTextModel), specifically the [clip-vit-large-patch14](https://huggingface.co/openai/clip-vit-large-patch14) variant. text_encoder_2 ([` CLIPTextModelWithProjection`]): Second frozen text-encoder. Stable Diffusion XL uses the text and pool portion of [CLIP](https://huggingface.co/docs/transformers/model_doc/clip#transformers.CLIPTextModelWithProjection), specifically the [laion/CLIP-ViT-bigG-14-laion2B-39B-b160k](https://huggingface.co/laion/CLIP-ViT-bigG-14-laion2B-39B-b160k) variant. tokenizer (`CLIPTokenizer`): Tokenizer of class [CLIPTokenizer](https://huggingface.co/docs/transformers/v4.21.0/en/model_doc/clip#transformers.CLIPTokenizer). tokenizer_2 (`CLIPTokenizer`): Second Tokenizer of class [CLIPTokenizer](https://huggingface.co/docs/transformers/v4.21.0/en/model_doc/clip#transformers.CLIPTokenizer). unet ([`UNet2DConditionModel`]): Conditional U-Net architecture to denoise the encoded image latents. scheduler ([`SchedulerMixin`]): A scheduler to be used in combination with `unet` to denoise the encoded image latents. Can be one of [`DDIMScheduler`], [`LMSDiscreteScheduler`], or [`PNDMScheduler`]. requires_aesthetics_score (`bool`, *optional*, defaults to `"False"`): Whether the `unet` requires a aesthetic_score condition to be passed during inference. Also see the config of `stabilityai/stable-diffusion-xl-refiner-1-0`. force_zeros_for_empty_prompt (`bool`, *optional*, defaults to `"True"`): Whether the negative prompt embeddings shall be forced to always be set to 0. Also see the config of `stabilityai/stable-diffusion-xl-base-1-0`. add_watermarker (`bool`, *optional*): Whether to use the [invisible_watermark library](https://github.com/ShieldMnt/invisible-watermark/) to watermark output images. If not defined, it will default to True if the package is installed, otherwise no watermarker will be used. """ model_cpu_offload_seq = "text_encoder->text_encoder_2->unet->vae" _optional_components = ["tokenizer", "tokenizer_2", "text_encoder", "text_encoder_2"] def __init__( self, vae: AutoencoderKL, text_encoder: CLIPTextModel, text_encoder_2: CLIPTextModelWithProjection, tokenizer: CLIPTokenizer, tokenizer_2: CLIPTokenizer, unet: UNet2DConditionModel, scheduler: KarrasDiffusionSchedulers, force_zeros_for_empty_prompt: bool = True, add_watermarker: Optional[bool] = None, ): super().__init__() self.register_modules( vae=vae, text_encoder=text_encoder, text_encoder_2=text_encoder_2, tokenizer=tokenizer, tokenizer_2=tokenizer_2, unet=unet, scheduler=scheduler, ) self.register_to_config(force_zeros_for_empty_prompt=force_zeros_for_empty_prompt) self.vae_scale_factor = 2 ** (len(self.vae.config.block_out_channels) - 1) self.image_processor = VaeImageProcessor(vae_scale_factor=self.vae_scale_factor) self.default_sample_size = self.unet.config.sample_size add_watermarker = add_watermarker if add_watermarker is not None else is_invisible_watermark_available() if add_watermarker: self.watermark = StableDiffusionXLWatermarker() else: self.watermark = None def enable_vae_slicing(self): r""" Enable sliced VAE decoding. When this option is enabled, the VAE will split the input tensor in slices to compute decoding in several steps. This is useful to save some memory and allow larger batch sizes. """ self.vae.enable_slicing() def disable_vae_slicing(self): r""" Disable sliced VAE decoding. If `enable_vae_slicing` was previously invoked, this method will go back to computing decoding in one step. """ self.vae.disable_slicing() def enable_vae_tiling(self): r""" Enable tiled VAE decoding. When this option is enabled, the VAE will split the input tensor into tiles to compute decoding and encoding in several steps. This is useful to save a large amount of memory and to allow the processing of larger images. """ self.vae.enable_tiling() def disable_vae_tiling(self): r""" Disable tiled VAE decoding. If `enable_vae_tiling` was previously invoked, this method will go back to computing decoding in one step. """ self.vae.disable_tiling() def encode_prompt( self, prompt: str, prompt_2: Optional[str] = None, device: Optional[torch.device] = None, num_images_per_prompt: int = 1, do_classifier_free_guidance: bool = True, negative_prompt: Optional[str] = None, negative_prompt_2: Optional[str] = None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, pooled_prompt_embeds: Optional[torch.FloatTensor] = None, negative_pooled_prompt_embeds: Optional[torch.FloatTensor] = None, lora_scale: Optional[float] = None, ): r""" Encodes the prompt into text encoder hidden states. Args: prompt (`str` or `List[str]`, *optional*): prompt to be encoded prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts to be sent to the `tokenizer_2` and `text_encoder_2`. If not defined, `prompt` is used in both text-encoders device: (`torch.device`): torch device num_images_per_prompt (`int`): number of images that should be generated per prompt do_classifier_free_guidance (`bool`): whether to use classifier free guidance or not negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). negative_prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation to be sent to `tokenizer_2` and `text_encoder_2`. If not defined, `negative_prompt` is used in both text-encoders prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled text embeddings will be generated from `prompt` input argument. negative_pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled negative_prompt_embeds will be generated from `negative_prompt` input argument. lora_scale (`float`, *optional*): A lora scale that will be applied to all LoRA layers of the text encoder if LoRA layers are loaded. """ device = device or self._execution_device # set lora scale so that monkey patched LoRA # function of text encoder can correctly access it if lora_scale is not None and isinstance(self, StableDiffusionXLLoraLoaderMixin): self._lora_scale = lora_scale # dynamically adjust the LoRA scale if self.text_encoder is not None: if not USE_PEFT_BACKEND: adjust_lora_scale_text_encoder(self.text_encoder, lora_scale) else: scale_lora_layers(self.text_encoder, lora_scale) if self.text_encoder_2 is not None: if not USE_PEFT_BACKEND: adjust_lora_scale_text_encoder(self.text_encoder_2, lora_scale) else: scale_lora_layers(self.text_encoder_2, lora_scale) if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] # Define tokenizers and text encoders tokenizers = [self.tokenizer, self.tokenizer_2] if self.tokenizer is not None else [self.tokenizer_2] text_encoders = ( [self.text_encoder, self.text_encoder_2] if self.text_encoder is not None else [self.text_encoder_2] ) if prompt_embeds is None: prompt_2 = prompt_2 or prompt # textual inversion: procecss multi-vector tokens if necessary prompt_embeds_list = [] prompts = [prompt, prompt_2] for prompt, tokenizer, text_encoder in zip(prompts, tokenizers, text_encoders): if isinstance(self, TextualInversionLoaderMixin): prompt = self.maybe_convert_prompt(prompt, tokenizer) text_inputs = tokenizer( prompt, padding="max_length", max_length=tokenizer.model_max_length, truncation=True, return_tensors="pt", ) text_input_ids = text_inputs.input_ids untruncated_ids = tokenizer(prompt, padding="longest", return_tensors="pt").input_ids if untruncated_ids.shape[-1] >= text_input_ids.shape[-1] and not torch.equal( text_input_ids, untruncated_ids ): removed_text = tokenizer.batch_decode(untruncated_ids[:, tokenizer.model_max_length - 1 : -1]) logger.warning( "The following part of your input was truncated because CLIP can only handle sequences up to" f" {tokenizer.model_max_length} tokens: {removed_text}" ) prompt_embeds = text_encoder( text_input_ids.to(device), output_hidden_states=True, ) # We are only ALWAYS interested in the pooled output of the final text encoder pooled_prompt_embeds = prompt_embeds[0] prompt_embeds = prompt_embeds.hidden_states[-2] prompt_embeds_list.append(prompt_embeds) prompt_embeds = torch.concat(prompt_embeds_list, dim=-1) # get unconditional embeddings for classifier free guidance zero_out_negative_prompt = negative_prompt is None and self.config.force_zeros_for_empty_prompt if do_classifier_free_guidance and negative_prompt_embeds is None and zero_out_negative_prompt: negative_prompt_embeds = torch.zeros_like(prompt_embeds) negative_pooled_prompt_embeds = torch.zeros_like(pooled_prompt_embeds) elif do_classifier_free_guidance and negative_prompt_embeds is None: negative_prompt = negative_prompt or "" negative_prompt_2 = negative_prompt_2 or negative_prompt uncond_tokens: List[str] if prompt is not None and type(prompt) is not type(negative_prompt): raise TypeError( f"`negative_prompt` should be the same type to `prompt`, but got {type(negative_prompt)} !=" f" {type(prompt)}." ) elif isinstance(negative_prompt, str): uncond_tokens = [negative_prompt, negative_prompt_2] elif batch_size != len(negative_prompt): raise ValueError( f"`negative_prompt`: {negative_prompt} has batch size {len(negative_prompt)}, but `prompt`:" f" {prompt} has batch size {batch_size}. Please make sure that passed `negative_prompt` matches" " the batch size of `prompt`." ) else: uncond_tokens = [negative_prompt, negative_prompt_2] negative_prompt_embeds_list = [] for negative_prompt, tokenizer, text_encoder in zip(uncond_tokens, tokenizers, text_encoders): if isinstance(self, TextualInversionLoaderMixin): negative_prompt = self.maybe_convert_prompt(negative_prompt, tokenizer) max_length = prompt_embeds.shape[1] uncond_input = tokenizer( negative_prompt, padding="max_length", max_length=max_length, truncation=True, return_tensors="pt", ) negative_prompt_embeds = text_encoder( uncond_input.input_ids.to(device), output_hidden_states=True, ) # We are only ALWAYS interested in the pooled output of the final text encoder negative_pooled_prompt_embeds = negative_prompt_embeds[0] negative_prompt_embeds = negative_prompt_embeds.hidden_states[-2] negative_prompt_embeds_list.append(negative_prompt_embeds) negative_prompt_embeds = torch.concat(negative_prompt_embeds_list, dim=-1) prompt_embeds_dtype = self.text_encoder_2.dtype if self.text_encoder_2 is not None else self.unet.dtype prompt_embeds = prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) bs_embed, seq_len, _ = prompt_embeds.shape # duplicate text embeddings for each generation per prompt, using mps friendly method prompt_embeds = prompt_embeds.repeat(1, num_images_per_prompt, 1) prompt_embeds = prompt_embeds.view(bs_embed * num_images_per_prompt, seq_len, -1) if do_classifier_free_guidance: # duplicate unconditional embeddings for each generation per prompt, using mps friendly method seq_len = negative_prompt_embeds.shape[1] negative_prompt_embeds = negative_prompt_embeds.to(dtype=prompt_embeds_dtype, device=device) negative_prompt_embeds = negative_prompt_embeds.repeat(1, num_images_per_prompt, 1) negative_prompt_embeds = negative_prompt_embeds.view(batch_size * num_images_per_prompt, seq_len, -1) pooled_prompt_embeds = pooled_prompt_embeds.repeat(1, num_images_per_prompt).view( bs_embed * num_images_per_prompt, -1 ) if do_classifier_free_guidance: negative_pooled_prompt_embeds = negative_pooled_prompt_embeds.repeat(1, num_images_per_prompt).view( bs_embed * num_images_per_prompt, -1 ) return prompt_embeds, negative_prompt_embeds, pooled_prompt_embeds, negative_pooled_prompt_embeds # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_extra_step_kwargs def prepare_extra_step_kwargs(self, generator, eta): # prepare extra kwargs for the scheduler step, since not all schedulers have the same signature # eta (ฮท) is only used with the DDIMScheduler, it will be ignored for other schedulers. # eta corresponds to ฮท in DDIM paper: https://arxiv.org/abs/2010.02502 # and should be between [0, 1] accepts_eta = "eta" in set(inspect.signature(self.scheduler.step).parameters.keys()) extra_step_kwargs = {} if accepts_eta: extra_step_kwargs["eta"] = eta # check if the scheduler accepts generator accepts_generator = "generator" in set(inspect.signature(self.scheduler.step).parameters.keys()) if accepts_generator: extra_step_kwargs["generator"] = generator return extra_step_kwargs # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion_instruct_pix2pix.StableDiffusionInstructPix2PixPipeline.check_inputs def check_inputs( self, prompt, callback_steps, negative_prompt=None, prompt_embeds=None, negative_prompt_embeds=None, callback_on_step_end_tensor_inputs=None, ): if callback_steps is not None and (not isinstance(callback_steps, int) or callback_steps <= 0): raise ValueError( f"`callback_steps` has to be a positive integer but is {callback_steps} of type" f" {type(callback_steps)}." ) if callback_on_step_end_tensor_inputs is not None and not all( k in self._callback_tensor_inputs for k in callback_on_step_end_tensor_inputs ): raise ValueError( f"`callback_on_step_end_tensor_inputs` has to be in {self._callback_tensor_inputs}, but found {[k for k in callback_on_step_end_tensor_inputs if k not in self._callback_tensor_inputs]}" ) if prompt is not None and prompt_embeds is not None: raise ValueError( f"Cannot forward both `prompt`: {prompt} and `prompt_embeds`: {prompt_embeds}. Please make sure to" " only forward one of the two." ) elif prompt is None and prompt_embeds is None: raise ValueError( "Provide either `prompt` or `prompt_embeds`. Cannot leave both `prompt` and `prompt_embeds` undefined." ) elif prompt is not None and (not isinstance(prompt, str) and not isinstance(prompt, list)): raise ValueError(f"`prompt` has to be of type `str` or `list` but is {type(prompt)}") if negative_prompt is not None and negative_prompt_embeds is not None: raise ValueError( f"Cannot forward both `negative_prompt`: {negative_prompt} and `negative_prompt_embeds`:" f" {negative_prompt_embeds}. Please make sure to only forward one of the two." ) if prompt_embeds is not None and negative_prompt_embeds is not None: if prompt_embeds.shape != negative_prompt_embeds.shape: raise ValueError( "`prompt_embeds` and `negative_prompt_embeds` must have the same shape when passed directly, but" f" got: `prompt_embeds` {prompt_embeds.shape} != `negative_prompt_embeds`" f" {negative_prompt_embeds.shape}." ) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.prepare_latents def prepare_latents(self, batch_size, num_channels_latents, height, width, dtype, device, generator, latents=None): shape = (batch_size, num_channels_latents, height // self.vae_scale_factor, width // self.vae_scale_factor) if isinstance(generator, list) and len(generator) != batch_size: raise ValueError( f"You have passed a list of generators of length {len(generator)}, but requested an effective batch" f" size of {batch_size}. Make sure the batch size matches the length of the generators." ) if latents is None: latents = randn_tensor(shape, generator=generator, device=device, dtype=dtype) else: latents = latents.to(device) # scale the initial noise by the standard deviation required by the scheduler latents = latents * self.scheduler.init_noise_sigma return latents def prepare_image_latents( self, image, batch_size, num_images_per_prompt, dtype, device, do_classifier_free_guidance, generator=None ): if not isinstance(image, (torch.Tensor, PIL.Image.Image, list)): raise ValueError( f"`image` has to be of type `torch.Tensor`, `PIL.Image.Image` or list but is {type(image)}" ) image = image.to(device=device, dtype=dtype) batch_size = batch_size * num_images_per_prompt if image.shape[1] == 4: image_latents = image else: # make sure the VAE is in float32 mode, as it overflows in float16 needs_upcasting = self.vae.dtype == torch.float16 and self.vae.config.force_upcast if needs_upcasting: self.upcast_vae() image = image.to(next(iter(self.vae.post_quant_conv.parameters())).dtype) image_latents = retrieve_latents(self.vae.encode(image), sample_mode="argmax") # cast back to fp16 if needed if needs_upcasting: self.vae.to(dtype=torch.float16) if batch_size > image_latents.shape[0] and batch_size % image_latents.shape[0] == 0: # expand image_latents for batch_size deprecation_message = ( f"You have passed {batch_size} text prompts (`prompt`), but only {image_latents.shape[0]} initial" " images (`image`). Initial images are now duplicating to match the number of text prompts. Note" " that this behavior is deprecated and will be removed in a version 1.0.0. Please make sure to update" " your script to pass as many initial images as text prompts to suppress this warning." ) deprecate("len(prompt) != len(image)", "1.0.0", deprecation_message, standard_warn=False) additional_image_per_prompt = batch_size // image_latents.shape[0] image_latents = torch.cat([image_latents] * additional_image_per_prompt, dim=0) elif batch_size > image_latents.shape[0] and batch_size % image_latents.shape[0] != 0: raise ValueError( f"Cannot duplicate `image` of batch size {image_latents.shape[0]} to {batch_size} text prompts." ) else: image_latents = torch.cat([image_latents], dim=0) if do_classifier_free_guidance: uncond_image_latents = torch.zeros_like(image_latents) image_latents = torch.cat([image_latents, image_latents, uncond_image_latents], dim=0) if image_latents.dtype != self.vae.dtype: image_latents = image_latents.to(dtype=self.vae.dtype) return image_latents # Copied from diffusers.pipelines.stable_diffusion_xl.pipeline_stable_diffusion_xl.StableDiffusionXLPipeline._get_add_time_ids def _get_add_time_ids( self, original_size, crops_coords_top_left, target_size, dtype, text_encoder_projection_dim=None ): add_time_ids = list(original_size + crops_coords_top_left + target_size) passed_add_embed_dim = ( self.unet.config.addition_time_embed_dim * len(add_time_ids) + text_encoder_projection_dim ) expected_add_embed_dim = self.unet.add_embedding.linear_1.in_features if expected_add_embed_dim != passed_add_embed_dim: raise ValueError( f"Model expects an added time embedding vector of length {expected_add_embed_dim}, but a vector of {passed_add_embed_dim} was created. The model has an incorrect config. Please check `unet.config.time_embedding_type` and `text_encoder_2.config.projection_dim`." ) add_time_ids = torch.tensor([add_time_ids], dtype=dtype) return add_time_ids # Copied from diffusers.pipelines.stable_diffusion_xl.pipeline_stable_diffusion_xl.StableDiffusionXLPipeline.upcast_vae def upcast_vae(self): dtype = self.vae.dtype self.vae.to(dtype=torch.float32) use_torch_2_0_or_xformers = isinstance( self.vae.decoder.mid_block.attentions[0].processor, ( AttnProcessor2_0, XFormersAttnProcessor, LoRAXFormersAttnProcessor, LoRAAttnProcessor2_0, FusedAttnProcessor2_0, ), ) # if xformers or torch_2_0 is used attention block does not need # to be in float32 which can save lots of memory if use_torch_2_0_or_xformers: self.vae.post_quant_conv.to(dtype) self.vae.decoder.conv_in.to(dtype) self.vae.decoder.mid_block.to(dtype) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.enable_freeu def enable_freeu(self, s1: float, s2: float, b1: float, b2: float): r"""Enables the FreeU mechanism as in https://arxiv.org/abs/2309.11497. The suffixes after the scaling factors represent the stages where they are being applied. Please refer to the [official repository](https://github.com/ChenyangSi/FreeU) for combinations of the values that are known to work well for different pipelines such as Stable Diffusion v1, v2, and Stable Diffusion XL. Args: s1 (`float`): Scaling factor for stage 1 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. s2 (`float`): Scaling factor for stage 2 to attenuate the contributions of the skip features. This is done to mitigate "oversmoothing effect" in the enhanced denoising process. b1 (`float`): Scaling factor for stage 1 to amplify the contributions of backbone features. b2 (`float`): Scaling factor for stage 2 to amplify the contributions of backbone features. """ if not hasattr(self, "unet"): raise ValueError("The pipeline must have `unet` for using FreeU.") self.unet.enable_freeu(s1=s1, s2=s2, b1=b1, b2=b2) # Copied from diffusers.pipelines.stable_diffusion.pipeline_stable_diffusion.StableDiffusionPipeline.disable_freeu def disable_freeu(self): """Disables the FreeU mechanism if enabled.""" self.unet.disable_freeu() @torch.no_grad() @replace_example_docstring(EXAMPLE_DOC_STRING) def __call__( self, prompt: Union[str, List[str]] = None, prompt_2: Optional[Union[str, List[str]]] = None, image: PipelineImageInput = None, height: Optional[int] = None, width: Optional[int] = None, num_inference_steps: int = 100, denoising_end: Optional[float] = None, guidance_scale: float = 5.0, image_guidance_scale: float = 1.5, negative_prompt: Optional[Union[str, List[str]]] = None, negative_prompt_2: Optional[Union[str, List[str]]] = None, num_images_per_prompt: Optional[int] = 1, eta: float = 0.0, generator: Optional[Union[torch.Generator, List[torch.Generator]]] = None, latents: Optional[torch.FloatTensor] = None, prompt_embeds: Optional[torch.FloatTensor] = None, negative_prompt_embeds: Optional[torch.FloatTensor] = None, pooled_prompt_embeds: Optional[torch.FloatTensor] = None, negative_pooled_prompt_embeds: Optional[torch.FloatTensor] = None, output_type: Optional[str] = "pil", return_dict: bool = True, callback: Optional[Callable[[int, int, torch.FloatTensor], None]] = None, callback_steps: int = 1, cross_attention_kwargs: Optional[Dict[str, Any]] = None, guidance_rescale: float = 0.0, original_size: Tuple[int, int] = None, crops_coords_top_left: Tuple[int, int] = (0, 0), target_size: Tuple[int, int] = None, ): r""" Function invoked when calling the pipeline for generation. Args: prompt (`str` or `List[str]`, *optional*): The prompt or prompts to guide the image generation. If not defined, one has to pass `prompt_embeds`. instead. prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts to be sent to the `tokenizer_2` and `text_encoder_2`. If not defined, `prompt` is used in both text-encoders image (`torch.FloatTensor` or `PIL.Image.Image` or `np.ndarray` or `List[torch.FloatTensor]` or `List[PIL.Image.Image]` or `List[np.ndarray]`): The image(s) to modify with the pipeline. height (`int`, *optional*, defaults to self.unet.config.sample_size * self.vae_scale_factor): The height in pixels of the generated image. width (`int`, *optional*, defaults to self.unet.config.sample_size * self.vae_scale_factor): The width in pixels of the generated image. num_inference_steps (`int`, *optional*, defaults to 50): The number of denoising steps. More denoising steps usually lead to a higher quality image at the expense of slower inference. denoising_end (`float`, *optional*): When specified, determines the fraction (between 0.0 and 1.0) of the total denoising process to be completed before it is intentionally prematurely terminated. As a result, the returned sample will still retain a substantial amount of noise as determined by the discrete timesteps selected by the scheduler. The denoising_end parameter should ideally be utilized when this pipeline forms a part of a "Mixture of Denoisers" multi-pipeline setup, as elaborated in [**Refining the Image Output**](https://huggingface.co/docs/diffusers/api/pipelines/stable_diffusion/stable_diffusion_xl#refining-the-image-output) guidance_scale (`float`, *optional*, defaults to 5.0): Guidance scale as defined in [Classifier-Free Diffusion Guidance](https://arxiv.org/abs/2207.12598). `guidance_scale` is defined as `w` of equation 2. of [Imagen Paper](https://arxiv.org/pdf/2205.11487.pdf). Guidance scale is enabled by setting `guidance_scale > 1`. Higher guidance scale encourages to generate images that are closely linked to the text `prompt`, usually at the expense of lower image quality. image_guidance_scale (`float`, *optional*, defaults to 1.5): Image guidance scale is to push the generated image towards the inital image `image`. Image guidance scale is enabled by setting `image_guidance_scale > 1`. Higher image guidance scale encourages to generate images that are closely linked to the source image `image`, usually at the expense of lower image quality. This pipeline requires a value of at least `1`. negative_prompt (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation. If not defined, one has to pass `negative_prompt_embeds` instead. Ignored when not using guidance (i.e., ignored if `guidance_scale` is less than `1`). negative_prompt_2 (`str` or `List[str]`, *optional*): The prompt or prompts not to guide the image generation to be sent to `tokenizer_2` and `text_encoder_2`. If not defined, `negative_prompt` is used in both text-encoders. num_images_per_prompt (`int`, *optional*, defaults to 1): The number of images to generate per prompt. eta (`float`, *optional*, defaults to 0.0): Corresponds to parameter eta (ฮท) in the DDIM paper: https://arxiv.org/abs/2010.02502. Only applies to [`schedulers.DDIMScheduler`], will be ignored for others. generator (`torch.Generator` or `List[torch.Generator]`, *optional*): One or a list of [torch generator(s)](https://pytorch.org/docs/stable/generated/torch.Generator.html) to make generation deterministic. latents (`torch.FloatTensor`, *optional*): Pre-generated noisy latents, sampled from a Gaussian distribution, to be used as inputs for image generation. Can be used to tweak the same generation with different prompts. If not provided, a latents tensor will ge generated by sampling using the supplied random `generator`. prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, text embeddings will be generated from `prompt` input argument. negative_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, negative_prompt_embeds will be generated from `negative_prompt` input argument. pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled text embeddings will be generated from `prompt` input argument. negative_pooled_prompt_embeds (`torch.FloatTensor`, *optional*): Pre-generated negative pooled text embeddings. Can be used to easily tweak text inputs, *e.g.* prompt weighting. If not provided, pooled negative_prompt_embeds will be generated from `negative_prompt` input argument. output_type (`str`, *optional*, defaults to `"pil"`): The output format of the generate image. Choose between [PIL](https://pillow.readthedocs.io/en/stable/): `PIL.Image.Image` or `np.array`. return_dict (`bool`, *optional*, defaults to `True`): Whether or not to return a [`~pipelines.stable_diffusion.StableDiffusionXLPipelineOutput`] instead of a plain tuple. callback (`Callable`, *optional*): A function that will be called every `callback_steps` steps during inference. The function will be called with the following arguments: `callback(step: int, timestep: int, latents: torch.FloatTensor)`. callback_steps (`int`, *optional*, defaults to 1): The frequency at which the `callback` function will be called. If not specified, the callback will be called at every step. cross_attention_kwargs (`dict`, *optional*): A kwargs dictionary that if specified is passed along to the `AttentionProcessor` as defined under `self.processor` in [diffusers.models.attention_processor](https://github.com/huggingface/diffusers/blob/main/src/diffusers/models/attention_processor.py). guidance_rescale (`float`, *optional*, defaults to 0.0): Guidance rescale factor proposed by [Common Diffusion Noise Schedules and Sample Steps are Flawed](https://arxiv.org/pdf/2305.08891.pdf) `guidance_scale` is defined as `ฯ†` in equation 16. of [Common Diffusion Noise Schedules and Sample Steps are Flawed](https://arxiv.org/pdf/2305.08891.pdf). Guidance rescale factor should fix overexposure when using zero terminal SNR. original_size (`Tuple[int]`, *optional*, defaults to (1024, 1024)): If `original_size` is not the same as `target_size` the image will appear to be down- or upsampled. `original_size` defaults to `(height, width)` if not specified. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). crops_coords_top_left (`Tuple[int]`, *optional*, defaults to (0, 0)): `crops_coords_top_left` can be used to generate an image that appears to be "cropped" from the position `crops_coords_top_left` downwards. Favorable, well-centered images are usually achieved by setting `crops_coords_top_left` to (0, 0). Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). target_size (`Tuple[int]`, *optional*, defaults to (1024, 1024)): For most cases, `target_size` should be set to the desired height and width of the generated image. If not specified it will default to `(height, width)`. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). aesthetic_score (`float`, *optional*, defaults to 6.0): Used to simulate an aesthetic score of the generated image by influencing the positive text condition. Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). negative_aesthetic_score (`float`, *optional*, defaults to 2.5): Part of SDXL's micro-conditioning as explained in section 2.2 of [https://huggingface.co/papers/2307.01952](https://huggingface.co/papers/2307.01952). Can be used to simulate an aesthetic score of the generated image by influencing the negative text condition. Examples: Returns: [`~pipelines.stable_diffusion_xl.StableDiffusionXLPipelineOutput`] or `tuple`: [`~pipelines.stable_diffusion_xl.StableDiffusionXLPipelineOutput`] if `return_dict` is True, otherwise a `tuple`. When returning a tuple, the first element is a list with the generated images. """ # 0. Default height and width to unet height = height or self.default_sample_size * self.vae_scale_factor width = width or self.default_sample_size * self.vae_scale_factor original_size = original_size or (height, width) target_size = target_size or (height, width) # 1. Check inputs. Raise error if not correct self.check_inputs(prompt, callback_steps, negative_prompt, prompt_embeds, negative_prompt_embeds) if image is None: raise ValueError("`image` input cannot be undefined.") # 2. Define call parameters if prompt is not None and isinstance(prompt, str): batch_size = 1 elif prompt is not None and isinstance(prompt, list): batch_size = len(prompt) else: batch_size = prompt_embeds.shape[0] device = self._execution_device # here `guidance_scale` is defined analog to the guidance weight `w` of equation (2) # of the Imagen paper: https://arxiv.org/pdf/2205.11487.pdf . `guidance_scale = 1` # corresponds to doing no classifier free guidance. do_classifier_free_guidance = guidance_scale > 1.0 and image_guidance_scale >= 1.0 # check if scheduler is in sigmas space scheduler_is_in_sigma_space = hasattr(self.scheduler, "sigmas") # 3. Encode input prompt text_encoder_lora_scale = ( cross_attention_kwargs.get("scale", None) if cross_attention_kwargs is not None else None ) ( prompt_embeds, negative_prompt_embeds, pooled_prompt_embeds, negative_pooled_prompt_embeds, ) = self.encode_prompt( prompt=prompt, prompt_2=prompt_2, device=device, num_images_per_prompt=num_images_per_prompt, do_classifier_free_guidance=do_classifier_free_guidance, negative_prompt=negative_prompt, negative_prompt_2=negative_prompt_2, prompt_embeds=prompt_embeds, negative_prompt_embeds=negative_prompt_embeds, pooled_prompt_embeds=pooled_prompt_embeds, negative_pooled_prompt_embeds=negative_pooled_prompt_embeds, lora_scale=text_encoder_lora_scale, ) # 4. Preprocess image image = self.image_processor.preprocess(image, height=height, width=width).to(device) # 5. Prepare timesteps self.scheduler.set_timesteps(num_inference_steps, device=device) timesteps = self.scheduler.timesteps # 6. Prepare Image latents image_latents = self.prepare_image_latents( image, batch_size, num_images_per_prompt, prompt_embeds.dtype, device, do_classifier_free_guidance, ) # 7. Prepare latent variables num_channels_latents = self.vae.config.latent_channels latents = self.prepare_latents( batch_size * num_images_per_prompt, num_channels_latents, height, width, prompt_embeds.dtype, device, generator, latents, ) # 8. Check that shapes of latents and image match the UNet channels num_channels_image = image_latents.shape[1] if num_channels_latents + num_channels_image != self.unet.config.in_channels: raise ValueError( f"Incorrect configuration settings! The config of `pipeline.unet`: {self.unet.config} expects" f" {self.unet.config.in_channels} but received `num_channels_latents`: {num_channels_latents} +" f" `num_channels_image`: {num_channels_image} " f" = {num_channels_latents + num_channels_image}. Please verify the config of" " `pipeline.unet` or your `image` input." ) # 9. Prepare extra step kwargs. TODO: Logic should ideally just be moved out of the pipeline extra_step_kwargs = self.prepare_extra_step_kwargs(generator, eta) # 10. Prepare added time ids & embeddings add_text_embeds = pooled_prompt_embeds if self.text_encoder_2 is None: text_encoder_projection_dim = int(pooled_prompt_embeds.shape[-1]) else: text_encoder_projection_dim = self.text_encoder_2.config.projection_dim add_time_ids = self._get_add_time_ids( original_size, crops_coords_top_left, target_size, dtype=prompt_embeds.dtype, text_encoder_projection_dim=text_encoder_projection_dim, ) if do_classifier_free_guidance: # The extra concat similar to how it's done in SD InstructPix2Pix. prompt_embeds = torch.cat([prompt_embeds, negative_prompt_embeds, negative_prompt_embeds], dim=0) add_text_embeds = torch.cat( [add_text_embeds, negative_pooled_prompt_embeds, negative_pooled_prompt_embeds], dim=0 ) add_time_ids = torch.cat([add_time_ids, add_time_ids, add_time_ids], dim=0) prompt_embeds = prompt_embeds.to(device) add_text_embeds = add_text_embeds.to(device) add_time_ids = add_time_ids.to(device).repeat(batch_size * num_images_per_prompt, 1) # 11. Denoising loop num_warmup_steps = max(len(timesteps) - num_inference_steps * self.scheduler.order, 0) if denoising_end is not None and isinstance(denoising_end, float) and denoising_end > 0 and denoising_end < 1: discrete_timestep_cutoff = int( round( self.scheduler.config.num_train_timesteps - (denoising_end * self.scheduler.config.num_train_timesteps) ) ) num_inference_steps = len(list(filter(lambda ts: ts >= discrete_timestep_cutoff, timesteps))) timesteps = timesteps[:num_inference_steps] with self.progress_bar(total=num_inference_steps) as progress_bar: for i, t in enumerate(timesteps): # Expand the latents if we are doing classifier free guidance. # The latents are expanded 3 times because for pix2pix the guidance # is applied for both the text and the input image. latent_model_input = torch.cat([latents] * 3) if do_classifier_free_guidance else latents # concat latents, image_latents in the channel dimension scaled_latent_model_input = self.scheduler.scale_model_input(latent_model_input, t) scaled_latent_model_input = torch.cat([scaled_latent_model_input, image_latents], dim=1) # predict the noise residual added_cond_kwargs = {"text_embeds": add_text_embeds, "time_ids": add_time_ids} noise_pred = self.unet( scaled_latent_model_input, t, encoder_hidden_states=prompt_embeds, cross_attention_kwargs=cross_attention_kwargs, added_cond_kwargs=added_cond_kwargs, return_dict=False, )[0] # Hack: # For karras style schedulers the model does classifer free guidance using the # predicted_original_sample instead of the noise_pred. So we need to compute the # predicted_original_sample here if we are using a karras style scheduler. if scheduler_is_in_sigma_space: step_index = (self.scheduler.timesteps == t).nonzero()[0].item() sigma = self.scheduler.sigmas[step_index] noise_pred = latent_model_input - sigma * noise_pred # perform guidance if do_classifier_free_guidance: noise_pred_text, noise_pred_image, noise_pred_uncond = noise_pred.chunk(3) noise_pred = ( noise_pred_uncond + guidance_scale * (noise_pred_text - noise_pred_image) + image_guidance_scale * (noise_pred_image - noise_pred_uncond) ) if do_classifier_free_guidance and guidance_rescale > 0.0: # Based on 3.4. in https://arxiv.org/pdf/2305.08891.pdf noise_pred = rescale_noise_cfg(noise_pred, noise_pred_text, guidance_rescale=guidance_rescale) # Hack: # For karras style schedulers the model does classifer free guidance using the # predicted_original_sample instead of the noise_pred. But the scheduler.step function # expects the noise_pred and computes the predicted_original_sample internally. So we # need to overwrite the noise_pred here such that the value of the computed # predicted_original_sample is correct. if scheduler_is_in_sigma_space: noise_pred = (noise_pred - latents) / (-sigma) # compute the previous noisy sample x_t -> x_t-1 latents = self.scheduler.step(noise_pred, t, latents, **extra_step_kwargs, return_dict=False)[0] # call the callback, if provided if i == len(timesteps) - 1 or ((i + 1) > num_warmup_steps and (i + 1) % self.scheduler.order == 0): progress_bar.update() if callback is not None and i % callback_steps == 0: step_idx = i // getattr(self.scheduler, "order", 1) callback(step_idx, t, latents) if XLA_AVAILABLE: xm.mark_step() if not output_type == "latent": # make sure the VAE is in float32 mode, as it overflows in float16 needs_upcasting = self.vae.dtype == torch.float16 and self.vae.config.force_upcast if needs_upcasting: self.upcast_vae() latents = latents.to(next(iter(self.vae.post_quant_conv.parameters())).dtype) image = self.vae.decode(latents / self.vae.config.scaling_factor, return_dict=False)[0] # cast back to fp16 if needed if needs_upcasting: self.vae.to(dtype=torch.float16) else: image = latents return StableDiffusionXLPipelineOutput(images=image) # apply watermark if available if self.watermark is not None: image = self.watermark.apply_watermark(image) image = self.image_processor.postprocess(image, output_type=output_type) # Offload all models self.maybe_free_model_hooks() if not return_dict: return (image,) return StableDiffusionXLPipelineOutput(images=image)
diffusers/src/diffusers/pipelines/stable_diffusion_xl/pipeline_stable_diffusion_xl_instruct_pix2pix.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/stable_diffusion_xl/pipeline_stable_diffusion_xl_instruct_pix2pix.py", "repo_id": "diffusers", "token_count": 24082 }
122
# Copyright 2023 Kakao Brain and The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import torch from torch import nn from ...configuration_utils import ConfigMixin, register_to_config from ...models import ModelMixin class UnCLIPTextProjModel(ModelMixin, ConfigMixin): """ Utility class for CLIP embeddings. Used to combine the image and text embeddings into a format usable by the decoder. For more details, see the original paper: https://arxiv.org/abs/2204.06125 section 2.1 """ @register_to_config def __init__( self, *, clip_extra_context_tokens: int = 4, clip_embeddings_dim: int = 768, time_embed_dim: int, cross_attention_dim, ): super().__init__() self.learned_classifier_free_guidance_embeddings = nn.Parameter(torch.zeros(clip_embeddings_dim)) # parameters for additional clip time embeddings self.embedding_proj = nn.Linear(clip_embeddings_dim, time_embed_dim) self.clip_image_embeddings_project_to_time_embeddings = nn.Linear(clip_embeddings_dim, time_embed_dim) # parameters for encoder hidden states self.clip_extra_context_tokens = clip_extra_context_tokens self.clip_extra_context_tokens_proj = nn.Linear( clip_embeddings_dim, self.clip_extra_context_tokens * cross_attention_dim ) self.encoder_hidden_states_proj = nn.Linear(clip_embeddings_dim, cross_attention_dim) self.text_encoder_hidden_states_norm = nn.LayerNorm(cross_attention_dim) def forward(self, *, image_embeddings, prompt_embeds, text_encoder_hidden_states, do_classifier_free_guidance): if do_classifier_free_guidance: # Add the classifier free guidance embeddings to the image embeddings image_embeddings_batch_size = image_embeddings.shape[0] classifier_free_guidance_embeddings = self.learned_classifier_free_guidance_embeddings.unsqueeze(0) classifier_free_guidance_embeddings = classifier_free_guidance_embeddings.expand( image_embeddings_batch_size, -1 ) image_embeddings = torch.cat([classifier_free_guidance_embeddings, image_embeddings], dim=0) # The image embeddings batch size and the text embeddings batch size are equal assert image_embeddings.shape[0] == prompt_embeds.shape[0] batch_size = prompt_embeds.shape[0] # "Specifically, we modify the architecture described in Nichol et al. (2021) by projecting and # adding CLIP embeddings to the existing timestep embedding, ... time_projected_prompt_embeds = self.embedding_proj(prompt_embeds) time_projected_image_embeddings = self.clip_image_embeddings_project_to_time_embeddings(image_embeddings) additive_clip_time_embeddings = time_projected_image_embeddings + time_projected_prompt_embeds # ... and by projecting CLIP embeddings into four # extra tokens of context that are concatenated to the sequence of outputs from the GLIDE text encoder" clip_extra_context_tokens = self.clip_extra_context_tokens_proj(image_embeddings) clip_extra_context_tokens = clip_extra_context_tokens.reshape(batch_size, -1, self.clip_extra_context_tokens) clip_extra_context_tokens = clip_extra_context_tokens.permute(0, 2, 1) text_encoder_hidden_states = self.encoder_hidden_states_proj(text_encoder_hidden_states) text_encoder_hidden_states = self.text_encoder_hidden_states_norm(text_encoder_hidden_states) text_encoder_hidden_states = torch.cat([clip_extra_context_tokens, text_encoder_hidden_states], dim=1) return text_encoder_hidden_states, additive_clip_time_embeddings
diffusers/src/diffusers/pipelines/unclip/text_proj.py/0
{ "file_path": "diffusers/src/diffusers/pipelines/unclip/text_proj.py", "repo_id": "diffusers", "token_count": 1638 }
123
from typing import TYPE_CHECKING from ...utils import ( DIFFUSERS_SLOW_IMPORT, OptionalDependencyNotAvailable, _LazyModule, get_objects_from_module, is_torch_available, is_transformers_available, ) _dummy_objects = {} _import_structure = {} try: if not (is_transformers_available() and is_torch_available()): raise OptionalDependencyNotAvailable() except OptionalDependencyNotAvailable: from ...utils import dummy_pt_objects # noqa F403 _dummy_objects.update(get_objects_from_module(dummy_pt_objects)) else: _import_structure["scheduling_karras_ve"] = ["KarrasVeScheduler"] _import_structure["scheduling_sde_vp"] = ["ScoreSdeVpScheduler"] if TYPE_CHECKING or DIFFUSERS_SLOW_IMPORT: try: if not is_torch_available(): raise OptionalDependencyNotAvailable() except OptionalDependencyNotAvailable: from ..utils.dummy_pt_objects import * # noqa F403 else: from .scheduling_karras_ve import KarrasVeScheduler from .scheduling_sde_vp import ScoreSdeVpScheduler else: import sys sys.modules[__name__] = _LazyModule( __name__, globals()["__file__"], _import_structure, module_spec=__spec__, ) for name, value in _dummy_objects.items(): setattr(sys.modules[__name__], name, value)
diffusers/src/diffusers/schedulers/deprecated/__init__.py/0
{ "file_path": "diffusers/src/diffusers/schedulers/deprecated/__init__.py", "repo_id": "diffusers", "token_count": 555 }
124
# Copyright 2023 TSAIL Team and The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # DISCLAIMER: This file is strongly influenced by https://github.com/LuChengTHU/dpm-solver from dataclasses import dataclass from typing import List, Optional, Tuple, Union import flax import jax import jax.numpy as jnp from ..configuration_utils import ConfigMixin, register_to_config from .scheduling_utils_flax import ( CommonSchedulerState, FlaxKarrasDiffusionSchedulers, FlaxSchedulerMixin, FlaxSchedulerOutput, add_noise_common, ) @flax.struct.dataclass class DPMSolverMultistepSchedulerState: common: CommonSchedulerState alpha_t: jnp.ndarray sigma_t: jnp.ndarray lambda_t: jnp.ndarray # setable values init_noise_sigma: jnp.ndarray timesteps: jnp.ndarray num_inference_steps: Optional[int] = None # running values model_outputs: Optional[jnp.ndarray] = None lower_order_nums: Optional[jnp.int32] = None prev_timestep: Optional[jnp.int32] = None cur_sample: Optional[jnp.ndarray] = None @classmethod def create( cls, common: CommonSchedulerState, alpha_t: jnp.ndarray, sigma_t: jnp.ndarray, lambda_t: jnp.ndarray, init_noise_sigma: jnp.ndarray, timesteps: jnp.ndarray, ): return cls( common=common, alpha_t=alpha_t, sigma_t=sigma_t, lambda_t=lambda_t, init_noise_sigma=init_noise_sigma, timesteps=timesteps, ) @dataclass class FlaxDPMSolverMultistepSchedulerOutput(FlaxSchedulerOutput): state: DPMSolverMultistepSchedulerState class FlaxDPMSolverMultistepScheduler(FlaxSchedulerMixin, ConfigMixin): """ DPM-Solver (and the improved version DPM-Solver++) is a fast dedicated high-order solver for diffusion ODEs with the convergence order guarantee. Empirically, sampling by DPM-Solver with only 20 steps can generate high-quality samples, and it can generate quite good samples even in only 10 steps. For more details, see the original paper: https://arxiv.org/abs/2206.00927 and https://arxiv.org/abs/2211.01095 Currently, we support the multistep DPM-Solver for both noise prediction models and data prediction models. We recommend to use `solver_order=2` for guided sampling, and `solver_order=3` for unconditional sampling. We also support the "dynamic thresholding" method in Imagen (https://arxiv.org/abs/2205.11487). For pixel-space diffusion models, you can set both `algorithm_type="dpmsolver++"` and `thresholding=True` to use the dynamic thresholding. Note that the thresholding method is unsuitable for latent-space diffusion models (such as stable-diffusion). [`~ConfigMixin`] takes care of storing all config attributes that are passed in the scheduler's `__init__` function, such as `num_train_timesteps`. They can be accessed via `scheduler.config.num_train_timesteps`. [`SchedulerMixin`] provides general loading and saving functionality via the [`SchedulerMixin.save_pretrained`] and [`~SchedulerMixin.from_pretrained`] functions. For more details, see the original paper: https://arxiv.org/abs/2206.00927 and https://arxiv.org/abs/2211.01095 Args: num_train_timesteps (`int`): number of diffusion steps used to train the model. beta_start (`float`): the starting `beta` value of inference. beta_end (`float`): the final `beta` value. beta_schedule (`str`): the beta schedule, a mapping from a beta range to a sequence of betas for stepping the model. Choose from `linear`, `scaled_linear`, or `squaredcos_cap_v2`. trained_betas (`np.ndarray`, optional): option to pass an array of betas directly to the constructor to bypass `beta_start`, `beta_end` etc. solver_order (`int`, default `2`): the order of DPM-Solver; can be `1` or `2` or `3`. We recommend to use `solver_order=2` for guided sampling, and `solver_order=3` for unconditional sampling. prediction_type (`str`, default `epsilon`): indicates whether the model predicts the noise (epsilon), or the data / `x0`. One of `epsilon`, `sample`, or `v-prediction`. thresholding (`bool`, default `False`): whether to use the "dynamic thresholding" method (introduced by Imagen, https://arxiv.org/abs/2205.11487). For pixel-space diffusion models, you can set both `algorithm_type=dpmsolver++` and `thresholding=True` to use the dynamic thresholding. Note that the thresholding method is unsuitable for latent-space diffusion models (such as stable-diffusion). dynamic_thresholding_ratio (`float`, default `0.995`): the ratio for the dynamic thresholding method. Default is `0.995`, the same as Imagen (https://arxiv.org/abs/2205.11487). sample_max_value (`float`, default `1.0`): the threshold value for dynamic thresholding. Valid only when `thresholding=True` and `algorithm_type="dpmsolver++`. algorithm_type (`str`, default `dpmsolver++`): the algorithm type for the solver. Either `dpmsolver` or `dpmsolver++`. The `dpmsolver` type implements the algorithms in https://arxiv.org/abs/2206.00927, and the `dpmsolver++` type implements the algorithms in https://arxiv.org/abs/2211.01095. We recommend to use `dpmsolver++` with `solver_order=2` for guided sampling (e.g. stable-diffusion). solver_type (`str`, default `midpoint`): the solver type for the second-order solver. Either `midpoint` or `heun`. The solver type slightly affects the sample quality, especially for small number of steps. We empirically find that `midpoint` solvers are slightly better, so we recommend to use the `midpoint` type. lower_order_final (`bool`, default `True`): whether to use lower-order solvers in the final steps. Only valid for < 15 inference steps. We empirically find this trick can stabilize the sampling of DPM-Solver for steps < 15, especially for steps <= 10. timestep_spacing (`str`, defaults to `"linspace"`): The way the timesteps should be scaled. Refer to Table 2 of the [Common Diffusion Noise Schedules and Sample Steps are Flawed](https://huggingface.co/papers/2305.08891) for more information. dtype (`jnp.dtype`, *optional*, defaults to `jnp.float32`): the `dtype` used for params and computation. """ _compatibles = [e.name for e in FlaxKarrasDiffusionSchedulers] dtype: jnp.dtype @property def has_state(self): return True @register_to_config def __init__( self, num_train_timesteps: int = 1000, beta_start: float = 0.0001, beta_end: float = 0.02, beta_schedule: str = "linear", trained_betas: Optional[jnp.ndarray] = None, solver_order: int = 2, prediction_type: str = "epsilon", thresholding: bool = False, dynamic_thresholding_ratio: float = 0.995, sample_max_value: float = 1.0, algorithm_type: str = "dpmsolver++", solver_type: str = "midpoint", lower_order_final: bool = True, timestep_spacing: str = "linspace", dtype: jnp.dtype = jnp.float32, ): self.dtype = dtype def create_state(self, common: Optional[CommonSchedulerState] = None) -> DPMSolverMultistepSchedulerState: if common is None: common = CommonSchedulerState.create(self) # Currently we only support VP-type noise schedule alpha_t = jnp.sqrt(common.alphas_cumprod) sigma_t = jnp.sqrt(1 - common.alphas_cumprod) lambda_t = jnp.log(alpha_t) - jnp.log(sigma_t) # settings for DPM-Solver if self.config.algorithm_type not in ["dpmsolver", "dpmsolver++"]: raise NotImplementedError(f"{self.config.algorithm_type} does is not implemented for {self.__class__}") if self.config.solver_type not in ["midpoint", "heun"]: raise NotImplementedError(f"{self.config.solver_type} does is not implemented for {self.__class__}") # standard deviation of the initial noise distribution init_noise_sigma = jnp.array(1.0, dtype=self.dtype) timesteps = jnp.arange(0, self.config.num_train_timesteps).round()[::-1] return DPMSolverMultistepSchedulerState.create( common=common, alpha_t=alpha_t, sigma_t=sigma_t, lambda_t=lambda_t, init_noise_sigma=init_noise_sigma, timesteps=timesteps, ) def set_timesteps( self, state: DPMSolverMultistepSchedulerState, num_inference_steps: int, shape: Tuple ) -> DPMSolverMultistepSchedulerState: """ Sets the discrete timesteps used for the diffusion chain. Supporting function to be run before inference. Args: state (`DPMSolverMultistepSchedulerState`): the `FlaxDPMSolverMultistepScheduler` state data class instance. num_inference_steps (`int`): the number of diffusion steps used when generating samples with a pre-trained model. shape (`Tuple`): the shape of the samples to be generated. """ last_timestep = self.config.num_train_timesteps if self.config.timestep_spacing == "linspace": timesteps = ( jnp.linspace(0, last_timestep - 1, num_inference_steps + 1).round()[::-1][:-1].astype(jnp.int32) ) elif self.config.timestep_spacing == "leading": step_ratio = last_timestep // (num_inference_steps + 1) # creates integer timesteps by multiplying by ratio # casting to int to avoid issues when num_inference_step is power of 3 timesteps = ( (jnp.arange(0, num_inference_steps + 1) * step_ratio).round()[::-1][:-1].copy().astype(jnp.int32) ) timesteps += self.config.steps_offset elif self.config.timestep_spacing == "trailing": step_ratio = self.config.num_train_timesteps / num_inference_steps # creates integer timesteps by multiplying by ratio # casting to int to avoid issues when num_inference_step is power of 3 timesteps = jnp.arange(last_timestep, 0, -step_ratio).round().copy().astype(jnp.int32) timesteps -= 1 else: raise ValueError( f"{self.config.timestep_spacing} is not supported. Please make sure to choose one of 'linspace', 'leading' or 'trailing'." ) # initial running values model_outputs = jnp.zeros((self.config.solver_order,) + shape, dtype=self.dtype) lower_order_nums = jnp.int32(0) prev_timestep = jnp.int32(-1) cur_sample = jnp.zeros(shape, dtype=self.dtype) return state.replace( num_inference_steps=num_inference_steps, timesteps=timesteps, model_outputs=model_outputs, lower_order_nums=lower_order_nums, prev_timestep=prev_timestep, cur_sample=cur_sample, ) def convert_model_output( self, state: DPMSolverMultistepSchedulerState, model_output: jnp.ndarray, timestep: int, sample: jnp.ndarray, ) -> jnp.ndarray: """ Convert the model output to the corresponding type that the algorithm (DPM-Solver / DPM-Solver++) needs. DPM-Solver is designed to discretize an integral of the noise prediction model, and DPM-Solver++ is designed to discretize an integral of the data prediction model. So we need to first convert the model output to the corresponding type to match the algorithm. Note that the algorithm type and the model type is decoupled. That is to say, we can use either DPM-Solver or DPM-Solver++ for both noise prediction model and data prediction model. Args: model_output (`jnp.ndarray`): direct output from learned diffusion model. timestep (`int`): current discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. Returns: `jnp.ndarray`: the converted model output. """ # DPM-Solver++ needs to solve an integral of the data prediction model. if self.config.algorithm_type == "dpmsolver++": if self.config.prediction_type == "epsilon": alpha_t, sigma_t = state.alpha_t[timestep], state.sigma_t[timestep] x0_pred = (sample - sigma_t * model_output) / alpha_t elif self.config.prediction_type == "sample": x0_pred = model_output elif self.config.prediction_type == "v_prediction": alpha_t, sigma_t = state.alpha_t[timestep], state.sigma_t[timestep] x0_pred = alpha_t * sample - sigma_t * model_output else: raise ValueError( f"prediction_type given as {self.config.prediction_type} must be one of `epsilon`, `sample`, " " or `v_prediction` for the FlaxDPMSolverMultistepScheduler." ) if self.config.thresholding: # Dynamic thresholding in https://arxiv.org/abs/2205.11487 dynamic_max_val = jnp.percentile( jnp.abs(x0_pred), self.config.dynamic_thresholding_ratio, axis=tuple(range(1, x0_pred.ndim)) ) dynamic_max_val = jnp.maximum( dynamic_max_val, self.config.sample_max_value * jnp.ones_like(dynamic_max_val) ) x0_pred = jnp.clip(x0_pred, -dynamic_max_val, dynamic_max_val) / dynamic_max_val return x0_pred # DPM-Solver needs to solve an integral of the noise prediction model. elif self.config.algorithm_type == "dpmsolver": if self.config.prediction_type == "epsilon": return model_output elif self.config.prediction_type == "sample": alpha_t, sigma_t = state.alpha_t[timestep], state.sigma_t[timestep] epsilon = (sample - alpha_t * model_output) / sigma_t return epsilon elif self.config.prediction_type == "v_prediction": alpha_t, sigma_t = state.alpha_t[timestep], state.sigma_t[timestep] epsilon = alpha_t * model_output + sigma_t * sample return epsilon else: raise ValueError( f"prediction_type given as {self.config.prediction_type} must be one of `epsilon`, `sample`, " " or `v_prediction` for the FlaxDPMSolverMultistepScheduler." ) def dpm_solver_first_order_update( self, state: DPMSolverMultistepSchedulerState, model_output: jnp.ndarray, timestep: int, prev_timestep: int, sample: jnp.ndarray, ) -> jnp.ndarray: """ One step for the first-order DPM-Solver (equivalent to DDIM). See https://arxiv.org/abs/2206.00927 for the detailed derivation. Args: model_output (`jnp.ndarray`): direct output from learned diffusion model. timestep (`int`): current discrete timestep in the diffusion chain. prev_timestep (`int`): previous discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. Returns: `jnp.ndarray`: the sample tensor at the previous timestep. """ t, s0 = prev_timestep, timestep m0 = model_output lambda_t, lambda_s = state.lambda_t[t], state.lambda_t[s0] alpha_t, alpha_s = state.alpha_t[t], state.alpha_t[s0] sigma_t, sigma_s = state.sigma_t[t], state.sigma_t[s0] h = lambda_t - lambda_s if self.config.algorithm_type == "dpmsolver++": x_t = (sigma_t / sigma_s) * sample - (alpha_t * (jnp.exp(-h) - 1.0)) * m0 elif self.config.algorithm_type == "dpmsolver": x_t = (alpha_t / alpha_s) * sample - (sigma_t * (jnp.exp(h) - 1.0)) * m0 return x_t def multistep_dpm_solver_second_order_update( self, state: DPMSolverMultistepSchedulerState, model_output_list: jnp.ndarray, timestep_list: List[int], prev_timestep: int, sample: jnp.ndarray, ) -> jnp.ndarray: """ One step for the second-order multistep DPM-Solver. Args: model_output_list (`List[jnp.ndarray]`): direct outputs from learned diffusion model at current and latter timesteps. timestep (`int`): current and latter discrete timestep in the diffusion chain. prev_timestep (`int`): previous discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. Returns: `jnp.ndarray`: the sample tensor at the previous timestep. """ t, s0, s1 = prev_timestep, timestep_list[-1], timestep_list[-2] m0, m1 = model_output_list[-1], model_output_list[-2] lambda_t, lambda_s0, lambda_s1 = state.lambda_t[t], state.lambda_t[s0], state.lambda_t[s1] alpha_t, alpha_s0 = state.alpha_t[t], state.alpha_t[s0] sigma_t, sigma_s0 = state.sigma_t[t], state.sigma_t[s0] h, h_0 = lambda_t - lambda_s0, lambda_s0 - lambda_s1 r0 = h_0 / h D0, D1 = m0, (1.0 / r0) * (m0 - m1) if self.config.algorithm_type == "dpmsolver++": # See https://arxiv.org/abs/2211.01095 for detailed derivations if self.config.solver_type == "midpoint": x_t = ( (sigma_t / sigma_s0) * sample - (alpha_t * (jnp.exp(-h) - 1.0)) * D0 - 0.5 * (alpha_t * (jnp.exp(-h) - 1.0)) * D1 ) elif self.config.solver_type == "heun": x_t = ( (sigma_t / sigma_s0) * sample - (alpha_t * (jnp.exp(-h) - 1.0)) * D0 + (alpha_t * ((jnp.exp(-h) - 1.0) / h + 1.0)) * D1 ) elif self.config.algorithm_type == "dpmsolver": # See https://arxiv.org/abs/2206.00927 for detailed derivations if self.config.solver_type == "midpoint": x_t = ( (alpha_t / alpha_s0) * sample - (sigma_t * (jnp.exp(h) - 1.0)) * D0 - 0.5 * (sigma_t * (jnp.exp(h) - 1.0)) * D1 ) elif self.config.solver_type == "heun": x_t = ( (alpha_t / alpha_s0) * sample - (sigma_t * (jnp.exp(h) - 1.0)) * D0 - (sigma_t * ((jnp.exp(h) - 1.0) / h - 1.0)) * D1 ) return x_t def multistep_dpm_solver_third_order_update( self, state: DPMSolverMultistepSchedulerState, model_output_list: jnp.ndarray, timestep_list: List[int], prev_timestep: int, sample: jnp.ndarray, ) -> jnp.ndarray: """ One step for the third-order multistep DPM-Solver. Args: model_output_list (`List[jnp.ndarray]`): direct outputs from learned diffusion model at current and latter timesteps. timestep (`int`): current and latter discrete timestep in the diffusion chain. prev_timestep (`int`): previous discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. Returns: `jnp.ndarray`: the sample tensor at the previous timestep. """ t, s0, s1, s2 = prev_timestep, timestep_list[-1], timestep_list[-2], timestep_list[-3] m0, m1, m2 = model_output_list[-1], model_output_list[-2], model_output_list[-3] lambda_t, lambda_s0, lambda_s1, lambda_s2 = ( state.lambda_t[t], state.lambda_t[s0], state.lambda_t[s1], state.lambda_t[s2], ) alpha_t, alpha_s0 = state.alpha_t[t], state.alpha_t[s0] sigma_t, sigma_s0 = state.sigma_t[t], state.sigma_t[s0] h, h_0, h_1 = lambda_t - lambda_s0, lambda_s0 - lambda_s1, lambda_s1 - lambda_s2 r0, r1 = h_0 / h, h_1 / h D0 = m0 D1_0, D1_1 = (1.0 / r0) * (m0 - m1), (1.0 / r1) * (m1 - m2) D1 = D1_0 + (r0 / (r0 + r1)) * (D1_0 - D1_1) D2 = (1.0 / (r0 + r1)) * (D1_0 - D1_1) if self.config.algorithm_type == "dpmsolver++": # See https://arxiv.org/abs/2206.00927 for detailed derivations x_t = ( (sigma_t / sigma_s0) * sample - (alpha_t * (jnp.exp(-h) - 1.0)) * D0 + (alpha_t * ((jnp.exp(-h) - 1.0) / h + 1.0)) * D1 - (alpha_t * ((jnp.exp(-h) - 1.0 + h) / h**2 - 0.5)) * D2 ) elif self.config.algorithm_type == "dpmsolver": # See https://arxiv.org/abs/2206.00927 for detailed derivations x_t = ( (alpha_t / alpha_s0) * sample - (sigma_t * (jnp.exp(h) - 1.0)) * D0 - (sigma_t * ((jnp.exp(h) - 1.0) / h - 1.0)) * D1 - (sigma_t * ((jnp.exp(h) - 1.0 - h) / h**2 - 0.5)) * D2 ) return x_t def step( self, state: DPMSolverMultistepSchedulerState, model_output: jnp.ndarray, timestep: int, sample: jnp.ndarray, return_dict: bool = True, ) -> Union[FlaxDPMSolverMultistepSchedulerOutput, Tuple]: """ Predict the sample at the previous timestep by DPM-Solver. Core function to propagate the diffusion process from the learned model outputs (most often the predicted noise). Args: state (`DPMSolverMultistepSchedulerState`): the `FlaxDPMSolverMultistepScheduler` state data class instance. model_output (`jnp.ndarray`): direct output from learned diffusion model. timestep (`int`): current discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. return_dict (`bool`): option for returning tuple rather than FlaxDPMSolverMultistepSchedulerOutput class Returns: [`FlaxDPMSolverMultistepSchedulerOutput`] or `tuple`: [`FlaxDPMSolverMultistepSchedulerOutput`] if `return_dict` is True, otherwise a `tuple`. When returning a tuple, the first element is the sample tensor. """ if state.num_inference_steps is None: raise ValueError( "Number of inference steps is 'None', you need to run 'set_timesteps' after creating the scheduler" ) (step_index,) = jnp.where(state.timesteps == timestep, size=1) step_index = step_index[0] prev_timestep = jax.lax.select(step_index == len(state.timesteps) - 1, 0, state.timesteps[step_index + 1]) model_output = self.convert_model_output(state, model_output, timestep, sample) model_outputs_new = jnp.roll(state.model_outputs, -1, axis=0) model_outputs_new = model_outputs_new.at[-1].set(model_output) state = state.replace( model_outputs=model_outputs_new, prev_timestep=prev_timestep, cur_sample=sample, ) def step_1(state: DPMSolverMultistepSchedulerState) -> jnp.ndarray: return self.dpm_solver_first_order_update( state, state.model_outputs[-1], state.timesteps[step_index], state.prev_timestep, state.cur_sample, ) def step_23(state: DPMSolverMultistepSchedulerState) -> jnp.ndarray: def step_2(state: DPMSolverMultistepSchedulerState) -> jnp.ndarray: timestep_list = jnp.array([state.timesteps[step_index - 1], state.timesteps[step_index]]) return self.multistep_dpm_solver_second_order_update( state, state.model_outputs, timestep_list, state.prev_timestep, state.cur_sample, ) def step_3(state: DPMSolverMultistepSchedulerState) -> jnp.ndarray: timestep_list = jnp.array( [ state.timesteps[step_index - 2], state.timesteps[step_index - 1], state.timesteps[step_index], ] ) return self.multistep_dpm_solver_third_order_update( state, state.model_outputs, timestep_list, state.prev_timestep, state.cur_sample, ) step_2_output = step_2(state) step_3_output = step_3(state) if self.config.solver_order == 2: return step_2_output elif self.config.lower_order_final and len(state.timesteps) < 15: return jax.lax.select( state.lower_order_nums < 2, step_2_output, jax.lax.select( step_index == len(state.timesteps) - 2, step_2_output, step_3_output, ), ) else: return jax.lax.select( state.lower_order_nums < 2, step_2_output, step_3_output, ) step_1_output = step_1(state) step_23_output = step_23(state) if self.config.solver_order == 1: prev_sample = step_1_output elif self.config.lower_order_final and len(state.timesteps) < 15: prev_sample = jax.lax.select( state.lower_order_nums < 1, step_1_output, jax.lax.select( step_index == len(state.timesteps) - 1, step_1_output, step_23_output, ), ) else: prev_sample = jax.lax.select( state.lower_order_nums < 1, step_1_output, step_23_output, ) state = state.replace( lower_order_nums=jnp.minimum(state.lower_order_nums + 1, self.config.solver_order), ) if not return_dict: return (prev_sample, state) return FlaxDPMSolverMultistepSchedulerOutput(prev_sample=prev_sample, state=state) def scale_model_input( self, state: DPMSolverMultistepSchedulerState, sample: jnp.ndarray, timestep: Optional[int] = None ) -> jnp.ndarray: """ Ensures interchangeability with schedulers that need to scale the denoising model input depending on the current timestep. Args: state (`DPMSolverMultistepSchedulerState`): the `FlaxDPMSolverMultistepScheduler` state data class instance. sample (`jnp.ndarray`): input sample timestep (`int`, optional): current timestep Returns: `jnp.ndarray`: scaled input sample """ return sample def add_noise( self, state: DPMSolverMultistepSchedulerState, original_samples: jnp.ndarray, noise: jnp.ndarray, timesteps: jnp.ndarray, ) -> jnp.ndarray: return add_noise_common(state.common, original_samples, noise, timesteps) def __len__(self): return self.config.num_train_timesteps
diffusers/src/diffusers/schedulers/scheduling_dpmsolver_multistep_flax.py/0
{ "file_path": "diffusers/src/diffusers/schedulers/scheduling_dpmsolver_multistep_flax.py", "repo_id": "diffusers", "token_count": 13616 }
125
# Copyright 2023 Zhejiang University Team and The HuggingFace Team. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # DISCLAIMER: This file is strongly influenced by https://github.com/ermongroup/ddim from dataclasses import dataclass from typing import Optional, Tuple, Union import flax import jax import jax.numpy as jnp from ..configuration_utils import ConfigMixin, register_to_config from .scheduling_utils_flax import ( CommonSchedulerState, FlaxKarrasDiffusionSchedulers, FlaxSchedulerMixin, FlaxSchedulerOutput, add_noise_common, ) @flax.struct.dataclass class PNDMSchedulerState: common: CommonSchedulerState final_alpha_cumprod: jnp.ndarray # setable values init_noise_sigma: jnp.ndarray timesteps: jnp.ndarray num_inference_steps: Optional[int] = None prk_timesteps: Optional[jnp.ndarray] = None plms_timesteps: Optional[jnp.ndarray] = None # running values cur_model_output: Optional[jnp.ndarray] = None counter: Optional[jnp.int32] = None cur_sample: Optional[jnp.ndarray] = None ets: Optional[jnp.ndarray] = None @classmethod def create( cls, common: CommonSchedulerState, final_alpha_cumprod: jnp.ndarray, init_noise_sigma: jnp.ndarray, timesteps: jnp.ndarray, ): return cls( common=common, final_alpha_cumprod=final_alpha_cumprod, init_noise_sigma=init_noise_sigma, timesteps=timesteps, ) @dataclass class FlaxPNDMSchedulerOutput(FlaxSchedulerOutput): state: PNDMSchedulerState class FlaxPNDMScheduler(FlaxSchedulerMixin, ConfigMixin): """ Pseudo numerical methods for diffusion models (PNDM) proposes using more advanced ODE integration techniques, namely Runge-Kutta method and a linear multi-step method. [`~ConfigMixin`] takes care of storing all config attributes that are passed in the scheduler's `__init__` function, such as `num_train_timesteps`. They can be accessed via `scheduler.config.num_train_timesteps`. [`SchedulerMixin`] provides general loading and saving functionality via the [`SchedulerMixin.save_pretrained`] and [`~SchedulerMixin.from_pretrained`] functions. For more details, see the original paper: https://arxiv.org/abs/2202.09778 Args: num_train_timesteps (`int`): number of diffusion steps used to train the model. beta_start (`float`): the starting `beta` value of inference. beta_end (`float`): the final `beta` value. beta_schedule (`str`): the beta schedule, a mapping from a beta range to a sequence of betas for stepping the model. Choose from `linear`, `scaled_linear`, or `squaredcos_cap_v2`. trained_betas (`jnp.ndarray`, optional): option to pass an array of betas directly to the constructor to bypass `beta_start`, `beta_end` etc. skip_prk_steps (`bool`): allows the scheduler to skip the Runge-Kutta steps that are defined in the original paper as being required before plms steps; defaults to `False`. set_alpha_to_one (`bool`, default `False`): each diffusion step uses the value of alphas product at that step and at the previous one. For the final step there is no previous alpha. When this option is `True` the previous alpha product is fixed to `1`, otherwise it uses the value of alpha at step 0. steps_offset (`int`, default `0`): an offset added to the inference steps. You can use a combination of `offset=1` and `set_alpha_to_one=False`, to make the last step use step 0 for the previous alpha product, as done in stable diffusion. prediction_type (`str`, default `epsilon`, optional): prediction type of the scheduler function, one of `epsilon` (predicting the noise of the diffusion process), `sample` (directly predicting the noisy sample`) or `v_prediction` (see section 2.4 https://imagen.research.google/video/paper.pdf) dtype (`jnp.dtype`, *optional*, defaults to `jnp.float32`): the `dtype` used for params and computation. """ _compatibles = [e.name for e in FlaxKarrasDiffusionSchedulers] dtype: jnp.dtype pndm_order: int @property def has_state(self): return True @register_to_config def __init__( self, num_train_timesteps: int = 1000, beta_start: float = 0.0001, beta_end: float = 0.02, beta_schedule: str = "linear", trained_betas: Optional[jnp.ndarray] = None, skip_prk_steps: bool = False, set_alpha_to_one: bool = False, steps_offset: int = 0, prediction_type: str = "epsilon", dtype: jnp.dtype = jnp.float32, ): self.dtype = dtype # For now we only support F-PNDM, i.e. the runge-kutta method # For more information on the algorithm please take a look at the paper: https://arxiv.org/pdf/2202.09778.pdf # mainly at formula (9), (12), (13) and the Algorithm 2. self.pndm_order = 4 def create_state(self, common: Optional[CommonSchedulerState] = None) -> PNDMSchedulerState: if common is None: common = CommonSchedulerState.create(self) # At every step in ddim, we are looking into the previous alphas_cumprod # For the final step, there is no previous alphas_cumprod because we are already at 0 # `set_alpha_to_one` decides whether we set this parameter simply to one or # whether we use the final alpha of the "non-previous" one. final_alpha_cumprod = ( jnp.array(1.0, dtype=self.dtype) if self.config.set_alpha_to_one else common.alphas_cumprod[0] ) # standard deviation of the initial noise distribution init_noise_sigma = jnp.array(1.0, dtype=self.dtype) timesteps = jnp.arange(0, self.config.num_train_timesteps).round()[::-1] return PNDMSchedulerState.create( common=common, final_alpha_cumprod=final_alpha_cumprod, init_noise_sigma=init_noise_sigma, timesteps=timesteps, ) def set_timesteps(self, state: PNDMSchedulerState, num_inference_steps: int, shape: Tuple) -> PNDMSchedulerState: """ Sets the discrete timesteps used for the diffusion chain. Supporting function to be run before inference. Args: state (`PNDMSchedulerState`): the `FlaxPNDMScheduler` state data class instance. num_inference_steps (`int`): the number of diffusion steps used when generating samples with a pre-trained model. shape (`Tuple`): the shape of the samples to be generated. """ step_ratio = self.config.num_train_timesteps // num_inference_steps # creates integer timesteps by multiplying by ratio # rounding to avoid issues when num_inference_step is power of 3 _timesteps = (jnp.arange(0, num_inference_steps) * step_ratio).round() + self.config.steps_offset if self.config.skip_prk_steps: # for some models like stable diffusion the prk steps can/should be skipped to # produce better results. When using PNDM with `self.config.skip_prk_steps` the implementation # is based on crowsonkb's PLMS sampler implementation: https://github.com/CompVis/latent-diffusion/pull/51 prk_timesteps = jnp.array([], dtype=jnp.int32) plms_timesteps = jnp.concatenate([_timesteps[:-1], _timesteps[-2:-1], _timesteps[-1:]])[::-1] else: prk_timesteps = _timesteps[-self.pndm_order :].repeat(2) + jnp.tile( jnp.array([0, self.config.num_train_timesteps // num_inference_steps // 2], dtype=jnp.int32), self.pndm_order, ) prk_timesteps = (prk_timesteps[:-1].repeat(2)[1:-1])[::-1] plms_timesteps = _timesteps[:-3][::-1] timesteps = jnp.concatenate([prk_timesteps, plms_timesteps]) # initial running values cur_model_output = jnp.zeros(shape, dtype=self.dtype) counter = jnp.int32(0) cur_sample = jnp.zeros(shape, dtype=self.dtype) ets = jnp.zeros((4,) + shape, dtype=self.dtype) return state.replace( timesteps=timesteps, num_inference_steps=num_inference_steps, prk_timesteps=prk_timesteps, plms_timesteps=plms_timesteps, cur_model_output=cur_model_output, counter=counter, cur_sample=cur_sample, ets=ets, ) def scale_model_input( self, state: PNDMSchedulerState, sample: jnp.ndarray, timestep: Optional[int] = None ) -> jnp.ndarray: """ Ensures interchangeability with schedulers that need to scale the denoising model input depending on the current timestep. Args: state (`PNDMSchedulerState`): the `FlaxPNDMScheduler` state data class instance. sample (`jnp.ndarray`): input sample timestep (`int`, optional): current timestep Returns: `jnp.ndarray`: scaled input sample """ return sample def step( self, state: PNDMSchedulerState, model_output: jnp.ndarray, timestep: int, sample: jnp.ndarray, return_dict: bool = True, ) -> Union[FlaxPNDMSchedulerOutput, Tuple]: """ Predict the sample at the previous timestep by reversing the SDE. Core function to propagate the diffusion process from the learned model outputs (most often the predicted noise). This function calls `step_prk()` or `step_plms()` depending on the internal variable `counter`. Args: state (`PNDMSchedulerState`): the `FlaxPNDMScheduler` state data class instance. model_output (`jnp.ndarray`): direct output from learned diffusion model. timestep (`int`): current discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. return_dict (`bool`): option for returning tuple rather than FlaxPNDMSchedulerOutput class Returns: [`FlaxPNDMSchedulerOutput`] or `tuple`: [`FlaxPNDMSchedulerOutput`] if `return_dict` is True, otherwise a `tuple`. When returning a tuple, the first element is the sample tensor. """ if state.num_inference_steps is None: raise ValueError( "Number of inference steps is 'None', you need to run 'set_timesteps' after creating the scheduler" ) if self.config.skip_prk_steps: prev_sample, state = self.step_plms(state, model_output, timestep, sample) else: prk_prev_sample, prk_state = self.step_prk(state, model_output, timestep, sample) plms_prev_sample, plms_state = self.step_plms(state, model_output, timestep, sample) cond = state.counter < len(state.prk_timesteps) prev_sample = jax.lax.select(cond, prk_prev_sample, plms_prev_sample) state = state.replace( cur_model_output=jax.lax.select(cond, prk_state.cur_model_output, plms_state.cur_model_output), ets=jax.lax.select(cond, prk_state.ets, plms_state.ets), cur_sample=jax.lax.select(cond, prk_state.cur_sample, plms_state.cur_sample), counter=jax.lax.select(cond, prk_state.counter, plms_state.counter), ) if not return_dict: return (prev_sample, state) return FlaxPNDMSchedulerOutput(prev_sample=prev_sample, state=state) def step_prk( self, state: PNDMSchedulerState, model_output: jnp.ndarray, timestep: int, sample: jnp.ndarray, ) -> Union[FlaxPNDMSchedulerOutput, Tuple]: """ Step function propagating the sample with the Runge-Kutta method. RK takes 4 forward passes to approximate the solution to the differential equation. Args: state (`PNDMSchedulerState`): the `FlaxPNDMScheduler` state data class instance. model_output (`jnp.ndarray`): direct output from learned diffusion model. timestep (`int`): current discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. return_dict (`bool`): option for returning tuple rather than FlaxPNDMSchedulerOutput class Returns: [`FlaxPNDMSchedulerOutput`] or `tuple`: [`FlaxPNDMSchedulerOutput`] if `return_dict` is True, otherwise a `tuple`. When returning a tuple, the first element is the sample tensor. """ if state.num_inference_steps is None: raise ValueError( "Number of inference steps is 'None', you need to run 'set_timesteps' after creating the scheduler" ) diff_to_prev = jnp.where( state.counter % 2, 0, self.config.num_train_timesteps // state.num_inference_steps // 2 ) prev_timestep = timestep - diff_to_prev timestep = state.prk_timesteps[state.counter // 4 * 4] model_output = jax.lax.select( (state.counter % 4) != 3, model_output, # remainder 0, 1, 2 state.cur_model_output + 1 / 6 * model_output, # remainder 3 ) state = state.replace( cur_model_output=jax.lax.select_n( state.counter % 4, state.cur_model_output + 1 / 6 * model_output, # remainder 0 state.cur_model_output + 1 / 3 * model_output, # remainder 1 state.cur_model_output + 1 / 3 * model_output, # remainder 2 jnp.zeros_like(state.cur_model_output), # remainder 3 ), ets=jax.lax.select( (state.counter % 4) == 0, state.ets.at[0:3].set(state.ets[1:4]).at[3].set(model_output), # remainder 0 state.ets, # remainder 1, 2, 3 ), cur_sample=jax.lax.select( (state.counter % 4) == 0, sample, # remainder 0 state.cur_sample, # remainder 1, 2, 3 ), ) cur_sample = state.cur_sample prev_sample = self._get_prev_sample(state, cur_sample, timestep, prev_timestep, model_output) state = state.replace(counter=state.counter + 1) return (prev_sample, state) def step_plms( self, state: PNDMSchedulerState, model_output: jnp.ndarray, timestep: int, sample: jnp.ndarray, ) -> Union[FlaxPNDMSchedulerOutput, Tuple]: """ Step function propagating the sample with the linear multi-step method. This has one forward pass with multiple times to approximate the solution. Args: state (`PNDMSchedulerState`): the `FlaxPNDMScheduler` state data class instance. model_output (`jnp.ndarray`): direct output from learned diffusion model. timestep (`int`): current discrete timestep in the diffusion chain. sample (`jnp.ndarray`): current instance of sample being created by diffusion process. return_dict (`bool`): option for returning tuple rather than FlaxPNDMSchedulerOutput class Returns: [`FlaxPNDMSchedulerOutput`] or `tuple`: [`FlaxPNDMSchedulerOutput`] if `return_dict` is True, otherwise a `tuple`. When returning a tuple, the first element is the sample tensor. """ if state.num_inference_steps is None: raise ValueError( "Number of inference steps is 'None', you need to run 'set_timesteps' after creating the scheduler" ) # NOTE: There is no way to check in the jitted runtime if the prk mode was ran before prev_timestep = timestep - self.config.num_train_timesteps // state.num_inference_steps prev_timestep = jnp.where(prev_timestep > 0, prev_timestep, 0) # Reference: # if state.counter != 1: # state.ets.append(model_output) # else: # prev_timestep = timestep # timestep = timestep + self.config.num_train_timesteps // state.num_inference_steps prev_timestep = jnp.where(state.counter == 1, timestep, prev_timestep) timestep = jnp.where( state.counter == 1, timestep + self.config.num_train_timesteps // state.num_inference_steps, timestep ) # Reference: # if len(state.ets) == 1 and state.counter == 0: # model_output = model_output # state.cur_sample = sample # elif len(state.ets) == 1 and state.counter == 1: # model_output = (model_output + state.ets[-1]) / 2 # sample = state.cur_sample # state.cur_sample = None # elif len(state.ets) == 2: # model_output = (3 * state.ets[-1] - state.ets[-2]) / 2 # elif len(state.ets) == 3: # model_output = (23 * state.ets[-1] - 16 * state.ets[-2] + 5 * state.ets[-3]) / 12 # else: # model_output = (1 / 24) * (55 * state.ets[-1] - 59 * state.ets[-2] + 37 * state.ets[-3] - 9 * state.ets[-4]) state = state.replace( ets=jax.lax.select( state.counter != 1, state.ets.at[0:3].set(state.ets[1:4]).at[3].set(model_output), # counter != 1 state.ets, # counter 1 ), cur_sample=jax.lax.select( state.counter != 1, sample, # counter != 1 state.cur_sample, # counter 1 ), ) state = state.replace( cur_model_output=jax.lax.select_n( jnp.clip(state.counter, 0, 4), model_output, # counter 0 (model_output + state.ets[-1]) / 2, # counter 1 (3 * state.ets[-1] - state.ets[-2]) / 2, # counter 2 (23 * state.ets[-1] - 16 * state.ets[-2] + 5 * state.ets[-3]) / 12, # counter 3 (1 / 24) * (55 * state.ets[-1] - 59 * state.ets[-2] + 37 * state.ets[-3] - 9 * state.ets[-4]), # counter >= 4 ), ) sample = state.cur_sample model_output = state.cur_model_output prev_sample = self._get_prev_sample(state, sample, timestep, prev_timestep, model_output) state = state.replace(counter=state.counter + 1) return (prev_sample, state) def _get_prev_sample(self, state: PNDMSchedulerState, sample, timestep, prev_timestep, model_output): # See formula (9) of PNDM paper https://arxiv.org/pdf/2202.09778.pdf # this function computes x_(tโˆ’ฮด) using the formula of (9) # Note that x_t needs to be added to both sides of the equation # Notation (<variable name> -> <name in paper> # alpha_prod_t -> ฮฑ_t # alpha_prod_t_prev -> ฮฑ_(tโˆ’ฮด) # beta_prod_t -> (1 - ฮฑ_t) # beta_prod_t_prev -> (1 - ฮฑ_(tโˆ’ฮด)) # sample -> x_t # model_output -> e_ฮธ(x_t, t) # prev_sample -> x_(tโˆ’ฮด) alpha_prod_t = state.common.alphas_cumprod[timestep] alpha_prod_t_prev = jnp.where( prev_timestep >= 0, state.common.alphas_cumprod[prev_timestep], state.final_alpha_cumprod ) beta_prod_t = 1 - alpha_prod_t beta_prod_t_prev = 1 - alpha_prod_t_prev if self.config.prediction_type == "v_prediction": model_output = (alpha_prod_t**0.5) * model_output + (beta_prod_t**0.5) * sample elif self.config.prediction_type != "epsilon": raise ValueError( f"prediction_type given as {self.config.prediction_type} must be one of `epsilon` or `v_prediction`" ) # corresponds to (ฮฑ_(tโˆ’ฮด) - ฮฑ_t) divided by # denominator of x_t in formula (9) and plus 1 # Note: (ฮฑ_(tโˆ’ฮด) - ฮฑ_t) / (sqrt(ฮฑ_t) * (sqrt(ฮฑ_(tโˆ’ฮด)) + sqr(ฮฑ_t))) = # sqrt(ฮฑ_(tโˆ’ฮด)) / sqrt(ฮฑ_t)) sample_coeff = (alpha_prod_t_prev / alpha_prod_t) ** (0.5) # corresponds to denominator of e_ฮธ(x_t, t) in formula (9) model_output_denom_coeff = alpha_prod_t * beta_prod_t_prev ** (0.5) + ( alpha_prod_t * beta_prod_t * alpha_prod_t_prev ) ** (0.5) # full formula (9) prev_sample = ( sample_coeff * sample - (alpha_prod_t_prev - alpha_prod_t) * model_output / model_output_denom_coeff ) return prev_sample def add_noise( self, state: PNDMSchedulerState, original_samples: jnp.ndarray, noise: jnp.ndarray, timesteps: jnp.ndarray, ) -> jnp.ndarray: return add_noise_common(state.common, original_samples, noise, timesteps) def __len__(self): return self.config.num_train_timesteps
diffusers/src/diffusers/schedulers/scheduling_pndm_flax.py/0
{ "file_path": "diffusers/src/diffusers/schedulers/scheduling_pndm_flax.py", "repo_id": "diffusers", "token_count": 9658 }
126
# This file is autogenerated by the command `make fix-copies`, do not edit. from ..utils import DummyObject, requires_backends class FlaxStableDiffusionControlNetPipeline(metaclass=DummyObject): _backends = ["flax", "transformers"] def __init__(self, *args, **kwargs): requires_backends(self, ["flax", "transformers"]) @classmethod def from_config(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) @classmethod def from_pretrained(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) class FlaxStableDiffusionImg2ImgPipeline(metaclass=DummyObject): _backends = ["flax", "transformers"] def __init__(self, *args, **kwargs): requires_backends(self, ["flax", "transformers"]) @classmethod def from_config(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) @classmethod def from_pretrained(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) class FlaxStableDiffusionInpaintPipeline(metaclass=DummyObject): _backends = ["flax", "transformers"] def __init__(self, *args, **kwargs): requires_backends(self, ["flax", "transformers"]) @classmethod def from_config(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) @classmethod def from_pretrained(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) class FlaxStableDiffusionPipeline(metaclass=DummyObject): _backends = ["flax", "transformers"] def __init__(self, *args, **kwargs): requires_backends(self, ["flax", "transformers"]) @classmethod def from_config(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) @classmethod def from_pretrained(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) class FlaxStableDiffusionXLPipeline(metaclass=DummyObject): _backends = ["flax", "transformers"] def __init__(self, *args, **kwargs): requires_backends(self, ["flax", "transformers"]) @classmethod def from_config(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"]) @classmethod def from_pretrained(cls, *args, **kwargs): requires_backends(cls, ["flax", "transformers"])
diffusers/src/diffusers/utils/dummy_flax_and_transformers_objects.py/0
{ "file_path": "diffusers/src/diffusers/utils/dummy_flax_and_transformers_objects.py", "repo_id": "diffusers", "token_count": 957 }
127
import os from typing import Callable, Union import PIL.Image import PIL.ImageOps import requests def load_image( image: Union[str, PIL.Image.Image], convert_method: Callable[[PIL.Image.Image], PIL.Image.Image] = None ) -> PIL.Image.Image: """ Loads `image` to a PIL Image. Args: image (`str` or `PIL.Image.Image`): The image to convert to the PIL Image format. convert_method (Callable[[PIL.Image.Image], PIL.Image.Image], optional): A conversion method to apply to the image after loading it. When set to `None` the image will be converted "RGB". Returns: `PIL.Image.Image`: A PIL Image. """ if isinstance(image, str): if image.startswith("http://") or image.startswith("https://"): image = PIL.Image.open(requests.get(image, stream=True).raw) elif os.path.isfile(image): image = PIL.Image.open(image) else: raise ValueError( f"Incorrect path or URL. URLs must start with `http://` or `https://`, and {image} is not a valid path." ) else: raise ValueError( "Incorrect format used for the image. Should be a URL linking to an image, a local path, or a PIL image." ) image = PIL.ImageOps.exif_transpose(image) if convert_method is not None: image = convert_method(image) else: image = image.convert("RGB") return image
diffusers/src/diffusers/utils/loading_utils.py/0
{ "file_path": "diffusers/src/diffusers/utils/loading_utils.py", "repo_id": "diffusers", "token_count": 631 }
128
# coding=utf-8 # Copyright 2023 HuggingFace Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import unittest import numpy as np import torch from diffusers import DiffusionPipeline from diffusers.utils.testing_utils import torch_device class PEFTLoRALoading(unittest.TestCase): def get_dummy_inputs(self): pipeline_inputs = { "prompt": "A painting of a squirrel eating a burger", "num_inference_steps": 2, "guidance_scale": 6.0, "output_type": "np", "generator": torch.manual_seed(0), } return pipeline_inputs def test_stable_diffusion_peft_lora_loading_in_non_peft(self): sd_pipe = DiffusionPipeline.from_pretrained("hf-internal-testing/tiny-sd-pipe").to(torch_device) # This LoRA was obtained using similarly as how it's done in the training scripts. # For details on how the LoRA was obtained, refer to: # https://hf.co/datasets/diffusers/notebooks/blob/main/check_logits_with_serialization_peft_lora.py sd_pipe.load_lora_weights("hf-internal-testing/tiny-sd-lora-peft") inputs = self.get_dummy_inputs() outputs = sd_pipe(**inputs).images predicted_slice = outputs[0, -3:, -3:, -1].flatten() expected_slice = np.array([0.5396, 0.5707, 0.477, 0.4665, 0.5419, 0.4594, 0.4857, 0.4741, 0.4804]) self.assertTrue(outputs.shape == (1, 64, 64, 3)) assert np.allclose(expected_slice, predicted_slice, atol=1e-3, rtol=1e-3) def test_stable_diffusion_xl_peft_lora_loading_in_non_peft(self): sd_pipe = DiffusionPipeline.from_pretrained("hf-internal-testing/tiny-sdxl-pipe").to(torch_device) # This LoRA was obtained using similarly as how it's done in the training scripts. sd_pipe.load_lora_weights("hf-internal-testing/tiny-sdxl-lora-peft") inputs = self.get_dummy_inputs() outputs = sd_pipe(**inputs).images predicted_slice = outputs[0, -3:, -3:, -1].flatten() expected_slice = np.array([0.613, 0.5566, 0.54, 0.4162, 0.4042, 0.4596, 0.5374, 0.5286, 0.5038]) self.assertTrue(outputs.shape == (1, 64, 64, 3)) assert np.allclose(expected_slice, predicted_slice, atol=1e-3, rtol=1e-3)
diffusers/tests/lora/test_peft_lora_in_non_peft.py/0
{ "file_path": "diffusers/tests/lora/test_peft_lora_in_non_peft.py", "repo_id": "diffusers", "token_count": 1114 }
129
# coding=utf-8 # Copyright 2023 HuggingFace Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import copy import gc import os import tempfile import unittest from collections import OrderedDict import torch from parameterized import parameterized from pytest import mark from diffusers import UNet2DConditionModel from diffusers.models.attention_processor import ( CustomDiffusionAttnProcessor, IPAdapterAttnProcessor, IPAdapterAttnProcessor2_0, ) from diffusers.models.embeddings import ImageProjection, IPAdapterPlusImageProjection from diffusers.utils import logging from diffusers.utils.import_utils import is_xformers_available from diffusers.utils.testing_utils import ( backend_empty_cache, enable_full_determinism, floats_tensor, load_hf_numpy, require_torch_accelerator, require_torch_accelerator_with_fp16, require_torch_accelerator_with_training, require_torch_gpu, skip_mps, slow, torch_all_close, torch_device, ) from ..test_modeling_common import ModelTesterMixin, UNetTesterMixin logger = logging.get_logger(__name__) enable_full_determinism() def create_ip_adapter_state_dict(model): # "ip_adapter" (cross-attention weights) ip_cross_attn_state_dict = {} key_id = 1 for name in model.attn_processors.keys(): cross_attention_dim = None if name.endswith("attn1.processor") else model.config.cross_attention_dim if name.startswith("mid_block"): hidden_size = model.config.block_out_channels[-1] elif name.startswith("up_blocks"): block_id = int(name[len("up_blocks.")]) hidden_size = list(reversed(model.config.block_out_channels))[block_id] elif name.startswith("down_blocks"): block_id = int(name[len("down_blocks.")]) hidden_size = model.config.block_out_channels[block_id] if cross_attention_dim is not None: sd = IPAdapterAttnProcessor( hidden_size=hidden_size, cross_attention_dim=cross_attention_dim, scale=1.0 ).state_dict() ip_cross_attn_state_dict.update( { f"{key_id}.to_k_ip.weight": sd["to_k_ip.0.weight"], f"{key_id}.to_v_ip.weight": sd["to_v_ip.0.weight"], } ) key_id += 2 # "image_proj" (ImageProjection layer weights) cross_attention_dim = model.config["cross_attention_dim"] image_projection = ImageProjection( cross_attention_dim=cross_attention_dim, image_embed_dim=cross_attention_dim, num_image_text_embeds=4 ) ip_image_projection_state_dict = {} sd = image_projection.state_dict() ip_image_projection_state_dict.update( { "proj.weight": sd["image_embeds.weight"], "proj.bias": sd["image_embeds.bias"], "norm.weight": sd["norm.weight"], "norm.bias": sd["norm.bias"], } ) del sd ip_state_dict = {} ip_state_dict.update({"image_proj": ip_image_projection_state_dict, "ip_adapter": ip_cross_attn_state_dict}) return ip_state_dict def create_ip_adapter_plus_state_dict(model): # "ip_adapter" (cross-attention weights) ip_cross_attn_state_dict = {} key_id = 1 for name in model.attn_processors.keys(): cross_attention_dim = None if name.endswith("attn1.processor") else model.config.cross_attention_dim if name.startswith("mid_block"): hidden_size = model.config.block_out_channels[-1] elif name.startswith("up_blocks"): block_id = int(name[len("up_blocks.")]) hidden_size = list(reversed(model.config.block_out_channels))[block_id] elif name.startswith("down_blocks"): block_id = int(name[len("down_blocks.")]) hidden_size = model.config.block_out_channels[block_id] if cross_attention_dim is not None: sd = IPAdapterAttnProcessor( hidden_size=hidden_size, cross_attention_dim=cross_attention_dim, scale=1.0 ).state_dict() ip_cross_attn_state_dict.update( { f"{key_id}.to_k_ip.weight": sd["to_k_ip.0.weight"], f"{key_id}.to_v_ip.weight": sd["to_v_ip.0.weight"], } ) key_id += 2 # "image_proj" (ImageProjection layer weights) cross_attention_dim = model.config["cross_attention_dim"] image_projection = IPAdapterPlusImageProjection( embed_dims=cross_attention_dim, output_dims=cross_attention_dim, dim_head=32, heads=2, num_queries=4 ) ip_image_projection_state_dict = OrderedDict() for k, v in image_projection.state_dict().items(): if "2.to" in k: k = k.replace("2.to", "0.to") elif "3.0.weight" in k: k = k.replace("3.0.weight", "1.0.weight") elif "3.0.bias" in k: k = k.replace("3.0.bias", "1.0.bias") elif "3.0.weight" in k: k = k.replace("3.0.weight", "1.0.weight") elif "3.1.net.0.proj.weight" in k: k = k.replace("3.1.net.0.proj.weight", "1.1.weight") elif "3.net.2.weight" in k: k = k.replace("3.net.2.weight", "1.3.weight") elif "layers.0.0" in k: k = k.replace("layers.0.0", "layers.0.0.norm1") elif "layers.0.1" in k: k = k.replace("layers.0.1", "layers.0.0.norm2") elif "layers.1.0" in k: k = k.replace("layers.1.0", "layers.1.0.norm1") elif "layers.1.1" in k: k = k.replace("layers.1.1", "layers.1.0.norm2") elif "layers.2.0" in k: k = k.replace("layers.2.0", "layers.2.0.norm1") elif "layers.2.1" in k: k = k.replace("layers.2.1", "layers.2.0.norm2") if "norm_cross" in k: ip_image_projection_state_dict[k.replace("norm_cross", "norm1")] = v elif "layer_norm" in k: ip_image_projection_state_dict[k.replace("layer_norm", "norm2")] = v elif "to_k" in k: ip_image_projection_state_dict[k.replace("to_k", "to_kv")] = torch.cat([v, v], dim=0) elif "to_v" in k: continue elif "to_out.0" in k: ip_image_projection_state_dict[k.replace("to_out.0", "to_out")] = v else: ip_image_projection_state_dict[k] = v ip_state_dict = {} ip_state_dict.update({"image_proj": ip_image_projection_state_dict, "ip_adapter": ip_cross_attn_state_dict}) return ip_state_dict def create_custom_diffusion_layers(model, mock_weights: bool = True): train_kv = True train_q_out = True custom_diffusion_attn_procs = {} st = model.state_dict() for name, _ in model.attn_processors.items(): cross_attention_dim = None if name.endswith("attn1.processor") else model.config.cross_attention_dim if name.startswith("mid_block"): hidden_size = model.config.block_out_channels[-1] elif name.startswith("up_blocks"): block_id = int(name[len("up_blocks.")]) hidden_size = list(reversed(model.config.block_out_channels))[block_id] elif name.startswith("down_blocks"): block_id = int(name[len("down_blocks.")]) hidden_size = model.config.block_out_channels[block_id] layer_name = name.split(".processor")[0] weights = { "to_k_custom_diffusion.weight": st[layer_name + ".to_k.weight"], "to_v_custom_diffusion.weight": st[layer_name + ".to_v.weight"], } if train_q_out: weights["to_q_custom_diffusion.weight"] = st[layer_name + ".to_q.weight"] weights["to_out_custom_diffusion.0.weight"] = st[layer_name + ".to_out.0.weight"] weights["to_out_custom_diffusion.0.bias"] = st[layer_name + ".to_out.0.bias"] if cross_attention_dim is not None: custom_diffusion_attn_procs[name] = CustomDiffusionAttnProcessor( train_kv=train_kv, train_q_out=train_q_out, hidden_size=hidden_size, cross_attention_dim=cross_attention_dim, ).to(model.device) custom_diffusion_attn_procs[name].load_state_dict(weights) if mock_weights: # add 1 to weights to mock trained weights with torch.no_grad(): custom_diffusion_attn_procs[name].to_k_custom_diffusion.weight += 1 custom_diffusion_attn_procs[name].to_v_custom_diffusion.weight += 1 else: custom_diffusion_attn_procs[name] = CustomDiffusionAttnProcessor( train_kv=False, train_q_out=False, hidden_size=hidden_size, cross_attention_dim=cross_attention_dim, ) del st return custom_diffusion_attn_procs class UNet2DConditionModelTests(ModelTesterMixin, UNetTesterMixin, unittest.TestCase): model_class = UNet2DConditionModel main_input_name = "sample" @property def dummy_input(self): batch_size = 4 num_channels = 4 sizes = (32, 32) noise = floats_tensor((batch_size, num_channels) + sizes).to(torch_device) time_step = torch.tensor([10]).to(torch_device) encoder_hidden_states = floats_tensor((batch_size, 4, 32)).to(torch_device) return {"sample": noise, "timestep": time_step, "encoder_hidden_states": encoder_hidden_states} @property def input_shape(self): return (4, 32, 32) @property def output_shape(self): return (4, 32, 32) def prepare_init_args_and_inputs_for_common(self): init_dict = { "block_out_channels": (32, 64), "down_block_types": ("CrossAttnDownBlock2D", "DownBlock2D"), "up_block_types": ("UpBlock2D", "CrossAttnUpBlock2D"), "cross_attention_dim": 32, "attention_head_dim": 8, "out_channels": 4, "in_channels": 4, "layers_per_block": 2, "sample_size": 32, } inputs_dict = self.dummy_input return init_dict, inputs_dict @unittest.skipIf( torch_device != "cuda" or not is_xformers_available(), reason="XFormers attention is only available with CUDA and `xformers` installed", ) def test_xformers_enable_works(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() model = self.model_class(**init_dict) model.enable_xformers_memory_efficient_attention() assert ( model.mid_block.attentions[0].transformer_blocks[0].attn1.processor.__class__.__name__ == "XFormersAttnProcessor" ), "xformers is not enabled" @require_torch_accelerator_with_training def test_gradient_checkpointing(self): # enable deterministic behavior for gradient checkpointing init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() model = self.model_class(**init_dict) model.to(torch_device) assert not model.is_gradient_checkpointing and model.training out = model(**inputs_dict).sample # run the backwards pass on the model. For backwards pass, for simplicity purpose, # we won't calculate the loss and rather backprop on out.sum() model.zero_grad() labels = torch.randn_like(out) loss = (out - labels).mean() loss.backward() # re-instantiate the model now enabling gradient checkpointing model_2 = self.model_class(**init_dict) # clone model model_2.load_state_dict(model.state_dict()) model_2.to(torch_device) model_2.enable_gradient_checkpointing() assert model_2.is_gradient_checkpointing and model_2.training out_2 = model_2(**inputs_dict).sample # run the backwards pass on the model. For backwards pass, for simplicity purpose, # we won't calculate the loss and rather backprop on out.sum() model_2.zero_grad() loss_2 = (out_2 - labels).mean() loss_2.backward() # compare the output and parameters gradients self.assertTrue((loss - loss_2).abs() < 1e-5) named_params = dict(model.named_parameters()) named_params_2 = dict(model_2.named_parameters()) for name, param in named_params.items(): self.assertTrue(torch_all_close(param.grad.data, named_params_2[name].grad.data, atol=5e-5)) def test_model_with_attention_head_dim_tuple(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) model.to(torch_device) model.eval() with torch.no_grad(): output = model(**inputs_dict) if isinstance(output, dict): output = output.sample self.assertIsNotNone(output) expected_shape = inputs_dict["sample"].shape self.assertEqual(output.shape, expected_shape, "Input and output shapes do not match") def test_model_with_use_linear_projection(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["use_linear_projection"] = True model = self.model_class(**init_dict) model.to(torch_device) model.eval() with torch.no_grad(): output = model(**inputs_dict) if isinstance(output, dict): output = output.sample self.assertIsNotNone(output) expected_shape = inputs_dict["sample"].shape self.assertEqual(output.shape, expected_shape, "Input and output shapes do not match") def test_model_with_cross_attention_dim_tuple(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["cross_attention_dim"] = (32, 32) model = self.model_class(**init_dict) model.to(torch_device) model.eval() with torch.no_grad(): output = model(**inputs_dict) if isinstance(output, dict): output = output.sample self.assertIsNotNone(output) expected_shape = inputs_dict["sample"].shape self.assertEqual(output.shape, expected_shape, "Input and output shapes do not match") def test_model_with_simple_projection(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() batch_size, _, _, sample_size = inputs_dict["sample"].shape init_dict["class_embed_type"] = "simple_projection" init_dict["projection_class_embeddings_input_dim"] = sample_size inputs_dict["class_labels"] = floats_tensor((batch_size, sample_size)).to(torch_device) model = self.model_class(**init_dict) model.to(torch_device) model.eval() with torch.no_grad(): output = model(**inputs_dict) if isinstance(output, dict): output = output.sample self.assertIsNotNone(output) expected_shape = inputs_dict["sample"].shape self.assertEqual(output.shape, expected_shape, "Input and output shapes do not match") def test_model_with_class_embeddings_concat(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() batch_size, _, _, sample_size = inputs_dict["sample"].shape init_dict["class_embed_type"] = "simple_projection" init_dict["projection_class_embeddings_input_dim"] = sample_size init_dict["class_embeddings_concat"] = True inputs_dict["class_labels"] = floats_tensor((batch_size, sample_size)).to(torch_device) model = self.model_class(**init_dict) model.to(torch_device) model.eval() with torch.no_grad(): output = model(**inputs_dict) if isinstance(output, dict): output = output.sample self.assertIsNotNone(output) expected_shape = inputs_dict["sample"].shape self.assertEqual(output.shape, expected_shape, "Input and output shapes do not match") def test_model_attention_slicing(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) model.to(torch_device) model.eval() model.set_attention_slice("auto") with torch.no_grad(): output = model(**inputs_dict) assert output is not None model.set_attention_slice("max") with torch.no_grad(): output = model(**inputs_dict) assert output is not None model.set_attention_slice(2) with torch.no_grad(): output = model(**inputs_dict) assert output is not None def test_model_sliceable_head_dim(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) def check_sliceable_dim_attr(module: torch.nn.Module): if hasattr(module, "set_attention_slice"): assert isinstance(module.sliceable_head_dim, int) for child in module.children(): check_sliceable_dim_attr(child) # retrieve number of attention layers for module in model.children(): check_sliceable_dim_attr(module) def test_gradient_checkpointing_is_applied(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model_class_copy = copy.copy(self.model_class) modules_with_gc_enabled = {} # now monkey patch the following function: # def _set_gradient_checkpointing(self, module, value=False): # if hasattr(module, "gradient_checkpointing"): # module.gradient_checkpointing = value def _set_gradient_checkpointing_new(self, module, value=False): if hasattr(module, "gradient_checkpointing"): module.gradient_checkpointing = value modules_with_gc_enabled[module.__class__.__name__] = True model_class_copy._set_gradient_checkpointing = _set_gradient_checkpointing_new model = model_class_copy(**init_dict) model.enable_gradient_checkpointing() EXPECTED_SET = { "CrossAttnUpBlock2D", "CrossAttnDownBlock2D", "UNetMidBlock2DCrossAttn", "UpBlock2D", "Transformer2DModel", "DownBlock2D", } assert set(modules_with_gc_enabled.keys()) == EXPECTED_SET assert all(modules_with_gc_enabled.values()), "All modules should be enabled" def test_special_attn_proc(self): class AttnEasyProc(torch.nn.Module): def __init__(self, num): super().__init__() self.weight = torch.nn.Parameter(torch.tensor(num)) self.is_run = False self.number = 0 self.counter = 0 def __call__(self, attn, hidden_states, encoder_hidden_states=None, attention_mask=None, number=None): batch_size, sequence_length, _ = hidden_states.shape attention_mask = attn.prepare_attention_mask(attention_mask, sequence_length, batch_size) query = attn.to_q(hidden_states) encoder_hidden_states = encoder_hidden_states if encoder_hidden_states is not None else hidden_states key = attn.to_k(encoder_hidden_states) value = attn.to_v(encoder_hidden_states) query = attn.head_to_batch_dim(query) key = attn.head_to_batch_dim(key) value = attn.head_to_batch_dim(value) attention_probs = attn.get_attention_scores(query, key, attention_mask) hidden_states = torch.bmm(attention_probs, value) hidden_states = attn.batch_to_head_dim(hidden_states) # linear proj hidden_states = attn.to_out[0](hidden_states) # dropout hidden_states = attn.to_out[1](hidden_states) hidden_states += self.weight self.is_run = True self.counter += 1 self.number = number return hidden_states # enable deterministic behavior for gradient checkpointing init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) model.to(torch_device) processor = AttnEasyProc(5.0) model.set_attn_processor(processor) model(**inputs_dict, cross_attention_kwargs={"number": 123}).sample assert processor.counter == 12 assert processor.is_run assert processor.number == 123 @parameterized.expand( [ # fmt: off [torch.bool], [torch.long], [torch.float], # fmt: on ] ) def test_model_xattn_mask(self, mask_dtype): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() model = self.model_class(**{**init_dict, "attention_head_dim": (8, 16)}) model.to(torch_device) model.eval() cond = inputs_dict["encoder_hidden_states"] with torch.no_grad(): full_cond_out = model(**inputs_dict).sample assert full_cond_out is not None keepall_mask = torch.ones(*cond.shape[:-1], device=cond.device, dtype=mask_dtype) full_cond_keepallmask_out = model(**{**inputs_dict, "encoder_attention_mask": keepall_mask}).sample assert full_cond_keepallmask_out.allclose( full_cond_out, rtol=1e-05, atol=1e-05 ), "a 'keep all' mask should give the same result as no mask" trunc_cond = cond[:, :-1, :] trunc_cond_out = model(**{**inputs_dict, "encoder_hidden_states": trunc_cond}).sample assert not trunc_cond_out.allclose( full_cond_out, rtol=1e-05, atol=1e-05 ), "discarding the last token from our cond should change the result" batch, tokens, _ = cond.shape mask_last = (torch.arange(tokens) < tokens - 1).expand(batch, -1).to(cond.device, mask_dtype) masked_cond_out = model(**{**inputs_dict, "encoder_attention_mask": mask_last}).sample assert masked_cond_out.allclose( trunc_cond_out, rtol=1e-05, atol=1e-05 ), "masking the last token from our cond should be equivalent to truncating that token out of the condition" # see diffusers.models.attention_processor::Attention#prepare_attention_mask # note: we may not need to fix mask padding to work for stable-diffusion cross-attn masks. # since the use-case (somebody passes in a too-short cross-attn mask) is pretty esoteric. # maybe it's fine that this only works for the unclip use-case. @mark.skip( reason="we currently pad mask by target_length tokens (what unclip needs), whereas stable-diffusion's cross-attn needs to instead pad by remaining_length." ) def test_model_xattn_padding(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() model = self.model_class(**{**init_dict, "attention_head_dim": (8, 16)}) model.to(torch_device) model.eval() cond = inputs_dict["encoder_hidden_states"] with torch.no_grad(): full_cond_out = model(**inputs_dict).sample assert full_cond_out is not None batch, tokens, _ = cond.shape keeplast_mask = (torch.arange(tokens) == tokens - 1).expand(batch, -1).to(cond.device, torch.bool) keeplast_out = model(**{**inputs_dict, "encoder_attention_mask": keeplast_mask}).sample assert not keeplast_out.allclose(full_cond_out), "a 'keep last token' mask should change the result" trunc_mask = torch.zeros(batch, tokens - 1, device=cond.device, dtype=torch.bool) trunc_mask_out = model(**{**inputs_dict, "encoder_attention_mask": trunc_mask}).sample assert trunc_mask_out.allclose( keeplast_out ), "a mask with fewer tokens than condition, will be padded with 'keep' tokens. a 'discard-all' mask missing the final token is thus equivalent to a 'keep last' mask." def test_custom_diffusion_processors(self): # enable deterministic behavior for gradient checkpointing init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) model.to(torch_device) with torch.no_grad(): sample1 = model(**inputs_dict).sample custom_diffusion_attn_procs = create_custom_diffusion_layers(model, mock_weights=False) # make sure we can set a list of attention processors model.set_attn_processor(custom_diffusion_attn_procs) model.to(torch_device) # test that attn processors can be set to itself model.set_attn_processor(model.attn_processors) with torch.no_grad(): sample2 = model(**inputs_dict).sample assert (sample1 - sample2).abs().max() < 3e-3 def test_custom_diffusion_save_load(self): # enable deterministic behavior for gradient checkpointing init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) torch.manual_seed(0) model = self.model_class(**init_dict) model.to(torch_device) with torch.no_grad(): old_sample = model(**inputs_dict).sample custom_diffusion_attn_procs = create_custom_diffusion_layers(model, mock_weights=False) model.set_attn_processor(custom_diffusion_attn_procs) with torch.no_grad(): sample = model(**inputs_dict).sample with tempfile.TemporaryDirectory() as tmpdirname: model.save_attn_procs(tmpdirname, safe_serialization=False) self.assertTrue(os.path.isfile(os.path.join(tmpdirname, "pytorch_custom_diffusion_weights.bin"))) torch.manual_seed(0) new_model = self.model_class(**init_dict) new_model.load_attn_procs(tmpdirname, weight_name="pytorch_custom_diffusion_weights.bin") new_model.to(torch_device) with torch.no_grad(): new_sample = new_model(**inputs_dict).sample assert (sample - new_sample).abs().max() < 1e-4 # custom diffusion and no custom diffusion should be the same assert (sample - old_sample).abs().max() < 3e-3 @unittest.skipIf( torch_device != "cuda" or not is_xformers_available(), reason="XFormers attention is only available with CUDA and `xformers` installed", ) def test_custom_diffusion_xformers_on_off(self): # enable deterministic behavior for gradient checkpointing init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) torch.manual_seed(0) model = self.model_class(**init_dict) model.to(torch_device) custom_diffusion_attn_procs = create_custom_diffusion_layers(model, mock_weights=False) model.set_attn_processor(custom_diffusion_attn_procs) # default with torch.no_grad(): sample = model(**inputs_dict).sample model.enable_xformers_memory_efficient_attention() on_sample = model(**inputs_dict).sample model.disable_xformers_memory_efficient_attention() off_sample = model(**inputs_dict).sample assert (sample - on_sample).abs().max() < 1e-4 assert (sample - off_sample).abs().max() < 1e-4 def test_pickle(self): # enable deterministic behavior for gradient checkpointing init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) model.to(torch_device) with torch.no_grad(): sample = model(**inputs_dict).sample sample_copy = copy.copy(sample) assert (sample - sample_copy).abs().max() < 1e-4 def test_asymmetrical_unet(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() # Add asymmetry to configs init_dict["transformer_layers_per_block"] = [[3, 2], 1] init_dict["reverse_transformer_layers_per_block"] = [[3, 4], 1] torch.manual_seed(0) model = self.model_class(**init_dict) model.to(torch_device) output = model(**inputs_dict).sample expected_shape = inputs_dict["sample"].shape # Check if input and output shapes are the same self.assertEqual(output.shape, expected_shape, "Input and output shapes do not match") def test_ip_adapter(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) model.to(torch_device) # forward pass without ip-adapter with torch.no_grad(): sample1 = model(**inputs_dict).sample # update inputs_dict for ip-adapter batch_size = inputs_dict["encoder_hidden_states"].shape[0] # for ip-adapter image_embeds has shape [batch_size, num_image, embed_dim] image_embeds = floats_tensor((batch_size, 1, model.cross_attention_dim)).to(torch_device) inputs_dict["added_cond_kwargs"] = {"image_embeds": [image_embeds]} # make ip_adapter_1 and ip_adapter_2 ip_adapter_1 = create_ip_adapter_state_dict(model) image_proj_state_dict_2 = {k: w + 1.0 for k, w in ip_adapter_1["image_proj"].items()} cross_attn_state_dict_2 = {k: w + 1.0 for k, w in ip_adapter_1["ip_adapter"].items()} ip_adapter_2 = {} ip_adapter_2.update({"image_proj": image_proj_state_dict_2, "ip_adapter": cross_attn_state_dict_2}) # forward pass ip_adapter_1 model._load_ip_adapter_weights([ip_adapter_1]) assert model.config.encoder_hid_dim_type == "ip_image_proj" assert model.encoder_hid_proj is not None assert model.down_blocks[0].attentions[0].transformer_blocks[0].attn2.processor.__class__.__name__ in ( "IPAdapterAttnProcessor", "IPAdapterAttnProcessor2_0", ) with torch.no_grad(): sample2 = model(**inputs_dict).sample # forward pass with ip_adapter_2 model._load_ip_adapter_weights([ip_adapter_2]) with torch.no_grad(): sample3 = model(**inputs_dict).sample # forward pass with ip_adapter_1 again model._load_ip_adapter_weights([ip_adapter_1]) with torch.no_grad(): sample4 = model(**inputs_dict).sample # forward pass with multiple ip-adapters and multiple images model._load_ip_adapter_weights([ip_adapter_1, ip_adapter_2]) # set the scale for ip_adapter_2 to 0 so that result should be same as only load ip_adapter_1 for attn_processor in model.attn_processors.values(): if isinstance(attn_processor, (IPAdapterAttnProcessor, IPAdapterAttnProcessor2_0)): attn_processor.scale = [1, 0] image_embeds_multi = image_embeds.repeat(1, 2, 1) inputs_dict["added_cond_kwargs"] = {"image_embeds": [image_embeds_multi, image_embeds_multi]} with torch.no_grad(): sample5 = model(**inputs_dict).sample # forward pass with single ip-adapter & single image when image_embeds is not a list and a 2-d tensor image_embeds = image_embeds.squeeze(1) inputs_dict["added_cond_kwargs"] = {"image_embeds": image_embeds} model._load_ip_adapter_weights(ip_adapter_1) with torch.no_grad(): sample6 = model(**inputs_dict).sample assert not sample1.allclose(sample2, atol=1e-4, rtol=1e-4) assert not sample2.allclose(sample3, atol=1e-4, rtol=1e-4) assert sample2.allclose(sample4, atol=1e-4, rtol=1e-4) assert sample2.allclose(sample5, atol=1e-4, rtol=1e-4) assert sample2.allclose(sample6, atol=1e-4, rtol=1e-4) def test_ip_adapter_plus(self): init_dict, inputs_dict = self.prepare_init_args_and_inputs_for_common() init_dict["attention_head_dim"] = (8, 16) model = self.model_class(**init_dict) model.to(torch_device) # forward pass without ip-adapter with torch.no_grad(): sample1 = model(**inputs_dict).sample # update inputs_dict for ip-adapter batch_size = inputs_dict["encoder_hidden_states"].shape[0] # for ip-adapter-plus image_embeds has shape [batch_size, num_image, sequence_length, embed_dim] image_embeds = floats_tensor((batch_size, 1, 1, model.cross_attention_dim)).to(torch_device) inputs_dict["added_cond_kwargs"] = {"image_embeds": [image_embeds]} # make ip_adapter_1 and ip_adapter_2 ip_adapter_1 = create_ip_adapter_plus_state_dict(model) image_proj_state_dict_2 = {k: w + 1.0 for k, w in ip_adapter_1["image_proj"].items()} cross_attn_state_dict_2 = {k: w + 1.0 for k, w in ip_adapter_1["ip_adapter"].items()} ip_adapter_2 = {} ip_adapter_2.update({"image_proj": image_proj_state_dict_2, "ip_adapter": cross_attn_state_dict_2}) # forward pass ip_adapter_1 model._load_ip_adapter_weights([ip_adapter_1]) assert model.config.encoder_hid_dim_type == "ip_image_proj" assert model.encoder_hid_proj is not None assert model.down_blocks[0].attentions[0].transformer_blocks[0].attn2.processor.__class__.__name__ in ( "IPAdapterAttnProcessor", "IPAdapterAttnProcessor2_0", ) with torch.no_grad(): sample2 = model(**inputs_dict).sample # forward pass with ip_adapter_2 model._load_ip_adapter_weights([ip_adapter_2]) with torch.no_grad(): sample3 = model(**inputs_dict).sample # forward pass with ip_adapter_1 again model._load_ip_adapter_weights([ip_adapter_1]) with torch.no_grad(): sample4 = model(**inputs_dict).sample # forward pass with multiple ip-adapters and multiple images model._load_ip_adapter_weights([ip_adapter_1, ip_adapter_2]) # set the scale for ip_adapter_2 to 0 so that result should be same as only load ip_adapter_1 for attn_processor in model.attn_processors.values(): if isinstance(attn_processor, (IPAdapterAttnProcessor, IPAdapterAttnProcessor2_0)): attn_processor.scale = [1, 0] image_embeds_multi = image_embeds.repeat(1, 2, 1, 1) inputs_dict["added_cond_kwargs"] = {"image_embeds": [image_embeds_multi, image_embeds_multi]} with torch.no_grad(): sample5 = model(**inputs_dict).sample # forward pass with single ip-adapter & single image when image_embeds is a 3-d tensor image_embeds = image_embeds[:,].squeeze(1) inputs_dict["added_cond_kwargs"] = {"image_embeds": image_embeds} model._load_ip_adapter_weights(ip_adapter_1) with torch.no_grad(): sample6 = model(**inputs_dict).sample assert not sample1.allclose(sample2, atol=1e-4, rtol=1e-4) assert not sample2.allclose(sample3, atol=1e-4, rtol=1e-4) assert sample2.allclose(sample4, atol=1e-4, rtol=1e-4) assert sample2.allclose(sample5, atol=1e-4, rtol=1e-4) assert sample2.allclose(sample6, atol=1e-4, rtol=1e-4) @slow class UNet2DConditionModelIntegrationTests(unittest.TestCase): def get_file_format(self, seed, shape): return f"gaussian_noise_s={seed}_shape={'_'.join([str(s) for s in shape])}.npy" def tearDown(self): # clean up the VRAM after each test super().tearDown() gc.collect() backend_empty_cache(torch_device) def get_latents(self, seed=0, shape=(4, 4, 64, 64), fp16=False): dtype = torch.float16 if fp16 else torch.float32 image = torch.from_numpy(load_hf_numpy(self.get_file_format(seed, shape))).to(torch_device).to(dtype) return image def get_unet_model(self, fp16=False, model_id="CompVis/stable-diffusion-v1-4"): revision = "fp16" if fp16 else None torch_dtype = torch.float16 if fp16 else torch.float32 model = UNet2DConditionModel.from_pretrained( model_id, subfolder="unet", torch_dtype=torch_dtype, revision=revision ) model.to(torch_device).eval() return model @require_torch_gpu def test_set_attention_slice_auto(self): torch.cuda.empty_cache() torch.cuda.reset_max_memory_allocated() torch.cuda.reset_peak_memory_stats() unet = self.get_unet_model() unet.set_attention_slice("auto") latents = self.get_latents(33) encoder_hidden_states = self.get_encoder_hidden_states(33) timestep = 1 with torch.no_grad(): _ = unet(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample mem_bytes = torch.cuda.max_memory_allocated() assert mem_bytes < 5 * 10**9 @require_torch_gpu def test_set_attention_slice_max(self): torch.cuda.empty_cache() torch.cuda.reset_max_memory_allocated() torch.cuda.reset_peak_memory_stats() unet = self.get_unet_model() unet.set_attention_slice("max") latents = self.get_latents(33) encoder_hidden_states = self.get_encoder_hidden_states(33) timestep = 1 with torch.no_grad(): _ = unet(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample mem_bytes = torch.cuda.max_memory_allocated() assert mem_bytes < 5 * 10**9 @require_torch_gpu def test_set_attention_slice_int(self): torch.cuda.empty_cache() torch.cuda.reset_max_memory_allocated() torch.cuda.reset_peak_memory_stats() unet = self.get_unet_model() unet.set_attention_slice(2) latents = self.get_latents(33) encoder_hidden_states = self.get_encoder_hidden_states(33) timestep = 1 with torch.no_grad(): _ = unet(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample mem_bytes = torch.cuda.max_memory_allocated() assert mem_bytes < 5 * 10**9 @require_torch_gpu def test_set_attention_slice_list(self): torch.cuda.empty_cache() torch.cuda.reset_max_memory_allocated() torch.cuda.reset_peak_memory_stats() # there are 32 sliceable layers slice_list = 16 * [2, 3] unet = self.get_unet_model() unet.set_attention_slice(slice_list) latents = self.get_latents(33) encoder_hidden_states = self.get_encoder_hidden_states(33) timestep = 1 with torch.no_grad(): _ = unet(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample mem_bytes = torch.cuda.max_memory_allocated() assert mem_bytes < 5 * 10**9 def get_encoder_hidden_states(self, seed=0, shape=(4, 77, 768), fp16=False): dtype = torch.float16 if fp16 else torch.float32 hidden_states = torch.from_numpy(load_hf_numpy(self.get_file_format(seed, shape))).to(torch_device).to(dtype) return hidden_states @parameterized.expand( [ # fmt: off [33, 4, [-0.4424, 0.1510, -0.1937, 0.2118, 0.3746, -0.3957, 0.0160, -0.0435]], [47, 0.55, [-0.1508, 0.0379, -0.3075, 0.2540, 0.3633, -0.0821, 0.1719, -0.0207]], [21, 0.89, [-0.6479, 0.6364, -0.3464, 0.8697, 0.4443, -0.6289, -0.0091, 0.1778]], [9, 1000, [0.8888, -0.5659, 0.5834, -0.7469, 1.1912, -0.3923, 1.1241, -0.4424]], # fmt: on ] ) @require_torch_accelerator_with_fp16 def test_compvis_sd_v1_4(self, seed, timestep, expected_slice): model = self.get_unet_model(model_id="CompVis/stable-diffusion-v1-4") latents = self.get_latents(seed) encoder_hidden_states = self.get_encoder_hidden_states(seed) timestep = torch.tensor([timestep], dtype=torch.long, device=torch_device) with torch.no_grad(): sample = model(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample assert sample.shape == latents.shape output_slice = sample[-1, -2:, -2:, :2].flatten().float().cpu() expected_output_slice = torch.tensor(expected_slice) assert torch_all_close(output_slice, expected_output_slice, atol=1e-3) @parameterized.expand( [ # fmt: off [83, 4, [-0.2323, -0.1304, 0.0813, -0.3093, -0.0919, -0.1571, -0.1125, -0.5806]], [17, 0.55, [-0.0831, -0.2443, 0.0901, -0.0919, 0.3396, 0.0103, -0.3743, 0.0701]], [8, 0.89, [-0.4863, 0.0859, 0.0875, -0.1658, 0.9199, -0.0114, 0.4839, 0.4639]], [3, 1000, [-0.5649, 0.2402, -0.5518, 0.1248, 1.1328, -0.2443, -0.0325, -1.0078]], # fmt: on ] ) @require_torch_accelerator_with_fp16 def test_compvis_sd_v1_4_fp16(self, seed, timestep, expected_slice): model = self.get_unet_model(model_id="CompVis/stable-diffusion-v1-4", fp16=True) latents = self.get_latents(seed, fp16=True) encoder_hidden_states = self.get_encoder_hidden_states(seed, fp16=True) timestep = torch.tensor([timestep], dtype=torch.long, device=torch_device) with torch.no_grad(): sample = model(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample assert sample.shape == latents.shape output_slice = sample[-1, -2:, -2:, :2].flatten().float().cpu() expected_output_slice = torch.tensor(expected_slice) assert torch_all_close(output_slice, expected_output_slice, atol=5e-3) @parameterized.expand( [ # fmt: off [33, 4, [-0.4430, 0.1570, -0.1867, 0.2376, 0.3205, -0.3681, 0.0525, -0.0722]], [47, 0.55, [-0.1415, 0.0129, -0.3136, 0.2257, 0.3430, -0.0536, 0.2114, -0.0436]], [21, 0.89, [-0.7091, 0.6664, -0.3643, 0.9032, 0.4499, -0.6541, 0.0139, 0.1750]], [9, 1000, [0.8878, -0.5659, 0.5844, -0.7442, 1.1883, -0.3927, 1.1192, -0.4423]], # fmt: on ] ) @require_torch_accelerator @skip_mps def test_compvis_sd_v1_5(self, seed, timestep, expected_slice): model = self.get_unet_model(model_id="runwayml/stable-diffusion-v1-5") latents = self.get_latents(seed) encoder_hidden_states = self.get_encoder_hidden_states(seed) timestep = torch.tensor([timestep], dtype=torch.long, device=torch_device) with torch.no_grad(): sample = model(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample assert sample.shape == latents.shape output_slice = sample[-1, -2:, -2:, :2].flatten().float().cpu() expected_output_slice = torch.tensor(expected_slice) assert torch_all_close(output_slice, expected_output_slice, atol=1e-3) @parameterized.expand( [ # fmt: off [83, 4, [-0.2695, -0.1669, 0.0073, -0.3181, -0.1187, -0.1676, -0.1395, -0.5972]], [17, 0.55, [-0.1290, -0.2588, 0.0551, -0.0916, 0.3286, 0.0238, -0.3669, 0.0322]], [8, 0.89, [-0.5283, 0.1198, 0.0870, -0.1141, 0.9189, -0.0150, 0.5474, 0.4319]], [3, 1000, [-0.5601, 0.2411, -0.5435, 0.1268, 1.1338, -0.2427, -0.0280, -1.0020]], # fmt: on ] ) @require_torch_accelerator_with_fp16 def test_compvis_sd_v1_5_fp16(self, seed, timestep, expected_slice): model = self.get_unet_model(model_id="runwayml/stable-diffusion-v1-5", fp16=True) latents = self.get_latents(seed, fp16=True) encoder_hidden_states = self.get_encoder_hidden_states(seed, fp16=True) timestep = torch.tensor([timestep], dtype=torch.long, device=torch_device) with torch.no_grad(): sample = model(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample assert sample.shape == latents.shape output_slice = sample[-1, -2:, -2:, :2].flatten().float().cpu() expected_output_slice = torch.tensor(expected_slice) assert torch_all_close(output_slice, expected_output_slice, atol=5e-3) @parameterized.expand( [ # fmt: off [33, 4, [-0.7639, 0.0106, -0.1615, -0.3487, -0.0423, -0.7972, 0.0085, -0.4858]], [47, 0.55, [-0.6564, 0.0795, -1.9026, -0.6258, 1.8235, 1.2056, 1.2169, 0.9073]], [21, 0.89, [0.0327, 0.4399, -0.6358, 0.3417, 0.4120, -0.5621, -0.0397, -1.0430]], [9, 1000, [0.1600, 0.7303, -1.0556, -0.3515, -0.7440, -1.2037, -1.8149, -1.8931]], # fmt: on ] ) @require_torch_accelerator @skip_mps def test_compvis_sd_inpaint(self, seed, timestep, expected_slice): model = self.get_unet_model(model_id="runwayml/stable-diffusion-inpainting") latents = self.get_latents(seed, shape=(4, 9, 64, 64)) encoder_hidden_states = self.get_encoder_hidden_states(seed) timestep = torch.tensor([timestep], dtype=torch.long, device=torch_device) with torch.no_grad(): sample = model(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample assert sample.shape == (4, 4, 64, 64) output_slice = sample[-1, -2:, -2:, :2].flatten().float().cpu() expected_output_slice = torch.tensor(expected_slice) assert torch_all_close(output_slice, expected_output_slice, atol=3e-3) @parameterized.expand( [ # fmt: off [83, 4, [-0.1047, -1.7227, 0.1067, 0.0164, -0.5698, -0.4172, -0.1388, 1.1387]], [17, 0.55, [0.0975, -0.2856, -0.3508, -0.4600, 0.3376, 0.2930, -0.2747, -0.7026]], [8, 0.89, [-0.0952, 0.0183, -0.5825, -0.1981, 0.1131, 0.4668, -0.0395, -0.3486]], [3, 1000, [0.4790, 0.4949, -1.0732, -0.7158, 0.7959, -0.9478, 0.1105, -0.9741]], # fmt: on ] ) @require_torch_accelerator_with_fp16 def test_compvis_sd_inpaint_fp16(self, seed, timestep, expected_slice): model = self.get_unet_model(model_id="runwayml/stable-diffusion-inpainting", fp16=True) latents = self.get_latents(seed, shape=(4, 9, 64, 64), fp16=True) encoder_hidden_states = self.get_encoder_hidden_states(seed, fp16=True) timestep = torch.tensor([timestep], dtype=torch.long, device=torch_device) with torch.no_grad(): sample = model(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample assert sample.shape == (4, 4, 64, 64) output_slice = sample[-1, -2:, -2:, :2].flatten().float().cpu() expected_output_slice = torch.tensor(expected_slice) assert torch_all_close(output_slice, expected_output_slice, atol=5e-3) @parameterized.expand( [ # fmt: off [83, 4, [0.1514, 0.0807, 0.1624, 0.1016, -0.1896, 0.0263, 0.0677, 0.2310]], [17, 0.55, [0.1164, -0.0216, 0.0170, 0.1589, -0.3120, 0.1005, -0.0581, -0.1458]], [8, 0.89, [-0.1758, -0.0169, 0.1004, -0.1411, 0.1312, 0.1103, -0.1996, 0.2139]], [3, 1000, [0.1214, 0.0352, -0.0731, -0.1562, -0.0994, -0.0906, -0.2340, -0.0539]], # fmt: on ] ) @require_torch_accelerator_with_fp16 def test_stabilityai_sd_v2_fp16(self, seed, timestep, expected_slice): model = self.get_unet_model(model_id="stabilityai/stable-diffusion-2", fp16=True) latents = self.get_latents(seed, shape=(4, 4, 96, 96), fp16=True) encoder_hidden_states = self.get_encoder_hidden_states(seed, shape=(4, 77, 1024), fp16=True) timestep = torch.tensor([timestep], dtype=torch.long, device=torch_device) with torch.no_grad(): sample = model(latents, timestep=timestep, encoder_hidden_states=encoder_hidden_states).sample assert sample.shape == latents.shape output_slice = sample[-1, -2:, -2:, :2].flatten().float().cpu() expected_output_slice = torch.tensor(expected_slice) assert torch_all_close(output_slice, expected_output_slice, atol=5e-3)
diffusers/tests/models/unets/test_models_unet_2d_condition.py/0
{ "file_path": "diffusers/tests/models/unets/test_models_unet_2d_condition.py", "repo_id": "diffusers", "token_count": 23036 }
130
# coding=utf-8 # Copyright 2023 HuggingFace Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import os import unittest from distutils.util import strtobool import pytest from diffusers import __version__ from diffusers.utils import deprecate # Used to test the hub USER = "__DUMMY_TRANSFORMERS_USER__" ENDPOINT_STAGING = "https://hub-ci.huggingface.co" # Not critical, only usable on the sandboxed CI instance. TOKEN = "hf_94wBhPGp6KrrTH3KDchhKpRxZwd6dmHWLL" class DeprecateTester(unittest.TestCase): higher_version = ".".join([str(int(__version__.split(".")[0]) + 1)] + __version__.split(".")[1:]) lower_version = "0.0.1" def test_deprecate_function_arg(self): kwargs = {"deprecated_arg": 4} with self.assertWarns(FutureWarning) as warning: output = deprecate("deprecated_arg", self.higher_version, "message", take_from=kwargs) assert output == 4 assert ( str(warning.warning) == f"The `deprecated_arg` argument is deprecated and will be removed in version {self.higher_version}." " message" ) def test_deprecate_function_arg_tuple(self): kwargs = {"deprecated_arg": 4} with self.assertWarns(FutureWarning) as warning: output = deprecate(("deprecated_arg", self.higher_version, "message"), take_from=kwargs) assert output == 4 assert ( str(warning.warning) == f"The `deprecated_arg` argument is deprecated and will be removed in version {self.higher_version}." " message" ) def test_deprecate_function_args(self): kwargs = {"deprecated_arg_1": 4, "deprecated_arg_2": 8} with self.assertWarns(FutureWarning) as warning: output_1, output_2 = deprecate( ("deprecated_arg_1", self.higher_version, "Hey"), ("deprecated_arg_2", self.higher_version, "Hey"), take_from=kwargs, ) assert output_1 == 4 assert output_2 == 8 assert ( str(warning.warnings[0].message) == "The `deprecated_arg_1` argument is deprecated and will be removed in version" f" {self.higher_version}. Hey" ) assert ( str(warning.warnings[1].message) == "The `deprecated_arg_2` argument is deprecated and will be removed in version" f" {self.higher_version}. Hey" ) def test_deprecate_function_incorrect_arg(self): kwargs = {"deprecated_arg": 4} with self.assertRaises(TypeError) as error: deprecate(("wrong_arg", self.higher_version, "message"), take_from=kwargs) assert "test_deprecate_function_incorrect_arg in" in str(error.exception) assert "line" in str(error.exception) assert "got an unexpected keyword argument `deprecated_arg`" in str(error.exception) def test_deprecate_arg_no_kwarg(self): with self.assertWarns(FutureWarning) as warning: deprecate(("deprecated_arg", self.higher_version, "message")) assert ( str(warning.warning) == f"`deprecated_arg` is deprecated and will be removed in version {self.higher_version}. message" ) def test_deprecate_args_no_kwarg(self): with self.assertWarns(FutureWarning) as warning: deprecate( ("deprecated_arg_1", self.higher_version, "Hey"), ("deprecated_arg_2", self.higher_version, "Hey"), ) assert ( str(warning.warnings[0].message) == f"`deprecated_arg_1` is deprecated and will be removed in version {self.higher_version}. Hey" ) assert ( str(warning.warnings[1].message) == f"`deprecated_arg_2` is deprecated and will be removed in version {self.higher_version}. Hey" ) def test_deprecate_class_obj(self): class Args: arg = 5 with self.assertWarns(FutureWarning) as warning: arg = deprecate(("arg", self.higher_version, "message"), take_from=Args()) assert arg == 5 assert ( str(warning.warning) == f"The `arg` attribute is deprecated and will be removed in version {self.higher_version}. message" ) def test_deprecate_class_objs(self): class Args: arg = 5 foo = 7 with self.assertWarns(FutureWarning) as warning: arg_1, arg_2 = deprecate( ("arg", self.higher_version, "message"), ("foo", self.higher_version, "message"), ("does not exist", self.higher_version, "message"), take_from=Args(), ) assert arg_1 == 5 assert arg_2 == 7 assert ( str(warning.warning) == f"The `arg` attribute is deprecated and will be removed in version {self.higher_version}. message" ) assert ( str(warning.warnings[0].message) == f"The `arg` attribute is deprecated and will be removed in version {self.higher_version}. message" ) assert ( str(warning.warnings[1].message) == f"The `foo` attribute is deprecated and will be removed in version {self.higher_version}. message" ) def test_deprecate_incorrect_version(self): kwargs = {"deprecated_arg": 4} with self.assertRaises(ValueError) as error: deprecate(("wrong_arg", self.lower_version, "message"), take_from=kwargs) assert ( str(error.exception) == "The deprecation tuple ('wrong_arg', '0.0.1', 'message') should be removed since diffusers' version" f" {__version__} is >= {self.lower_version}" ) def test_deprecate_incorrect_no_standard_warn(self): with self.assertWarns(FutureWarning) as warning: deprecate(("deprecated_arg", self.higher_version, "This message is better!!!"), standard_warn=False) assert str(warning.warning) == "This message is better!!!" def test_deprecate_stacklevel(self): with self.assertWarns(FutureWarning) as warning: deprecate(("deprecated_arg", self.higher_version, "This message is better!!!"), standard_warn=False) assert str(warning.warning) == "This message is better!!!" assert "diffusers/tests/others/test_utils.py" in warning.filename def parse_flag_from_env(key, default=False): try: value = os.environ[key] except KeyError: # KEY isn't set, default to `default`. _value = default else: # KEY is set, convert it to True or False. try: _value = strtobool(value) except ValueError: # More values are supported, but let's keep the message simple. raise ValueError(f"If set, {key} must be yes or no.") return _value _run_staging = parse_flag_from_env("HUGGINGFACE_CO_STAGING", default=False) def is_staging_test(test_case): """ Decorator marking a test as a staging test. Those tests will run using the staging environment of huggingface.co instead of the real model hub. """ if not _run_staging: return unittest.skip("test is staging test")(test_case) else: return pytest.mark.is_staging_test()(test_case)
diffusers/tests/others/test_utils.py/0
{ "file_path": "diffusers/tests/others/test_utils.py", "repo_id": "diffusers", "token_count": 3327 }
131
import gc import unittest import numpy as np import torch from torch.backends.cuda import sdp_kernel from diffusers import ( CMStochasticIterativeScheduler, ConsistencyModelPipeline, UNet2DModel, ) from diffusers.utils.testing_utils import ( enable_full_determinism, nightly, require_torch_2, require_torch_gpu, torch_device, ) from diffusers.utils.torch_utils import randn_tensor from ..pipeline_params import UNCONDITIONAL_IMAGE_GENERATION_BATCH_PARAMS, UNCONDITIONAL_IMAGE_GENERATION_PARAMS from ..test_pipelines_common import PipelineTesterMixin enable_full_determinism() class ConsistencyModelPipelineFastTests(PipelineTesterMixin, unittest.TestCase): pipeline_class = ConsistencyModelPipeline params = UNCONDITIONAL_IMAGE_GENERATION_PARAMS batch_params = UNCONDITIONAL_IMAGE_GENERATION_BATCH_PARAMS # Override required_optional_params to remove num_images_per_prompt required_optional_params = frozenset( [ "num_inference_steps", "generator", "latents", "output_type", "return_dict", "callback", "callback_steps", ] ) @property def dummy_uncond_unet(self): unet = UNet2DModel.from_pretrained( "diffusers/consistency-models-test", subfolder="test_unet", ) return unet @property def dummy_cond_unet(self): unet = UNet2DModel.from_pretrained( "diffusers/consistency-models-test", subfolder="test_unet_class_cond", ) return unet def get_dummy_components(self, class_cond=False): if class_cond: unet = self.dummy_cond_unet else: unet = self.dummy_uncond_unet # Default to CM multistep sampler scheduler = CMStochasticIterativeScheduler( num_train_timesteps=40, sigma_min=0.002, sigma_max=80.0, ) components = { "unet": unet, "scheduler": scheduler, } return components def get_dummy_inputs(self, device, seed=0): if str(device).startswith("mps"): generator = torch.manual_seed(seed) else: generator = torch.Generator(device=device).manual_seed(seed) inputs = { "batch_size": 1, "num_inference_steps": None, "timesteps": [22, 0], "generator": generator, "output_type": "np", } return inputs def test_consistency_model_pipeline_multistep(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = ConsistencyModelPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) image = pipe(**inputs).images assert image.shape == (1, 32, 32, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.3572, 0.6273, 0.4031, 0.3961, 0.4321, 0.5730, 0.5266, 0.4780, 0.5004]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_consistency_model_pipeline_multistep_class_cond(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components(class_cond=True) pipe = ConsistencyModelPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) inputs["class_labels"] = 0 image = pipe(**inputs).images assert image.shape == (1, 32, 32, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.3572, 0.6273, 0.4031, 0.3961, 0.4321, 0.5730, 0.5266, 0.4780, 0.5004]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_consistency_model_pipeline_onestep(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = ConsistencyModelPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) inputs["num_inference_steps"] = 1 inputs["timesteps"] = None image = pipe(**inputs).images assert image.shape == (1, 32, 32, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.5004, 0.5004, 0.4994, 0.5008, 0.4976, 0.5018, 0.4990, 0.4982, 0.4987]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_consistency_model_pipeline_onestep_class_cond(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components(class_cond=True) pipe = ConsistencyModelPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) inputs["num_inference_steps"] = 1 inputs["timesteps"] = None inputs["class_labels"] = 0 image = pipe(**inputs).images assert image.shape == (1, 32, 32, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.5004, 0.5004, 0.4994, 0.5008, 0.4976, 0.5018, 0.4990, 0.4982, 0.4987]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 @nightly @require_torch_gpu class ConsistencyModelPipelineSlowTests(unittest.TestCase): def tearDown(self): super().tearDown() gc.collect() torch.cuda.empty_cache() def get_inputs(self, seed=0, get_fixed_latents=False, device="cpu", dtype=torch.float32, shape=(1, 3, 64, 64)): generator = torch.manual_seed(seed) inputs = { "num_inference_steps": None, "timesteps": [22, 0], "class_labels": 0, "generator": generator, "output_type": "np", } if get_fixed_latents: latents = self.get_fixed_latents(seed=seed, device=device, dtype=dtype, shape=shape) inputs["latents"] = latents return inputs def get_fixed_latents(self, seed=0, device="cpu", dtype=torch.float32, shape=(1, 3, 64, 64)): if isinstance(device, str): device = torch.device(device) generator = torch.Generator(device=device).manual_seed(seed) latents = randn_tensor(shape, generator=generator, device=device, dtype=dtype) return latents def test_consistency_model_cd_multistep(self): unet = UNet2DModel.from_pretrained("diffusers/consistency_models", subfolder="diffusers_cd_imagenet64_l2") scheduler = CMStochasticIterativeScheduler( num_train_timesteps=40, sigma_min=0.002, sigma_max=80.0, ) pipe = ConsistencyModelPipeline(unet=unet, scheduler=scheduler) pipe.to(torch_device=torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs() image = pipe(**inputs).images assert image.shape == (1, 64, 64, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.0146, 0.0158, 0.0092, 0.0086, 0.0000, 0.0000, 0.0000, 0.0000, 0.0058]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_consistency_model_cd_onestep(self): unet = UNet2DModel.from_pretrained("diffusers/consistency_models", subfolder="diffusers_cd_imagenet64_l2") scheduler = CMStochasticIterativeScheduler( num_train_timesteps=40, sigma_min=0.002, sigma_max=80.0, ) pipe = ConsistencyModelPipeline(unet=unet, scheduler=scheduler) pipe.to(torch_device=torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs() inputs["num_inference_steps"] = 1 inputs["timesteps"] = None image = pipe(**inputs).images assert image.shape == (1, 64, 64, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.0059, 0.0003, 0.0000, 0.0023, 0.0052, 0.0007, 0.0165, 0.0081, 0.0095]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 @require_torch_2 def test_consistency_model_cd_multistep_flash_attn(self): unet = UNet2DModel.from_pretrained("diffusers/consistency_models", subfolder="diffusers_cd_imagenet64_l2") scheduler = CMStochasticIterativeScheduler( num_train_timesteps=40, sigma_min=0.002, sigma_max=80.0, ) pipe = ConsistencyModelPipeline(unet=unet, scheduler=scheduler) pipe.to(torch_device=torch_device, torch_dtype=torch.float16) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs(get_fixed_latents=True, device=torch_device) # Ensure usage of flash attention in torch 2.0 with sdp_kernel(enable_flash=True, enable_math=False, enable_mem_efficient=False): image = pipe(**inputs).images assert image.shape == (1, 64, 64, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.1845, 0.1371, 0.1211, 0.2035, 0.1954, 0.1323, 0.1773, 0.1593, 0.1314]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 @require_torch_2 def test_consistency_model_cd_onestep_flash_attn(self): unet = UNet2DModel.from_pretrained("diffusers/consistency_models", subfolder="diffusers_cd_imagenet64_l2") scheduler = CMStochasticIterativeScheduler( num_train_timesteps=40, sigma_min=0.002, sigma_max=80.0, ) pipe = ConsistencyModelPipeline(unet=unet, scheduler=scheduler) pipe.to(torch_device=torch_device, torch_dtype=torch.float16) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs(get_fixed_latents=True, device=torch_device) inputs["num_inference_steps"] = 1 inputs["timesteps"] = None # Ensure usage of flash attention in torch 2.0 with sdp_kernel(enable_flash=True, enable_math=False, enable_mem_efficient=False): image = pipe(**inputs).images assert image.shape == (1, 64, 64, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.1623, 0.2009, 0.2387, 0.1731, 0.1168, 0.1202, 0.2031, 0.1327, 0.2447]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3
diffusers/tests/pipelines/consistency_models/test_consistency_models.py/0
{ "file_path": "diffusers/tests/pipelines/consistency_models/test_consistency_models.py", "repo_id": "diffusers", "token_count": 4999 }
132
import tempfile import numpy as np import torch from transformers import AutoTokenizer, T5EncoderModel from diffusers import DDPMScheduler, UNet2DConditionModel from diffusers.models.attention_processor import AttnAddedKVProcessor from diffusers.pipelines.deepfloyd_if import IFWatermarker from diffusers.utils.testing_utils import torch_device from ..test_pipelines_common import to_np # WARN: the hf-internal-testing/tiny-random-t5 text encoder has some non-determinism in the `save_load` tests. class IFPipelineTesterMixin: def _get_dummy_components(self): torch.manual_seed(0) text_encoder = T5EncoderModel.from_pretrained("hf-internal-testing/tiny-random-t5") torch.manual_seed(0) tokenizer = AutoTokenizer.from_pretrained("hf-internal-testing/tiny-random-t5") torch.manual_seed(0) unet = UNet2DConditionModel( sample_size=32, layers_per_block=1, block_out_channels=[32, 64], down_block_types=[ "ResnetDownsampleBlock2D", "SimpleCrossAttnDownBlock2D", ], mid_block_type="UNetMidBlock2DSimpleCrossAttn", up_block_types=["SimpleCrossAttnUpBlock2D", "ResnetUpsampleBlock2D"], in_channels=3, out_channels=6, cross_attention_dim=32, encoder_hid_dim=32, attention_head_dim=8, addition_embed_type="text", addition_embed_type_num_heads=2, cross_attention_norm="group_norm", resnet_time_scale_shift="scale_shift", act_fn="gelu", ) unet.set_attn_processor(AttnAddedKVProcessor()) # For reproducibility tests torch.manual_seed(0) scheduler = DDPMScheduler( num_train_timesteps=1000, beta_schedule="squaredcos_cap_v2", beta_start=0.0001, beta_end=0.02, thresholding=True, dynamic_thresholding_ratio=0.95, sample_max_value=1.0, prediction_type="epsilon", variance_type="learned_range", ) torch.manual_seed(0) watermarker = IFWatermarker() return { "text_encoder": text_encoder, "tokenizer": tokenizer, "unet": unet, "scheduler": scheduler, "watermarker": watermarker, "safety_checker": None, "feature_extractor": None, } def _get_superresolution_dummy_components(self): torch.manual_seed(0) text_encoder = T5EncoderModel.from_pretrained("hf-internal-testing/tiny-random-t5") torch.manual_seed(0) tokenizer = AutoTokenizer.from_pretrained("hf-internal-testing/tiny-random-t5") torch.manual_seed(0) unet = UNet2DConditionModel( sample_size=32, layers_per_block=[1, 2], block_out_channels=[32, 64], down_block_types=[ "ResnetDownsampleBlock2D", "SimpleCrossAttnDownBlock2D", ], mid_block_type="UNetMidBlock2DSimpleCrossAttn", up_block_types=["SimpleCrossAttnUpBlock2D", "ResnetUpsampleBlock2D"], in_channels=6, out_channels=6, cross_attention_dim=32, encoder_hid_dim=32, attention_head_dim=8, addition_embed_type="text", addition_embed_type_num_heads=2, cross_attention_norm="group_norm", resnet_time_scale_shift="scale_shift", act_fn="gelu", class_embed_type="timestep", mid_block_scale_factor=1.414, time_embedding_act_fn="gelu", time_embedding_dim=32, ) unet.set_attn_processor(AttnAddedKVProcessor()) # For reproducibility tests torch.manual_seed(0) scheduler = DDPMScheduler( num_train_timesteps=1000, beta_schedule="squaredcos_cap_v2", beta_start=0.0001, beta_end=0.02, thresholding=True, dynamic_thresholding_ratio=0.95, sample_max_value=1.0, prediction_type="epsilon", variance_type="learned_range", ) torch.manual_seed(0) image_noising_scheduler = DDPMScheduler( num_train_timesteps=1000, beta_schedule="squaredcos_cap_v2", beta_start=0.0001, beta_end=0.02, ) torch.manual_seed(0) watermarker = IFWatermarker() return { "text_encoder": text_encoder, "tokenizer": tokenizer, "unet": unet, "scheduler": scheduler, "image_noising_scheduler": image_noising_scheduler, "watermarker": watermarker, "safety_checker": None, "feature_extractor": None, } # this test is modified from the base class because if pipelines set the text encoder # as optional with the intention that the user is allowed to encode the prompt once # and then pass the embeddings directly to the pipeline. The base class test uses # the unmodified arguments from `self.get_dummy_inputs` which will pass the unencoded # prompt to the pipeline when the text encoder is set to None, throwing an error. # So we make the test reflect the intended usage of setting the text encoder to None. def _test_save_load_optional_components(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(torch_device) prompt = inputs["prompt"] generator = inputs["generator"] num_inference_steps = inputs["num_inference_steps"] output_type = inputs["output_type"] if "image" in inputs: image = inputs["image"] else: image = None if "mask_image" in inputs: mask_image = inputs["mask_image"] else: mask_image = None if "original_image" in inputs: original_image = inputs["original_image"] else: original_image = None prompt_embeds, negative_prompt_embeds = pipe.encode_prompt(prompt) # inputs with prompt converted to embeddings inputs = { "prompt_embeds": prompt_embeds, "negative_prompt_embeds": negative_prompt_embeds, "generator": generator, "num_inference_steps": num_inference_steps, "output_type": output_type, } if image is not None: inputs["image"] = image if mask_image is not None: inputs["mask_image"] = mask_image if original_image is not None: inputs["original_image"] = original_image # set all optional components to None for optional_component in pipe._optional_components: setattr(pipe, optional_component, None) output = pipe(**inputs)[0] with tempfile.TemporaryDirectory() as tmpdir: pipe.save_pretrained(tmpdir) pipe_loaded = self.pipeline_class.from_pretrained(tmpdir) pipe_loaded.to(torch_device) pipe_loaded.set_progress_bar_config(disable=None) pipe_loaded.unet.set_attn_processor(AttnAddedKVProcessor()) # For reproducibility tests for optional_component in pipe._optional_components: self.assertTrue( getattr(pipe_loaded, optional_component) is None, f"`{optional_component}` did not stay set to None after loading.", ) inputs = self.get_dummy_inputs(torch_device) generator = inputs["generator"] num_inference_steps = inputs["num_inference_steps"] output_type = inputs["output_type"] # inputs with prompt converted to embeddings inputs = { "prompt_embeds": prompt_embeds, "negative_prompt_embeds": negative_prompt_embeds, "generator": generator, "num_inference_steps": num_inference_steps, "output_type": output_type, } if image is not None: inputs["image"] = image if mask_image is not None: inputs["mask_image"] = mask_image if original_image is not None: inputs["original_image"] = original_image output_loaded = pipe_loaded(**inputs)[0] max_diff = np.abs(to_np(output) - to_np(output_loaded)).max() self.assertLess(max_diff, 1e-4) # Modified from `PipelineTesterMixin` to set the attn processor as it's not serialized. # This should be handled in the base test and then this method can be removed. def _test_save_load_local(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(torch_device) output = pipe(**inputs)[0] with tempfile.TemporaryDirectory() as tmpdir: pipe.save_pretrained(tmpdir) pipe_loaded = self.pipeline_class.from_pretrained(tmpdir) pipe_loaded.to(torch_device) pipe_loaded.set_progress_bar_config(disable=None) pipe_loaded.unet.set_attn_processor(AttnAddedKVProcessor()) # For reproducibility tests inputs = self.get_dummy_inputs(torch_device) output_loaded = pipe_loaded(**inputs)[0] max_diff = np.abs(to_np(output) - to_np(output_loaded)).max() self.assertLess(max_diff, 1e-4)
diffusers/tests/pipelines/deepfloyd_if/__init__.py/0
{ "file_path": "diffusers/tests/pipelines/deepfloyd_if/__init__.py", "repo_id": "diffusers", "token_count": 4583 }
133
import gc import inspect import random import unittest import numpy as np import torch from transformers import CLIPTextConfig, CLIPTextModel, CLIPTokenizer from diffusers import ( AutoencoderKL, LatentConsistencyModelImg2ImgPipeline, LCMScheduler, UNet2DConditionModel, ) from diffusers.utils.testing_utils import ( enable_full_determinism, floats_tensor, load_image, require_torch_gpu, slow, torch_device, ) from ..pipeline_params import ( IMAGE_TO_IMAGE_IMAGE_PARAMS, TEXT_GUIDED_IMAGE_VARIATION_BATCH_PARAMS, TEXT_GUIDED_IMAGE_VARIATION_PARAMS, ) from ..test_pipelines_common import PipelineLatentTesterMixin, PipelineTesterMixin enable_full_determinism() class LatentConsistencyModelImg2ImgPipelineFastTests( PipelineLatentTesterMixin, PipelineTesterMixin, unittest.TestCase ): pipeline_class = LatentConsistencyModelImg2ImgPipeline params = TEXT_GUIDED_IMAGE_VARIATION_PARAMS - {"height", "width", "negative_prompt", "negative_prompt_embeds"} required_optional_params = PipelineTesterMixin.required_optional_params - {"latents", "negative_prompt"} batch_params = TEXT_GUIDED_IMAGE_VARIATION_BATCH_PARAMS image_params = IMAGE_TO_IMAGE_IMAGE_PARAMS image_latents_params = IMAGE_TO_IMAGE_IMAGE_PARAMS def get_dummy_components(self): torch.manual_seed(0) unet = UNet2DConditionModel( block_out_channels=(4, 8), layers_per_block=1, sample_size=32, in_channels=4, out_channels=4, down_block_types=("DownBlock2D", "CrossAttnDownBlock2D"), up_block_types=("CrossAttnUpBlock2D", "UpBlock2D"), cross_attention_dim=32, norm_num_groups=2, time_cond_proj_dim=32, ) scheduler = LCMScheduler( beta_start=0.00085, beta_end=0.012, beta_schedule="scaled_linear", clip_sample=False, set_alpha_to_one=False, ) torch.manual_seed(0) vae = AutoencoderKL( block_out_channels=[4, 8], in_channels=3, out_channels=3, down_block_types=["DownEncoderBlock2D", "DownEncoderBlock2D"], up_block_types=["UpDecoderBlock2D", "UpDecoderBlock2D"], latent_channels=4, norm_num_groups=2, ) torch.manual_seed(0) text_encoder_config = CLIPTextConfig( bos_token_id=0, eos_token_id=2, hidden_size=32, intermediate_size=64, layer_norm_eps=1e-05, num_attention_heads=8, num_hidden_layers=3, pad_token_id=1, vocab_size=1000, ) text_encoder = CLIPTextModel(text_encoder_config) tokenizer = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") components = { "unet": unet, "scheduler": scheduler, "vae": vae, "text_encoder": text_encoder, "tokenizer": tokenizer, "safety_checker": None, "feature_extractor": None, "image_encoder": None, "requires_safety_checker": False, } return components def get_dummy_inputs(self, device, seed=0): image = floats_tensor((1, 3, 32, 32), rng=random.Random(seed)).to(device) image = image / 2 + 0.5 if str(device).startswith("mps"): generator = torch.manual_seed(seed) else: generator = torch.Generator(device=device).manual_seed(seed) inputs = { "prompt": "A painting of a squirrel eating a burger", "image": image, "generator": generator, "num_inference_steps": 2, "guidance_scale": 6.0, "output_type": "np", } return inputs def test_lcm_onestep(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) inputs["num_inference_steps"] = 1 output = pipe(**inputs) image = output.images assert image.shape == (1, 32, 32, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.4388, 0.3717, 0.2202, 0.7213, 0.6370, 0.3664, 0.5815, 0.6080, 0.4977]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_lcm_multistep(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) output = pipe(**inputs) image = output.images assert image.shape == (1, 32, 32, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.4150, 0.3719, 0.2479, 0.6333, 0.6024, 0.3778, 0.5036, 0.5420, 0.4678]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_lcm_custom_timesteps(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) del inputs["num_inference_steps"] inputs["timesteps"] = [999, 499] output = pipe(**inputs) image = output.images assert image.shape == (1, 32, 32, 3) image_slice = image[0, -3:, -3:, -1] expected_slice = np.array([0.3994, 0.3471, 0.2540, 0.7030, 0.6193, 0.3645, 0.5777, 0.5850, 0.4965]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_inference_batch_single_identical(self): super().test_inference_batch_single_identical(expected_max_diff=5e-4) # override default test because the final latent variable is "denoised" instead of "latents" def test_callback_inputs(self): sig = inspect.signature(self.pipeline_class.__call__) if not ("callback_on_step_end_tensor_inputs" in sig.parameters and "callback_on_step_end" in sig.parameters): return components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) self.assertTrue( hasattr(pipe, "_callback_tensor_inputs"), f" {self.pipeline_class} should have `_callback_tensor_inputs` that defines a list of tensor variables its callback function can use as inputs", ) def callback_inputs_test(pipe, i, t, callback_kwargs): missing_callback_inputs = set() for v in pipe._callback_tensor_inputs: if v not in callback_kwargs: missing_callback_inputs.add(v) self.assertTrue( len(missing_callback_inputs) == 0, f"Missing callback tensor inputs: {missing_callback_inputs}" ) last_i = pipe.num_timesteps - 1 if i == last_i: callback_kwargs["denoised"] = torch.zeros_like(callback_kwargs["denoised"]) return callback_kwargs inputs = self.get_dummy_inputs(torch_device) inputs["callback_on_step_end"] = callback_inputs_test inputs["callback_on_step_end_tensor_inputs"] = pipe._callback_tensor_inputs inputs["output_type"] = "latent" output = pipe(**inputs)[0] assert output.abs().sum() == 0 @slow @require_torch_gpu class LatentConsistencyModelImg2ImgPipelineSlowTests(unittest.TestCase): def setUp(self): gc.collect() torch.cuda.empty_cache() def get_inputs(self, device, generator_device="cpu", dtype=torch.float32, seed=0): generator = torch.Generator(device=generator_device).manual_seed(seed) latents = np.random.RandomState(seed).standard_normal((1, 4, 64, 64)) latents = torch.from_numpy(latents).to(device=device, dtype=dtype) init_image = load_image( "https://huggingface.co/datasets/diffusers/test-arrays/resolve/main" "/stable_diffusion_img2img/sketch-mountains-input.png" ) init_image = init_image.resize((512, 512)) inputs = { "prompt": "a photograph of an astronaut riding a horse", "latents": latents, "generator": generator, "num_inference_steps": 3, "guidance_scale": 7.5, "output_type": "np", "image": init_image, } return inputs def test_lcm_onestep(self): pipe = LatentConsistencyModelImg2ImgPipeline.from_pretrained( "SimianLuo/LCM_Dreamshaper_v7", safety_checker=None ) pipe.scheduler = LCMScheduler.from_config(pipe.scheduler.config) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs(torch_device) inputs["num_inference_steps"] = 1 image = pipe(**inputs).images assert image.shape == (1, 512, 512, 3) image_slice = image[0, -3:, -3:, -1].flatten() expected_slice = np.array([0.1950, 0.1961, 0.2308, 0.1786, 0.1837, 0.2320, 0.1898, 0.1885, 0.2309]) assert np.abs(image_slice - expected_slice).max() < 1e-3 def test_lcm_multistep(self): pipe = LatentConsistencyModelImg2ImgPipeline.from_pretrained( "SimianLuo/LCM_Dreamshaper_v7", safety_checker=None ) pipe.scheduler = LCMScheduler.from_config(pipe.scheduler.config) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs(torch_device) image = pipe(**inputs).images assert image.shape == (1, 512, 512, 3) image_slice = image[0, -3:, -3:, -1].flatten() expected_slice = np.array([0.3756, 0.3816, 0.3767, 0.3718, 0.3739, 0.3735, 0.3863, 0.3803, 0.3563]) assert np.abs(image_slice - expected_slice).max() < 1e-3
diffusers/tests/pipelines/latent_consistency_models/test_latent_consistency_models_img2img.py/0
{ "file_path": "diffusers/tests/pipelines/latent_consistency_models/test_latent_consistency_models_img2img.py", "repo_id": "diffusers", "token_count": 4946 }
134
# coding=utf-8 # Copyright 2023 HuggingFace Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import gc import random import tempfile import unittest import numpy as np import torch from transformers import CLIPTextConfig, CLIPTextModel, CLIPTokenizer from diffusers import AutoencoderKL, DDIMScheduler, LMSDiscreteScheduler, PNDMScheduler, UNet2DConditionModel from diffusers.pipelines.semantic_stable_diffusion import SemanticStableDiffusionPipeline as StableDiffusionPipeline from diffusers.utils.testing_utils import ( enable_full_determinism, floats_tensor, nightly, require_torch_gpu, torch_device, ) enable_full_determinism() class SafeDiffusionPipelineFastTests(unittest.TestCase): def tearDown(self): # clean up the VRAM after each test super().tearDown() gc.collect() torch.cuda.empty_cache() @property def dummy_image(self): batch_size = 1 num_channels = 3 sizes = (32, 32) image = floats_tensor((batch_size, num_channels) + sizes, rng=random.Random(0)).to(torch_device) return image @property def dummy_cond_unet(self): torch.manual_seed(0) model = UNet2DConditionModel( block_out_channels=(32, 64), layers_per_block=2, sample_size=32, in_channels=4, out_channels=4, down_block_types=("DownBlock2D", "CrossAttnDownBlock2D"), up_block_types=("CrossAttnUpBlock2D", "UpBlock2D"), cross_attention_dim=32, ) return model @property def dummy_vae(self): torch.manual_seed(0) model = AutoencoderKL( block_out_channels=[32, 64], in_channels=3, out_channels=3, down_block_types=["DownEncoderBlock2D", "DownEncoderBlock2D"], up_block_types=["UpDecoderBlock2D", "UpDecoderBlock2D"], latent_channels=4, ) return model @property def dummy_text_encoder(self): torch.manual_seed(0) config = CLIPTextConfig( bos_token_id=0, eos_token_id=2, hidden_size=32, intermediate_size=37, layer_norm_eps=1e-05, num_attention_heads=4, num_hidden_layers=5, pad_token_id=1, vocab_size=1000, ) return CLIPTextModel(config) @property def dummy_extractor(self): def extract(*args, **kwargs): class Out: def __init__(self): self.pixel_values = torch.ones([0]) def to(self, device): self.pixel_values.to(device) return self return Out() return extract def test_semantic_diffusion_ddim(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator unet = self.dummy_cond_unet scheduler = DDIMScheduler( beta_start=0.00085, beta_end=0.012, beta_schedule="scaled_linear", clip_sample=False, set_alpha_to_one=False, ) vae = self.dummy_vae bert = self.dummy_text_encoder tokenizer = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") # make sure here that pndm scheduler skips prk sd_pipe = StableDiffusionPipeline( unet=unet, scheduler=scheduler, vae=vae, text_encoder=bert, tokenizer=tokenizer, safety_checker=None, feature_extractor=self.dummy_extractor, ) sd_pipe = sd_pipe.to(device) sd_pipe.set_progress_bar_config(disable=None) prompt = "A painting of a squirrel eating a burger" generator = torch.Generator(device=device).manual_seed(0) output = sd_pipe([prompt], generator=generator, guidance_scale=6.0, num_inference_steps=2, output_type="np") image = output.images generator = torch.Generator(device=device).manual_seed(0) image_from_tuple = sd_pipe( [prompt], generator=generator, guidance_scale=6.0, num_inference_steps=2, output_type="np", return_dict=False, )[0] image_slice = image[0, -3:, -3:, -1] image_from_tuple_slice = image_from_tuple[0, -3:, -3:, -1] assert image.shape == (1, 64, 64, 3) expected_slice = np.array([0.5753, 0.6114, 0.5001, 0.5034, 0.5470, 0.4729, 0.4971, 0.4867, 0.4867]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 assert np.abs(image_from_tuple_slice.flatten() - expected_slice).max() < 1e-2 def test_semantic_diffusion_pndm(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator unet = self.dummy_cond_unet scheduler = PNDMScheduler(skip_prk_steps=True) vae = self.dummy_vae bert = self.dummy_text_encoder tokenizer = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") # make sure here that pndm scheduler skips prk sd_pipe = StableDiffusionPipeline( unet=unet, scheduler=scheduler, vae=vae, text_encoder=bert, tokenizer=tokenizer, safety_checker=None, feature_extractor=self.dummy_extractor, ) sd_pipe = sd_pipe.to(device) sd_pipe.set_progress_bar_config(disable=None) prompt = "A painting of a squirrel eating a burger" generator = torch.Generator(device=device).manual_seed(0) output = sd_pipe([prompt], generator=generator, guidance_scale=6.0, num_inference_steps=2, output_type="np") image = output.images generator = torch.Generator(device=device).manual_seed(0) image_from_tuple = sd_pipe( [prompt], generator=generator, guidance_scale=6.0, num_inference_steps=2, output_type="np", return_dict=False, )[0] image_slice = image[0, -3:, -3:, -1] image_from_tuple_slice = image_from_tuple[0, -3:, -3:, -1] assert image.shape == (1, 64, 64, 3) expected_slice = np.array([0.5122, 0.5712, 0.4825, 0.5053, 0.5646, 0.4769, 0.5179, 0.4894, 0.4994]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 assert np.abs(image_from_tuple_slice.flatten() - expected_slice).max() < 1e-2 def test_semantic_diffusion_no_safety_checker(self): pipe = StableDiffusionPipeline.from_pretrained( "hf-internal-testing/tiny-stable-diffusion-lms-pipe", safety_checker=None ) assert isinstance(pipe, StableDiffusionPipeline) assert isinstance(pipe.scheduler, LMSDiscreteScheduler) assert pipe.safety_checker is None image = pipe("example prompt", num_inference_steps=2).images[0] assert image is not None # check that there's no error when saving a pipeline with one of the models being None with tempfile.TemporaryDirectory() as tmpdirname: pipe.save_pretrained(tmpdirname) pipe = StableDiffusionPipeline.from_pretrained(tmpdirname) # sanity check that the pipeline still works assert pipe.safety_checker is None image = pipe("example prompt", num_inference_steps=2).images[0] assert image is not None @unittest.skipIf(torch_device != "cuda", "This test requires a GPU") def test_semantic_diffusion_fp16(self): """Test that stable diffusion works with fp16""" unet = self.dummy_cond_unet scheduler = PNDMScheduler(skip_prk_steps=True) vae = self.dummy_vae bert = self.dummy_text_encoder tokenizer = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") # put models in fp16 unet = unet.half() vae = vae.half() bert = bert.half() # make sure here that pndm scheduler skips prk sd_pipe = StableDiffusionPipeline( unet=unet, scheduler=scheduler, vae=vae, text_encoder=bert, tokenizer=tokenizer, safety_checker=None, feature_extractor=self.dummy_extractor, ) sd_pipe = sd_pipe.to(torch_device) sd_pipe.set_progress_bar_config(disable=None) prompt = "A painting of a squirrel eating a burger" image = sd_pipe([prompt], num_inference_steps=2, output_type="np").images assert image.shape == (1, 64, 64, 3) @nightly @require_torch_gpu class SemanticDiffusionPipelineIntegrationTests(unittest.TestCase): def tearDown(self): # clean up the VRAM after each test super().tearDown() gc.collect() torch.cuda.empty_cache() def test_positive_guidance(self): torch_device = "cuda" pipe = StableDiffusionPipeline.from_pretrained("runwayml/stable-diffusion-v1-5") pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) prompt = "a photo of a cat" edit = { "editing_prompt": ["sunglasses"], "reverse_editing_direction": [False], "edit_warmup_steps": 10, "edit_guidance_scale": 6, "edit_threshold": 0.95, "edit_momentum_scale": 0.5, "edit_mom_beta": 0.6, } seed = 3 guidance_scale = 7 # no sega enabled generator = torch.Generator(torch_device) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.34673113, 0.38492733, 0.37597352, 0.34086335, 0.35650748, 0.35579205, 0.3384763, 0.34340236, 0.3573271, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 # with sega enabled # generator = torch.manual_seed(seed) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, **edit, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.41887826, 0.37728766, 0.30138272, 0.41416335, 0.41664985, 0.36283392, 0.36191246, 0.43364465, 0.43001732, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 def test_negative_guidance(self): torch_device = "cuda" pipe = StableDiffusionPipeline.from_pretrained("runwayml/stable-diffusion-v1-5") pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) prompt = "an image of a crowded boulevard, realistic, 4k" edit = { "editing_prompt": "crowd, crowded, people", "reverse_editing_direction": True, "edit_warmup_steps": 10, "edit_guidance_scale": 8.3, "edit_threshold": 0.9, "edit_momentum_scale": 0.5, "edit_mom_beta": 0.6, } seed = 9 guidance_scale = 7 # no sega enabled generator = torch.Generator(torch_device) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.43497998, 0.91814065, 0.7540739, 0.55580205, 0.8467265, 0.5389691, 0.62574506, 0.58897763, 0.50926757, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 # with sega enabled # generator = torch.manual_seed(seed) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, **edit, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.3089719, 0.30500144, 0.29016042, 0.30630964, 0.325687, 0.29419225, 0.2908091, 0.28723598, 0.27696294, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 def test_multi_cond_guidance(self): torch_device = "cuda" pipe = StableDiffusionPipeline.from_pretrained("runwayml/stable-diffusion-v1-5") pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) prompt = "a castle next to a river" edit = { "editing_prompt": ["boat on a river, boat", "monet, impression, sunrise"], "reverse_editing_direction": False, "edit_warmup_steps": [15, 18], "edit_guidance_scale": 6, "edit_threshold": [0.9, 0.8], "edit_momentum_scale": 0.5, "edit_mom_beta": 0.6, } seed = 48 guidance_scale = 7 # no sega enabled generator = torch.Generator(torch_device) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.75163555, 0.76037145, 0.61785, 0.9189673, 0.8627701, 0.85189694, 0.8512813, 0.87012076, 0.8312857, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 # with sega enabled # generator = torch.manual_seed(seed) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, **edit, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.73553365, 0.7537271, 0.74341905, 0.66480356, 0.6472925, 0.63039416, 0.64812905, 0.6749717, 0.6517102, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 def test_guidance_fp16(self): torch_device = "cuda" pipe = StableDiffusionPipeline.from_pretrained("runwayml/stable-diffusion-v1-5", torch_dtype=torch.float16) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) prompt = "a photo of a cat" edit = { "editing_prompt": ["sunglasses"], "reverse_editing_direction": [False], "edit_warmup_steps": 10, "edit_guidance_scale": 6, "edit_threshold": 0.95, "edit_momentum_scale": 0.5, "edit_mom_beta": 0.6, } seed = 3 guidance_scale = 7 # no sega enabled generator = torch.Generator(torch_device) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.34887695, 0.3876953, 0.375, 0.34423828, 0.3581543, 0.35717773, 0.3383789, 0.34570312, 0.359375, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 # with sega enabled # generator = torch.manual_seed(seed) generator.manual_seed(seed) output = pipe( [prompt], generator=generator, guidance_scale=guidance_scale, num_inference_steps=50, output_type="np", width=512, height=512, **edit, ) image = output.images image_slice = image[0, -3:, -3:, -1] expected_slice = [ 0.42285156, 0.36914062, 0.29077148, 0.42041016, 0.41918945, 0.35498047, 0.3618164, 0.4423828, 0.43115234, ] assert image.shape == (1, 512, 512, 3) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2
diffusers/tests/pipelines/semantic_stable_diffusion/test_semantic_diffusion.py/0
{ "file_path": "diffusers/tests/pipelines/semantic_stable_diffusion/test_semantic_diffusion.py", "repo_id": "diffusers", "token_count": 9605 }
135
# coding=utf-8 # Copyright 2023 HuggingFace Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import gc import random import tempfile import unittest import numpy as np import torch from PIL import Image from transformers import ( CLIPTextConfig, CLIPTextModel, CLIPTokenizer, DPTConfig, DPTFeatureExtractor, DPTForDepthEstimation, ) from diffusers import ( AutoencoderKL, DDIMScheduler, DPMSolverMultistepScheduler, LMSDiscreteScheduler, PNDMScheduler, StableDiffusionDepth2ImgPipeline, UNet2DConditionModel, ) from diffusers.utils import is_accelerate_available, is_accelerate_version from diffusers.utils.testing_utils import ( enable_full_determinism, floats_tensor, load_image, load_numpy, nightly, require_torch_gpu, skip_mps, slow, torch_device, ) from ..pipeline_params import ( IMAGE_TO_IMAGE_IMAGE_PARAMS, TEXT_GUIDED_IMAGE_VARIATION_BATCH_PARAMS, TEXT_GUIDED_IMAGE_VARIATION_PARAMS, TEXT_TO_IMAGE_CALLBACK_CFG_PARAMS, TEXT_TO_IMAGE_IMAGE_PARAMS, ) from ..test_pipelines_common import PipelineKarrasSchedulerTesterMixin, PipelineLatentTesterMixin, PipelineTesterMixin enable_full_determinism() @skip_mps class StableDiffusionDepth2ImgPipelineFastTests( PipelineLatentTesterMixin, PipelineKarrasSchedulerTesterMixin, PipelineTesterMixin, unittest.TestCase ): pipeline_class = StableDiffusionDepth2ImgPipeline test_save_load_optional_components = False params = TEXT_GUIDED_IMAGE_VARIATION_PARAMS - {"height", "width"} required_optional_params = PipelineTesterMixin.required_optional_params - {"latents"} batch_params = TEXT_GUIDED_IMAGE_VARIATION_BATCH_PARAMS image_params = IMAGE_TO_IMAGE_IMAGE_PARAMS image_latents_params = TEXT_TO_IMAGE_IMAGE_PARAMS callback_cfg_params = TEXT_TO_IMAGE_CALLBACK_CFG_PARAMS.union({"depth_mask"}) def get_dummy_components(self): torch.manual_seed(0) unet = UNet2DConditionModel( block_out_channels=(32, 64), layers_per_block=2, sample_size=32, in_channels=5, out_channels=4, down_block_types=("DownBlock2D", "CrossAttnDownBlock2D"), up_block_types=("CrossAttnUpBlock2D", "UpBlock2D"), cross_attention_dim=32, attention_head_dim=(2, 4), use_linear_projection=True, ) scheduler = PNDMScheduler(skip_prk_steps=True) torch.manual_seed(0) vae = AutoencoderKL( block_out_channels=[32, 64], in_channels=3, out_channels=3, down_block_types=["DownEncoderBlock2D", "DownEncoderBlock2D"], up_block_types=["UpDecoderBlock2D", "UpDecoderBlock2D"], latent_channels=4, ) torch.manual_seed(0) text_encoder_config = CLIPTextConfig( bos_token_id=0, eos_token_id=2, hidden_size=32, intermediate_size=37, layer_norm_eps=1e-05, num_attention_heads=4, num_hidden_layers=5, pad_token_id=1, vocab_size=1000, ) text_encoder = CLIPTextModel(text_encoder_config) tokenizer = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") backbone_config = { "global_padding": "same", "layer_type": "bottleneck", "depths": [3, 4, 9], "out_features": ["stage1", "stage2", "stage3"], "embedding_dynamic_padding": True, "hidden_sizes": [96, 192, 384, 768], "num_groups": 2, } depth_estimator_config = DPTConfig( image_size=32, patch_size=16, num_channels=3, hidden_size=32, num_hidden_layers=4, backbone_out_indices=(0, 1, 2, 3), num_attention_heads=4, intermediate_size=37, hidden_act="gelu", hidden_dropout_prob=0.1, attention_probs_dropout_prob=0.1, is_decoder=False, initializer_range=0.02, is_hybrid=True, backbone_config=backbone_config, backbone_featmap_shape=[1, 384, 24, 24], ) depth_estimator = DPTForDepthEstimation(depth_estimator_config).eval() feature_extractor = DPTFeatureExtractor.from_pretrained( "hf-internal-testing/tiny-random-DPTForDepthEstimation" ) components = { "unet": unet, "scheduler": scheduler, "vae": vae, "text_encoder": text_encoder, "tokenizer": tokenizer, "depth_estimator": depth_estimator, "feature_extractor": feature_extractor, } return components def get_dummy_inputs(self, device, seed=0): image = floats_tensor((1, 3, 32, 32), rng=random.Random(seed)) image = image.cpu().permute(0, 2, 3, 1)[0] image = Image.fromarray(np.uint8(image)).convert("RGB").resize((32, 32)) if str(device).startswith("mps"): generator = torch.manual_seed(seed) else: generator = torch.Generator(device=device).manual_seed(seed) inputs = { "prompt": "A painting of a squirrel eating a burger", "image": image, "generator": generator, "num_inference_steps": 2, "guidance_scale": 6.0, "output_type": "numpy", } return inputs def test_save_load_local(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(torch_device) output = pipe(**inputs)[0] with tempfile.TemporaryDirectory() as tmpdir: pipe.save_pretrained(tmpdir) pipe_loaded = self.pipeline_class.from_pretrained(tmpdir) pipe_loaded.to(torch_device) pipe_loaded.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(torch_device) output_loaded = pipe_loaded(**inputs)[0] max_diff = np.abs(output - output_loaded).max() self.assertLess(max_diff, 1e-4) @unittest.skipIf(torch_device != "cuda", reason="float16 requires CUDA") def test_save_load_float16(self): components = self.get_dummy_components() for name, module in components.items(): if hasattr(module, "half"): components[name] = module.to(torch_device).half() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(torch_device) output = pipe(**inputs)[0] with tempfile.TemporaryDirectory() as tmpdir: pipe.save_pretrained(tmpdir) pipe_loaded = self.pipeline_class.from_pretrained(tmpdir, torch_dtype=torch.float16) pipe_loaded.to(torch_device) pipe_loaded.set_progress_bar_config(disable=None) for name, component in pipe_loaded.components.items(): if hasattr(component, "dtype"): self.assertTrue( component.dtype == torch.float16, f"`{name}.dtype` switched from `float16` to {component.dtype} after loading.", ) inputs = self.get_dummy_inputs(torch_device) output_loaded = pipe_loaded(**inputs)[0] max_diff = np.abs(output - output_loaded).max() self.assertLess(max_diff, 2e-2, "The output of the fp16 pipeline changed after saving and loading.") @unittest.skipIf(torch_device != "cuda", reason="float16 requires CUDA") def test_float16_inference(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) for name, module in components.items(): if hasattr(module, "half"): components[name] = module.half() pipe_fp16 = self.pipeline_class(**components) pipe_fp16.to(torch_device) pipe_fp16.set_progress_bar_config(disable=None) output = pipe(**self.get_dummy_inputs(torch_device))[0] output_fp16 = pipe_fp16(**self.get_dummy_inputs(torch_device))[0] max_diff = np.abs(output - output_fp16).max() self.assertLess(max_diff, 1.3e-2, "The outputs of the fp16 and fp32 pipelines are too different.") @unittest.skipIf( torch_device != "cuda" or not is_accelerate_available() or is_accelerate_version("<", "0.14.0"), reason="CPU offload is only available with CUDA and `accelerate v0.14.0` or higher", ) def test_cpu_offload_forward_pass(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(torch_device) output_without_offload = pipe(**inputs)[0] pipe.enable_sequential_cpu_offload() inputs = self.get_dummy_inputs(torch_device) output_with_offload = pipe(**inputs)[0] max_diff = np.abs(output_with_offload - output_without_offload).max() self.assertLess(max_diff, 1e-4, "CPU offloading should not affect the inference results") def test_dict_tuple_outputs_equivalent(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) output = pipe(**self.get_dummy_inputs(torch_device))[0] output_tuple = pipe(**self.get_dummy_inputs(torch_device), return_dict=False)[0] max_diff = np.abs(output - output_tuple).max() self.assertLess(max_diff, 1e-4) def test_progress_bar(self): super().test_progress_bar() def test_stable_diffusion_depth2img_default_case(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = StableDiffusionDepth2ImgPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) image = pipe(**inputs).images image_slice = image[0, -3:, -3:, -1] assert image.shape == (1, 32, 32, 3) if torch_device == "mps": expected_slice = np.array([0.6071, 0.5035, 0.4378, 0.5776, 0.5753, 0.4316, 0.4513, 0.5263, 0.4546]) else: expected_slice = np.array([0.5435, 0.4992, 0.3783, 0.4411, 0.5842, 0.4654, 0.3786, 0.5077, 0.4655]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_stable_diffusion_depth2img_negative_prompt(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = StableDiffusionDepth2ImgPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) negative_prompt = "french fries" output = pipe(**inputs, negative_prompt=negative_prompt) image = output.images image_slice = image[0, -3:, -3:, -1] assert image.shape == (1, 32, 32, 3) if torch_device == "mps": expected_slice = np.array([0.6296, 0.5125, 0.3890, 0.4456, 0.5955, 0.4621, 0.3810, 0.5310, 0.4626]) else: expected_slice = np.array([0.6012, 0.4507, 0.3769, 0.4121, 0.5566, 0.4585, 0.3803, 0.5045, 0.4631]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_stable_diffusion_depth2img_multiple_init_images(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = StableDiffusionDepth2ImgPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) inputs["prompt"] = [inputs["prompt"]] * 2 inputs["image"] = 2 * [inputs["image"]] image = pipe(**inputs).images image_slice = image[-1, -3:, -3:, -1] assert image.shape == (2, 32, 32, 3) if torch_device == "mps": expected_slice = np.array([0.6501, 0.5150, 0.4939, 0.6688, 0.5437, 0.5758, 0.5115, 0.4406, 0.4551]) else: expected_slice = np.array([0.6557, 0.6214, 0.6254, 0.5775, 0.4785, 0.5949, 0.5904, 0.4785, 0.4730]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 def test_stable_diffusion_depth2img_pil(self): device = "cpu" # ensure determinism for the device-dependent torch.Generator components = self.get_dummy_components() pipe = StableDiffusionDepth2ImgPipeline(**components) pipe = pipe.to(device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(device) image = pipe(**inputs).images image_slice = image[0, -3:, -3:, -1] if torch_device == "mps": expected_slice = np.array([0.53232, 0.47015, 0.40868, 0.45651, 0.4891, 0.4668, 0.4287, 0.48822, 0.47439]) else: expected_slice = np.array([0.5435, 0.4992, 0.3783, 0.4411, 0.5842, 0.4654, 0.3786, 0.5077, 0.4655]) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-3 @skip_mps def test_attention_slicing_forward_pass(self): return super().test_attention_slicing_forward_pass() def test_inference_batch_single_identical(self): super().test_inference_batch_single_identical(expected_max_diff=7e-3) @slow @require_torch_gpu class StableDiffusionDepth2ImgPipelineSlowTests(unittest.TestCase): def tearDown(self): super().tearDown() gc.collect() torch.cuda.empty_cache() def get_inputs(self, device="cpu", dtype=torch.float32, seed=0): generator = torch.Generator(device=device).manual_seed(seed) init_image = load_image( "https://huggingface.co/datasets/hf-internal-testing/diffusers-images/resolve/main/depth2img/two_cats.png" ) inputs = { "prompt": "two tigers", "image": init_image, "generator": generator, "num_inference_steps": 3, "strength": 0.75, "guidance_scale": 7.5, "output_type": "numpy", } return inputs def test_stable_diffusion_depth2img_pipeline_default(self): pipe = StableDiffusionDepth2ImgPipeline.from_pretrained( "stabilityai/stable-diffusion-2-depth", safety_checker=None ) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) pipe.enable_attention_slicing() inputs = self.get_inputs() image = pipe(**inputs).images image_slice = image[0, 253:256, 253:256, -1].flatten() assert image.shape == (1, 480, 640, 3) expected_slice = np.array([0.5435, 0.4992, 0.3783, 0.4411, 0.5842, 0.4654, 0.3786, 0.5077, 0.4655]) assert np.abs(expected_slice - image_slice).max() < 6e-1 def test_stable_diffusion_depth2img_pipeline_k_lms(self): pipe = StableDiffusionDepth2ImgPipeline.from_pretrained( "stabilityai/stable-diffusion-2-depth", safety_checker=None ) pipe.unet.set_default_attn_processor() pipe.scheduler = LMSDiscreteScheduler.from_config(pipe.scheduler.config) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) pipe.enable_attention_slicing() inputs = self.get_inputs() image = pipe(**inputs).images image_slice = image[0, 253:256, 253:256, -1].flatten() assert image.shape == (1, 480, 640, 3) expected_slice = np.array([0.6363, 0.6274, 0.6309, 0.6370, 0.6226, 0.6286, 0.6213, 0.6453, 0.6306]) assert np.abs(expected_slice - image_slice).max() < 8e-4 def test_stable_diffusion_depth2img_pipeline_ddim(self): pipe = StableDiffusionDepth2ImgPipeline.from_pretrained( "stabilityai/stable-diffusion-2-depth", safety_checker=None ) pipe.scheduler = DDIMScheduler.from_config(pipe.scheduler.config) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) pipe.enable_attention_slicing() inputs = self.get_inputs() image = pipe(**inputs).images image_slice = image[0, 253:256, 253:256, -1].flatten() assert image.shape == (1, 480, 640, 3) expected_slice = np.array([0.6424, 0.6524, 0.6249, 0.6041, 0.6634, 0.6420, 0.6522, 0.6555, 0.6436]) assert np.abs(expected_slice - image_slice).max() < 5e-4 def test_stable_diffusion_depth2img_intermediate_state(self): number_of_steps = 0 def callback_fn(step: int, timestep: int, latents: torch.FloatTensor) -> None: callback_fn.has_been_called = True nonlocal number_of_steps number_of_steps += 1 if step == 1: latents = latents.detach().cpu().numpy() assert latents.shape == (1, 4, 60, 80) latents_slice = latents[0, -3:, -3:, -1] expected_slice = np.array( [-0.7168, -1.5137, -0.1418, -2.9219, -2.7266, -2.4414, -2.1035, -3.0078, -1.7051] ) assert np.abs(latents_slice.flatten() - expected_slice).max() < 5e-2 elif step == 2: latents = latents.detach().cpu().numpy() assert latents.shape == (1, 4, 60, 80) latents_slice = latents[0, -3:, -3:, -1] expected_slice = np.array( [-0.7109, -1.5068, -0.1403, -2.9160, -2.7207, -2.4414, -2.1035, -3.0059, -1.7090] ) assert np.abs(latents_slice.flatten() - expected_slice).max() < 5e-2 callback_fn.has_been_called = False pipe = StableDiffusionDepth2ImgPipeline.from_pretrained( "stabilityai/stable-diffusion-2-depth", safety_checker=None, torch_dtype=torch.float16 ) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) pipe.enable_attention_slicing() inputs = self.get_inputs(dtype=torch.float16) pipe(**inputs, callback=callback_fn, callback_steps=1) assert callback_fn.has_been_called assert number_of_steps == 2 def test_stable_diffusion_pipeline_with_sequential_cpu_offloading(self): torch.cuda.empty_cache() torch.cuda.reset_max_memory_allocated() torch.cuda.reset_peak_memory_stats() pipe = StableDiffusionDepth2ImgPipeline.from_pretrained( "stabilityai/stable-diffusion-2-depth", safety_checker=None, torch_dtype=torch.float16 ) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) pipe.enable_attention_slicing(1) pipe.enable_sequential_cpu_offload() inputs = self.get_inputs(dtype=torch.float16) _ = pipe(**inputs) mem_bytes = torch.cuda.max_memory_allocated() # make sure that less than 2.9 GB is allocated assert mem_bytes < 2.9 * 10**9 @nightly @require_torch_gpu class StableDiffusionImg2ImgPipelineNightlyTests(unittest.TestCase): def tearDown(self): super().tearDown() gc.collect() torch.cuda.empty_cache() def get_inputs(self, device="cpu", dtype=torch.float32, seed=0): generator = torch.Generator(device=device).manual_seed(seed) init_image = load_image( "https://huggingface.co/datasets/hf-internal-testing/diffusers-images/resolve/main/depth2img/two_cats.png" ) inputs = { "prompt": "two tigers", "image": init_image, "generator": generator, "num_inference_steps": 3, "strength": 0.75, "guidance_scale": 7.5, "output_type": "numpy", } return inputs def test_depth2img_pndm(self): pipe = StableDiffusionDepth2ImgPipeline.from_pretrained("stabilityai/stable-diffusion-2-depth") pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs() image = pipe(**inputs).images[0] expected_image = load_numpy( "https://huggingface.co/datasets/diffusers/test-arrays/resolve/main" "/stable_diffusion_depth2img/stable_diffusion_2_0_pndm.npy" ) max_diff = np.abs(expected_image - image).max() assert max_diff < 1e-3 def test_depth2img_ddim(self): pipe = StableDiffusionDepth2ImgPipeline.from_pretrained("stabilityai/stable-diffusion-2-depth") pipe.scheduler = DDIMScheduler.from_config(pipe.scheduler.config) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs() image = pipe(**inputs).images[0] expected_image = load_numpy( "https://huggingface.co/datasets/diffusers/test-arrays/resolve/main" "/stable_diffusion_depth2img/stable_diffusion_2_0_ddim.npy" ) max_diff = np.abs(expected_image - image).max() assert max_diff < 1e-3 def test_img2img_lms(self): pipe = StableDiffusionDepth2ImgPipeline.from_pretrained("stabilityai/stable-diffusion-2-depth") pipe.scheduler = LMSDiscreteScheduler.from_config(pipe.scheduler.config) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs() image = pipe(**inputs).images[0] expected_image = load_numpy( "https://huggingface.co/datasets/diffusers/test-arrays/resolve/main" "/stable_diffusion_depth2img/stable_diffusion_2_0_lms.npy" ) max_diff = np.abs(expected_image - image).max() assert max_diff < 1e-3 def test_img2img_dpm(self): pipe = StableDiffusionDepth2ImgPipeline.from_pretrained("stabilityai/stable-diffusion-2-depth") pipe.scheduler = DPMSolverMultistepScheduler.from_config(pipe.scheduler.config) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_inputs() inputs["num_inference_steps"] = 30 image = pipe(**inputs).images[0] expected_image = load_numpy( "https://huggingface.co/datasets/diffusers/test-arrays/resolve/main" "/stable_diffusion_depth2img/stable_diffusion_2_0_dpm_multi.npy" ) max_diff = np.abs(expected_image - image).max() assert max_diff < 1e-3
diffusers/tests/pipelines/stable_diffusion_2/test_stable_diffusion_depth.py/0
{ "file_path": "diffusers/tests/pipelines/stable_diffusion_2/test_stable_diffusion_depth.py", "repo_id": "diffusers", "token_count": 11025 }
136
# coding=utf-8 # Copyright 2023 HuggingFace Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import gc import unittest import numpy as np import torch from diffusers import StableDiffusionXLKDiffusionPipeline from diffusers.utils.testing_utils import enable_full_determinism, require_torch_gpu, slow, torch_device enable_full_determinism() @slow @require_torch_gpu class StableDiffusionXLKPipelineIntegrationTests(unittest.TestCase): dtype = torch.float16 def tearDown(self): # clean up the VRAM after each test super().tearDown() gc.collect() torch.cuda.empty_cache() def test_stable_diffusion_xl(self): sd_pipe = StableDiffusionXLKDiffusionPipeline.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=self.dtype ) sd_pipe = sd_pipe.to(torch_device) sd_pipe.set_progress_bar_config(disable=None) sd_pipe.set_scheduler("sample_euler") prompt = "A painting of a squirrel eating a burger" generator = torch.manual_seed(0) output = sd_pipe( [prompt], generator=generator, guidance_scale=9.0, num_inference_steps=20, height=512, width=512, output_type="np", ) image = output.images image_slice = image[0, -3:, -3:, -1] assert image.shape == (1, 512, 512, 3) expected_slice = np.array( [0.79600024, 0.796546, 0.80682373, 0.79428387, 0.7905743, 0.8008807, 0.786183, 0.7835959, 0.797892] ) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 def test_stable_diffusion_karras_sigmas(self): sd_pipe = StableDiffusionXLKDiffusionPipeline.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=self.dtype ) sd_pipe = sd_pipe.to(torch_device) sd_pipe.set_progress_bar_config(disable=None) sd_pipe.set_scheduler("sample_dpmpp_2m") prompt = "A painting of a squirrel eating a burger" generator = torch.manual_seed(0) output = sd_pipe( [prompt], generator=generator, guidance_scale=7.5, num_inference_steps=15, output_type="np", use_karras_sigmas=True, height=512, width=512, ) image = output.images image_slice = image[0, -3:, -3:, -1] assert image.shape == (1, 512, 512, 3) expected_slice = np.array( [0.9506951, 0.9527786, 0.95309967, 0.9511477, 0.952523, 0.9515326, 0.9511933, 0.9480397, 0.94930184] ) assert np.abs(image_slice.flatten() - expected_slice).max() < 1e-2 def test_stable_diffusion_noise_sampler_seed(self): sd_pipe = StableDiffusionXLKDiffusionPipeline.from_pretrained( "stabilityai/stable-diffusion-xl-base-1.0", torch_dtype=self.dtype ) sd_pipe = sd_pipe.to(torch_device) sd_pipe.set_progress_bar_config(disable=None) sd_pipe.set_scheduler("sample_dpmpp_sde") prompt = "A painting of a squirrel eating a burger" seed = 0 images1 = sd_pipe( [prompt], generator=torch.manual_seed(seed), noise_sampler_seed=seed, guidance_scale=9.0, num_inference_steps=20, output_type="np", height=512, width=512, ).images images2 = sd_pipe( [prompt], generator=torch.manual_seed(seed), noise_sampler_seed=seed, guidance_scale=9.0, num_inference_steps=20, output_type="np", height=512, width=512, ).images assert images1.shape == (1, 512, 512, 3) assert images2.shape == (1, 512, 512, 3) assert np.abs(images1.flatten() - images2.flatten()).max() < 1e-2
diffusers/tests/pipelines/stable_diffusion_xl/test_stable_diffusion_xl_k_diffusion.py/0
{ "file_path": "diffusers/tests/pipelines/stable_diffusion_xl/test_stable_diffusion_xl_k_diffusion.py", "repo_id": "diffusers", "token_count": 2097 }
137
# coding=utf-8 # Copyright 2023 HuggingFace Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import contextlib import inspect import io import re import tempfile import unittest import numpy as np import torch from transformers import CLIPTextConfig, CLIPTextModel, CLIPTextModelWithProjection, CLIPTokenizer from diffusers import AutoencoderKL, DDIMScheduler, TextToVideoZeroSDXLPipeline, UNet2DConditionModel from diffusers.utils.import_utils import is_accelerate_available, is_accelerate_version from diffusers.utils.testing_utils import enable_full_determinism, nightly, require_torch_gpu, torch_device from ..pipeline_params import TEXT_TO_IMAGE_BATCH_PARAMS, TEXT_TO_IMAGE_IMAGE_PARAMS, TEXT_TO_IMAGE_PARAMS from ..test_pipelines_common import PipelineTesterMixin enable_full_determinism() def to_np(tensor): if isinstance(tensor, torch.Tensor): tensor = tensor.detach().cpu().numpy() return tensor class TextToVideoZeroSDXLPipelineFastTests(PipelineTesterMixin, unittest.TestCase): pipeline_class = TextToVideoZeroSDXLPipeline params = TEXT_TO_IMAGE_PARAMS batch_params = TEXT_TO_IMAGE_BATCH_PARAMS image_params = TEXT_TO_IMAGE_IMAGE_PARAMS image_latents_params = TEXT_TO_IMAGE_IMAGE_PARAMS generator_device = "cpu" def get_dummy_components(self, seed=0): torch.manual_seed(seed) unet = UNet2DConditionModel( block_out_channels=(2, 4), layers_per_block=2, sample_size=2, norm_num_groups=2, in_channels=4, out_channels=4, down_block_types=("DownBlock2D", "CrossAttnDownBlock2D"), up_block_types=("CrossAttnUpBlock2D", "UpBlock2D"), # SD2-specific config below attention_head_dim=(2, 4), use_linear_projection=True, addition_embed_type="text_time", addition_time_embed_dim=8, transformer_layers_per_block=(1, 2), projection_class_embeddings_input_dim=80, # 6 * 8 + 32 cross_attention_dim=64, ) scheduler = DDIMScheduler( num_train_timesteps=1000, beta_start=0.0001, beta_end=0.02, beta_schedule="linear", trained_betas=None, clip_sample=True, set_alpha_to_one=True, steps_offset=0, prediction_type="epsilon", thresholding=False, dynamic_thresholding_ratio=0.995, clip_sample_range=1.0, sample_max_value=1.0, timestep_spacing="leading", rescale_betas_zero_snr=False, ) torch.manual_seed(seed) vae = AutoencoderKL( block_out_channels=[32, 64], in_channels=3, out_channels=3, down_block_types=["DownEncoderBlock2D", "DownEncoderBlock2D"], up_block_types=["UpDecoderBlock2D", "UpDecoderBlock2D"], latent_channels=4, sample_size=128, ) torch.manual_seed(seed) text_encoder_config = CLIPTextConfig( bos_token_id=0, eos_token_id=2, hidden_size=32, intermediate_size=37, layer_norm_eps=1e-05, num_attention_heads=4, num_hidden_layers=5, pad_token_id=1, vocab_size=1000, # SD2-specific config below hidden_act="gelu", projection_dim=32, ) text_encoder = CLIPTextModel(text_encoder_config) tokenizer = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") text_encoder_2 = CLIPTextModelWithProjection(text_encoder_config) tokenizer_2 = CLIPTokenizer.from_pretrained("hf-internal-testing/tiny-random-clip") components = { "unet": unet, "scheduler": scheduler, "vae": vae, "text_encoder": text_encoder, "tokenizer": tokenizer, "text_encoder_2": text_encoder_2, "tokenizer_2": tokenizer_2, "image_encoder": None, "feature_extractor": None, } return components def get_dummy_inputs(self, device, seed=0): if str(device).startswith("mps"): generator = torch.manual_seed(seed) else: generator = torch.Generator(device=device).manual_seed(seed) inputs = { "prompt": "A panda dancing in Antarctica", "generator": generator, "num_inference_steps": 5, "t0": 1, "t1": 3, "height": 64, "width": 64, "video_length": 3, "output_type": "np", } return inputs def get_generator(self, device, seed=0): if str(device).startswith("mps"): generator = torch.manual_seed(seed) else: generator = torch.Generator(device=device).manual_seed(seed) return generator def test_text_to_video_zero_sdxl(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe = pipe.to(torch_device) inputs = self.get_dummy_inputs(self.generator_device) result = pipe(**inputs).images first_frame_slice = result[0, -3:, -3:, -1] last_frame_slice = result[-1, -3:, -3:, 0] expected_slice1 = np.array([0.48, 0.58, 0.53, 0.59, 0.50, 0.44, 0.60, 0.65, 0.52]) expected_slice2 = np.array([0.66, 0.49, 0.40, 0.70, 0.47, 0.51, 0.73, 0.65, 0.52]) assert np.abs(first_frame_slice.flatten() - expected_slice1).max() < 1e-2 assert np.abs(last_frame_slice.flatten() - expected_slice2).max() < 1e-2 @unittest.skip( reason="Cannot call `set_default_attn_processor` as this pipeline uses a specific attention processor." ) def test_attention_slicing_forward_pass(self): pass def test_cfg(self): sig = inspect.signature(self.pipeline_class.__call__) if "guidance_scale" not in sig.parameters: return components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(self.generator_device) inputs["guidance_scale"] = 1.0 out_no_cfg = pipe(**inputs)[0] inputs["guidance_scale"] = 7.5 out_cfg = pipe(**inputs)[0] assert out_cfg.shape == out_no_cfg.shape def test_dict_tuple_outputs_equivalent(self, expected_max_difference=1e-4): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) output = pipe(**self.get_dummy_inputs(self.generator_device))[0] output_tuple = pipe(**self.get_dummy_inputs(self.generator_device), return_dict=False)[0] max_diff = np.abs(to_np(output) - to_np(output_tuple)).max() self.assertLess(max_diff, expected_max_difference) @unittest.skipIf(torch_device != "cuda", reason="float16 requires CUDA") def test_float16_inference(self, expected_max_diff=5e-2): components = self.get_dummy_components() for name, module in components.items(): if hasattr(module, "half"): components[name] = module.to(torch_device).half() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) components = self.get_dummy_components() pipe_fp16 = self.pipeline_class(**components) pipe_fp16.to(torch_device, torch.float16) pipe_fp16.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(self.generator_device) # # Reset generator in case it is used inside dummy inputs if "generator" in inputs: inputs["generator"] = self.get_generator(self.generator_device) output = pipe(**inputs)[0] fp16_inputs = self.get_dummy_inputs(self.generator_device) # Reset generator in case it is used inside dummy inputs if "generator" in fp16_inputs: fp16_inputs["generator"] = self.get_generator(self.generator_device) output_fp16 = pipe_fp16(**fp16_inputs)[0] max_diff = np.abs(to_np(output) - to_np(output_fp16)).max() self.assertLess(max_diff, expected_max_diff, "The outputs of the fp16 and fp32 pipelines are too different.") @unittest.skip(reason="Batching needs to be properly figured out first for this pipeline.") def test_inference_batch_consistent(self): pass @unittest.skip( reason="Cannot call `set_default_attn_processor` as this pipeline uses a specific attention processor." ) def test_inference_batch_single_identical(self): pass @unittest.skipIf( torch_device != "cuda" or not is_accelerate_available() or is_accelerate_version("<", "0.17.0"), reason="CPU offload is only available with CUDA and `accelerate v0.17.0` or higher", ) def test_model_cpu_offload_forward_pass(self, expected_max_diff=2e-4): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe = pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(self.generator_device) output_without_offload = pipe(**inputs)[0] pipe.enable_model_cpu_offload() inputs = self.get_dummy_inputs(self.generator_device) output_with_offload = pipe(**inputs)[0] max_diff = np.abs(to_np(output_with_offload) - to_np(output_without_offload)).max() self.assertLess(max_diff, expected_max_diff, "CPU offloading should not affect the inference results") @unittest.skip(reason="`num_images_per_prompt` argument is not supported for this pipeline.") def test_pipeline_call_signature(self): pass def test_progress_bar(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.to(torch_device) inputs = self.get_dummy_inputs(self.generator_device) with io.StringIO() as stderr, contextlib.redirect_stderr(stderr): _ = pipe(**inputs) stderr = stderr.getvalue() # we can't calculate the number of progress steps beforehand e.g. for strength-dependent img2img, # so we just match "5" in "#####| 1/5 [00:01<00:00]" max_steps = re.search("/(.*?) ", stderr).group(1) self.assertTrue(max_steps is not None and len(max_steps) > 0) self.assertTrue( f"{max_steps}/{max_steps}" in stderr, "Progress bar should be enabled and stopped at the max step" ) pipe.set_progress_bar_config(disable=True) with io.StringIO() as stderr, contextlib.redirect_stderr(stderr): _ = pipe(**inputs) self.assertTrue(stderr.getvalue() == "", "Progress bar should be disabled") @unittest.skipIf(torch_device != "cuda", reason="float16 requires CUDA") def test_save_load_float16(self, expected_max_diff=1e-2): components = self.get_dummy_components() for name, module in components.items(): if hasattr(module, "half"): components[name] = module.to(torch_device).half() pipe = self.pipeline_class(**components) pipe.to(torch_device) pipe.set_progress_bar_config(disable=None) inputs = self.get_dummy_inputs(self.generator_device) output = pipe(**inputs)[0] with tempfile.TemporaryDirectory() as tmpdir: pipe.save_pretrained(tmpdir) pipe_loaded = self.pipeline_class.from_pretrained(tmpdir, torch_dtype=torch.float16) pipe_loaded.to(torch_device) pipe_loaded.set_progress_bar_config(disable=None) for name, component in pipe_loaded.components.items(): if hasattr(component, "dtype"): self.assertTrue( component.dtype == torch.float16, f"`{name}.dtype` switched from `float16` to {component.dtype} after loading.", ) inputs = self.get_dummy_inputs(self.generator_device) output_loaded = pipe_loaded(**inputs)[0] max_diff = np.abs(to_np(output) - to_np(output_loaded)).max() self.assertLess( max_diff, expected_max_diff, "The output of the fp16 pipeline changed after saving and loading." ) @unittest.skip( reason="Cannot call `set_default_attn_processor` as this pipeline uses a specific attention processor." ) def test_save_load_local(self): pass @unittest.skip( reason="Cannot call `set_default_attn_processor` as this pipeline uses a specific attention processor." ) def test_save_load_optional_components(self): pass @unittest.skip( reason="Cannot call `set_default_attn_processor` as this pipeline uses a specific attention processor." ) def test_sequential_cpu_offload_forward_pass(self): pass @unittest.skipIf(torch_device != "cuda", reason="CUDA and CPU are required to switch devices") def test_to_device(self): components = self.get_dummy_components() pipe = self.pipeline_class(**components) pipe.set_progress_bar_config(disable=None) pipe.to("cpu") model_devices = [component.device.type for component in components.values() if hasattr(component, "device")] self.assertTrue(all(device == "cpu" for device in model_devices)) output_cpu = pipe(**self.get_dummy_inputs("cpu"))[0] # generator set to cpu self.assertTrue(np.isnan(output_cpu).sum() == 0) pipe.to("cuda") model_devices = [component.device.type for component in components.values() if hasattr(component, "device")] self.assertTrue(all(device == "cuda" for device in model_devices)) output_cuda = pipe(**self.get_dummy_inputs("cpu"))[0] # generator set to cpu self.assertTrue(np.isnan(to_np(output_cuda)).sum() == 0) @unittest.skip( reason="Cannot call `set_default_attn_processor` as this pipeline uses a specific attention processor." ) def test_xformers_attention_forwardGenerator_pass(self): pass @nightly @require_torch_gpu class TextToVideoZeroSDXLPipelineSlowTests(unittest.TestCase): def test_full_model(self): model_id = "stabilityai/stable-diffusion-xl-base-1.0" pipe = TextToVideoZeroSDXLPipeline.from_pretrained( model_id, torch_dtype=torch.float16, variant="fp16", use_safetensors=True ) pipe.enable_model_cpu_offload() pipe.enable_vae_slicing() pipe.scheduler = DDIMScheduler.from_config(pipe.scheduler.config) generator = torch.Generator(device="cpu").manual_seed(0) prompt = "A panda dancing in Antarctica" result = pipe(prompt=prompt, generator=generator).images first_frame_slice = result[0, -3:, -3:, -1] last_frame_slice = result[-1, -3:, -3:, 0] expected_slice1 = np.array([0.57, 0.57, 0.57, 0.57, 0.57, 0.56, 0.55, 0.56, 0.56]) expected_slice2 = np.array([0.54, 0.53, 0.53, 0.53, 0.53, 0.52, 0.53, 0.53, 0.53]) assert np.abs(first_frame_slice.flatten() - expected_slice1).max() < 1e-2 assert np.abs(last_frame_slice.flatten() - expected_slice2).max() < 1e-2
diffusers/tests/pipelines/text_to_video_synthesis/test_text_to_video_zero_sdxl.py/0
{ "file_path": "diffusers/tests/pipelines/text_to_video_synthesis/test_text_to_video_zero_sdxl.py", "repo_id": "diffusers", "token_count": 7188 }
138
import torch from diffusers import DDPMScheduler from .test_schedulers import SchedulerCommonTest class DDPMSchedulerTest(SchedulerCommonTest): scheduler_classes = (DDPMScheduler,) def get_scheduler_config(self, **kwargs): config = { "num_train_timesteps": 1000, "beta_start": 0.0001, "beta_end": 0.02, "beta_schedule": "linear", "variance_type": "fixed_small", "clip_sample": True, } config.update(**kwargs) return config def test_timesteps(self): for timesteps in [1, 5, 100, 1000]: self.check_over_configs(num_train_timesteps=timesteps) def test_betas(self): for beta_start, beta_end in zip([0.0001, 0.001, 0.01, 0.1], [0.002, 0.02, 0.2, 2]): self.check_over_configs(beta_start=beta_start, beta_end=beta_end) def test_schedules(self): for schedule in ["linear", "squaredcos_cap_v2"]: self.check_over_configs(beta_schedule=schedule) def test_variance_type(self): for variance in ["fixed_small", "fixed_large", "other"]: self.check_over_configs(variance_type=variance) def test_clip_sample(self): for clip_sample in [True, False]: self.check_over_configs(clip_sample=clip_sample) def test_thresholding(self): self.check_over_configs(thresholding=False) for threshold in [0.5, 1.0, 2.0]: for prediction_type in ["epsilon", "sample", "v_prediction"]: self.check_over_configs( thresholding=True, prediction_type=prediction_type, sample_max_value=threshold, ) def test_prediction_type(self): for prediction_type in ["epsilon", "sample", "v_prediction"]: self.check_over_configs(prediction_type=prediction_type) def test_time_indices(self): for t in [0, 500, 999]: self.check_over_forward(time_step=t) def test_variance(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) assert torch.sum(torch.abs(scheduler._get_variance(0) - 0.0)) < 1e-5 assert torch.sum(torch.abs(scheduler._get_variance(487) - 0.00979)) < 1e-5 assert torch.sum(torch.abs(scheduler._get_variance(999) - 0.02)) < 1e-5 def test_rescale_betas_zero_snr(self): for rescale_betas_zero_snr in [True, False]: self.check_over_configs(rescale_betas_zero_snr=rescale_betas_zero_snr) def test_full_loop_no_noise(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) num_trained_timesteps = len(scheduler) model = self.dummy_model() sample = self.dummy_sample_deter generator = torch.manual_seed(0) for t in reversed(range(num_trained_timesteps)): # 1. predict noise residual residual = model(sample, t) # 2. predict previous mean of sample x_t-1 pred_prev_sample = scheduler.step(residual, t, sample, generator=generator).prev_sample # if t > 0: # noise = self.dummy_sample_deter # variance = scheduler.get_variance(t) ** (0.5) * noise # # sample = pred_prev_sample + variance sample = pred_prev_sample result_sum = torch.sum(torch.abs(sample)) result_mean = torch.mean(torch.abs(sample)) assert abs(result_sum.item() - 258.9606) < 1e-2 assert abs(result_mean.item() - 0.3372) < 1e-3 def test_full_loop_with_v_prediction(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config(prediction_type="v_prediction") scheduler = scheduler_class(**scheduler_config) num_trained_timesteps = len(scheduler) model = self.dummy_model() sample = self.dummy_sample_deter generator = torch.manual_seed(0) for t in reversed(range(num_trained_timesteps)): # 1. predict noise residual residual = model(sample, t) # 2. predict previous mean of sample x_t-1 pred_prev_sample = scheduler.step(residual, t, sample, generator=generator).prev_sample # if t > 0: # noise = self.dummy_sample_deter # variance = scheduler.get_variance(t) ** (0.5) * noise # # sample = pred_prev_sample + variance sample = pred_prev_sample result_sum = torch.sum(torch.abs(sample)) result_mean = torch.mean(torch.abs(sample)) assert abs(result_sum.item() - 202.0296) < 1e-2 assert abs(result_mean.item() - 0.2631) < 1e-3 def test_custom_timesteps(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) timesteps = [100, 87, 50, 1, 0] scheduler.set_timesteps(timesteps=timesteps) scheduler_timesteps = scheduler.timesteps for i, timestep in enumerate(scheduler_timesteps): if i == len(timesteps) - 1: expected_prev_t = -1 else: expected_prev_t = timesteps[i + 1] prev_t = scheduler.previous_timestep(timestep) prev_t = prev_t.item() self.assertEqual(prev_t, expected_prev_t) def test_custom_timesteps_increasing_order(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) timesteps = [100, 87, 50, 51, 0] with self.assertRaises(ValueError, msg="`custom_timesteps` must be in descending order."): scheduler.set_timesteps(timesteps=timesteps) def test_custom_timesteps_passing_both_num_inference_steps_and_timesteps(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) timesteps = [100, 87, 50, 1, 0] num_inference_steps = len(timesteps) with self.assertRaises(ValueError, msg="Can only pass one of `num_inference_steps` or `custom_timesteps`."): scheduler.set_timesteps(num_inference_steps=num_inference_steps, timesteps=timesteps) def test_custom_timesteps_too_large(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) timesteps = [scheduler.config.num_train_timesteps] with self.assertRaises( ValueError, msg="`timesteps` must start before `self.config.train_timesteps`: {scheduler.config.num_train_timesteps}}", ): scheduler.set_timesteps(timesteps=timesteps) def test_full_loop_with_noise(self): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) num_trained_timesteps = len(scheduler) t_start = num_trained_timesteps - 2 model = self.dummy_model() sample = self.dummy_sample_deter generator = torch.manual_seed(0) # add noise noise = self.dummy_noise_deter timesteps = scheduler.timesteps[t_start * scheduler.order :] sample = scheduler.add_noise(sample, noise, timesteps[:1]) for t in timesteps: # 1. predict noise residual residual = model(sample, t) # 2. predict previous mean of sample x_t-1 pred_prev_sample = scheduler.step(residual, t, sample, generator=generator).prev_sample sample = pred_prev_sample result_sum = torch.sum(torch.abs(sample)) result_mean = torch.mean(torch.abs(sample)) assert abs(result_sum.item() - 387.9466) < 1e-2, f" expected result sum 387.9466, but get {result_sum}" assert abs(result_mean.item() - 0.5051) < 1e-3, f" expected result mean 0.5051, but get {result_mean}"
diffusers/tests/schedulers/test_scheduler_ddpm.py/0
{ "file_path": "diffusers/tests/schedulers/test_scheduler_ddpm.py", "repo_id": "diffusers", "token_count": 3860 }
139
import tempfile import torch from diffusers import PNDMScheduler from .test_schedulers import SchedulerCommonTest class PNDMSchedulerTest(SchedulerCommonTest): scheduler_classes = (PNDMScheduler,) forward_default_kwargs = (("num_inference_steps", 50),) def get_scheduler_config(self, **kwargs): config = { "num_train_timesteps": 1000, "beta_start": 0.0001, "beta_end": 0.02, "beta_schedule": "linear", } config.update(**kwargs) return config def check_over_configs(self, time_step=0, **config): kwargs = dict(self.forward_default_kwargs) num_inference_steps = kwargs.pop("num_inference_steps", None) sample = self.dummy_sample residual = 0.1 * sample dummy_past_residuals = [residual + 0.2, residual + 0.15, residual + 0.1, residual + 0.05] for scheduler_class in self.scheduler_classes: scheduler_config = self.get_scheduler_config(**config) scheduler = scheduler_class(**scheduler_config) scheduler.set_timesteps(num_inference_steps) # copy over dummy past residuals scheduler.ets = dummy_past_residuals[:] with tempfile.TemporaryDirectory() as tmpdirname: scheduler.save_config(tmpdirname) new_scheduler = scheduler_class.from_pretrained(tmpdirname) new_scheduler.set_timesteps(num_inference_steps) # copy over dummy past residuals new_scheduler.ets = dummy_past_residuals[:] output = scheduler.step_prk(residual, time_step, sample, **kwargs).prev_sample new_output = new_scheduler.step_prk(residual, time_step, sample, **kwargs).prev_sample assert torch.sum(torch.abs(output - new_output)) < 1e-5, "Scheduler outputs are not identical" output = scheduler.step_plms(residual, time_step, sample, **kwargs).prev_sample new_output = new_scheduler.step_plms(residual, time_step, sample, **kwargs).prev_sample assert torch.sum(torch.abs(output - new_output)) < 1e-5, "Scheduler outputs are not identical" def test_from_save_pretrained(self): pass def check_over_forward(self, time_step=0, **forward_kwargs): kwargs = dict(self.forward_default_kwargs) num_inference_steps = kwargs.pop("num_inference_steps", None) sample = self.dummy_sample residual = 0.1 * sample dummy_past_residuals = [residual + 0.2, residual + 0.15, residual + 0.1, residual + 0.05] for scheduler_class in self.scheduler_classes: scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) scheduler.set_timesteps(num_inference_steps) # copy over dummy past residuals (must be after setting timesteps) scheduler.ets = dummy_past_residuals[:] with tempfile.TemporaryDirectory() as tmpdirname: scheduler.save_config(tmpdirname) new_scheduler = scheduler_class.from_pretrained(tmpdirname) # copy over dummy past residuals new_scheduler.set_timesteps(num_inference_steps) # copy over dummy past residual (must be after setting timesteps) new_scheduler.ets = dummy_past_residuals[:] output = scheduler.step_prk(residual, time_step, sample, **kwargs).prev_sample new_output = new_scheduler.step_prk(residual, time_step, sample, **kwargs).prev_sample assert torch.sum(torch.abs(output - new_output)) < 1e-5, "Scheduler outputs are not identical" output = scheduler.step_plms(residual, time_step, sample, **kwargs).prev_sample new_output = new_scheduler.step_plms(residual, time_step, sample, **kwargs).prev_sample assert torch.sum(torch.abs(output - new_output)) < 1e-5, "Scheduler outputs are not identical" def full_loop(self, **config): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config(**config) scheduler = scheduler_class(**scheduler_config) num_inference_steps = 10 model = self.dummy_model() sample = self.dummy_sample_deter scheduler.set_timesteps(num_inference_steps) for i, t in enumerate(scheduler.prk_timesteps): residual = model(sample, t) sample = scheduler.step_prk(residual, t, sample).prev_sample for i, t in enumerate(scheduler.plms_timesteps): residual = model(sample, t) sample = scheduler.step_plms(residual, t, sample).prev_sample return sample def test_step_shape(self): kwargs = dict(self.forward_default_kwargs) num_inference_steps = kwargs.pop("num_inference_steps", None) for scheduler_class in self.scheduler_classes: scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) sample = self.dummy_sample residual = 0.1 * sample if num_inference_steps is not None and hasattr(scheduler, "set_timesteps"): scheduler.set_timesteps(num_inference_steps) elif num_inference_steps is not None and not hasattr(scheduler, "set_timesteps"): kwargs["num_inference_steps"] = num_inference_steps # copy over dummy past residuals (must be done after set_timesteps) dummy_past_residuals = [residual + 0.2, residual + 0.15, residual + 0.1, residual + 0.05] scheduler.ets = dummy_past_residuals[:] output_0 = scheduler.step_prk(residual, 0, sample, **kwargs).prev_sample output_1 = scheduler.step_prk(residual, 1, sample, **kwargs).prev_sample self.assertEqual(output_0.shape, sample.shape) self.assertEqual(output_0.shape, output_1.shape) output_0 = scheduler.step_plms(residual, 0, sample, **kwargs).prev_sample output_1 = scheduler.step_plms(residual, 1, sample, **kwargs).prev_sample self.assertEqual(output_0.shape, sample.shape) self.assertEqual(output_0.shape, output_1.shape) def test_timesteps(self): for timesteps in [100, 1000]: self.check_over_configs(num_train_timesteps=timesteps) def test_steps_offset(self): for steps_offset in [0, 1]: self.check_over_configs(steps_offset=steps_offset) scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config(steps_offset=1) scheduler = scheduler_class(**scheduler_config) scheduler.set_timesteps(10) assert torch.equal( scheduler.timesteps, torch.LongTensor( [901, 851, 851, 801, 801, 751, 751, 701, 701, 651, 651, 601, 601, 501, 401, 301, 201, 101, 1] ), ) def test_betas(self): for beta_start, beta_end in zip([0.0001, 0.001], [0.002, 0.02]): self.check_over_configs(beta_start=beta_start, beta_end=beta_end) def test_schedules(self): for schedule in ["linear", "squaredcos_cap_v2"]: self.check_over_configs(beta_schedule=schedule) def test_prediction_type(self): for prediction_type in ["epsilon", "v_prediction"]: self.check_over_configs(prediction_type=prediction_type) def test_time_indices(self): for t in [1, 5, 10]: self.check_over_forward(time_step=t) def test_inference_steps(self): for t, num_inference_steps in zip([1, 5, 10], [10, 50, 100]): self.check_over_forward(num_inference_steps=num_inference_steps) def test_pow_of_3_inference_steps(self): # earlier version of set_timesteps() caused an error indexing alpha's with inference steps as power of 3 num_inference_steps = 27 for scheduler_class in self.scheduler_classes: sample = self.dummy_sample residual = 0.1 * sample scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) scheduler.set_timesteps(num_inference_steps) # before power of 3 fix, would error on first step, so we only need to do two for i, t in enumerate(scheduler.prk_timesteps[:2]): sample = scheduler.step_prk(residual, t, sample).prev_sample def test_inference_plms_no_past_residuals(self): with self.assertRaises(ValueError): scheduler_class = self.scheduler_classes[0] scheduler_config = self.get_scheduler_config() scheduler = scheduler_class(**scheduler_config) scheduler.step_plms(self.dummy_sample, 1, self.dummy_sample).prev_sample def test_full_loop_no_noise(self): sample = self.full_loop() result_sum = torch.sum(torch.abs(sample)) result_mean = torch.mean(torch.abs(sample)) assert abs(result_sum.item() - 198.1318) < 1e-2 assert abs(result_mean.item() - 0.2580) < 1e-3 def test_full_loop_with_v_prediction(self): sample = self.full_loop(prediction_type="v_prediction") result_sum = torch.sum(torch.abs(sample)) result_mean = torch.mean(torch.abs(sample)) assert abs(result_sum.item() - 67.3986) < 1e-2 assert abs(result_mean.item() - 0.0878) < 1e-3 def test_full_loop_with_set_alpha_to_one(self): # We specify different beta, so that the first alpha is 0.99 sample = self.full_loop(set_alpha_to_one=True, beta_start=0.01) result_sum = torch.sum(torch.abs(sample)) result_mean = torch.mean(torch.abs(sample)) assert abs(result_sum.item() - 230.0399) < 1e-2 assert abs(result_mean.item() - 0.2995) < 1e-3 def test_full_loop_with_no_set_alpha_to_one(self): # We specify different beta, so that the first alpha is 0.99 sample = self.full_loop(set_alpha_to_one=False, beta_start=0.01) result_sum = torch.sum(torch.abs(sample)) result_mean = torch.mean(torch.abs(sample)) assert abs(result_sum.item() - 186.9482) < 1e-2 assert abs(result_mean.item() - 0.2434) < 1e-3
diffusers/tests/schedulers/test_scheduler_pndm.py/0
{ "file_path": "diffusers/tests/schedulers/test_scheduler_pndm.py", "repo_id": "diffusers", "token_count": 4654 }
140
# Introduction <CourseFloatingBanner unit={0} classNames="absolute z-10 right-0 top-0" /> ## Bienvenue au cours sur les modรจles de diffusion ๐Ÿค— ! ## ร€ quoi s'attendre ? In this free course, you will: - ๐Ÿ‘ฉโ€๐ŸŽ“ Study the theory behind diffusion models - ๐Ÿงจ Learn how to generate images and audio with the popular ๐Ÿค— Diffusers library - ๐Ÿ‹๏ธโ€โ™‚๏ธ Train your own diffusion models from scratch - ๐Ÿ“ป Fine-tune existing diffusion models on new datasets - ๐Ÿ—บ Explore conditional generation and guidance - ๐Ÿง‘โ€๐Ÿ”ฌ Create your own custom diffusion model pipelines ## Prรฉrequis Ce cours requiert un bon niveau en Python et des bases en apprentissage profond et Pytorch. Si ce n'est pas encore le cas, vous pouvez consulter ces ressources gratuites (en anglais) : - Python : https://www.udacity.com/course/introduction-to-python--ud1110 - Introduction ร  l'apprentissage profond avec PyTorch : https://www.udacity.com/course/deep-learning-pytorch--ud188 - PyTorch en 60 min : https://pytorch.org/tutorials/beginner/deep_learning_60min_blitz.html Pour pousser vos modรจles sur le *Hub* d'*Hugging Face*, vous aurez besoin d'un compte. Vous pouvez en crรฉer un gratuitement ร  l'adresse suivante : [https://huggingface.co/join](https://huggingface.co/join). ## Quel est le programme ? Le cours est constituรฉ de quatre unitรฉs. Chacune d'elle est composรฉe d'une partie thรฉorie listant รฉgalement des ressources / papiers, ainsi que de deux *notebooks*. Plus prรฉcisรฉment, nous avons : - Unitรฉ 1 : Introduction aux modรจles de diffusion Introduction ร  ๐Ÿค— Diffusers et implรฉmentation ร  partir de 0 - Unitรฉ 2 : <i>Finetuning</i> et guidage *Finetuner* un modรจle de diffusion sur de nouvelles donnรฉes et ajout du guidage - Unitรฉ 3 : Stable Diffusion Exploration d'un puissant modรจle de diffusion latent conditionnรฉ par le texte - Unitรฉ 4 : Faire plus avec la diffusion Techniques avancรฉes pour aller plus loin dans la diffusion ## Qui sommes-nous ? ร€ propos des auteurs de ce cours : [**Jonathan Whitaker**](https://huggingface.co/johnowhitaker) est TODO. [**Lewis Tunstall**](https://huggingface.co/lewtun) est ingรฉnieur en apprentissage machine chez Hugging Face et dรฉvouรฉ au dรฉveloppement d'outils *open source* avec la volontรฉ de les rendre accessibles ร  une communautรฉ plus large. Il est รฉgalement co-auteur du livre [*Natural Language Processing with Transformers*](https://www.oreilly.com/library/view/natural-language-processing/9781098136789/). ## FAQ Voici quelques rรฉponses aux questions frรฉquemment posรฉes : - **Suivre ce cours mรจne-t-il ร  une certification ?** Actuellement, nous n'avons pas de certification pour ce cours. - **Combien de temps dois-je consacrer ร  ce cours ?** Chaque chapitre de ce cours est conรงu pour รชtre complรฉtรฉ en une semaine, avec environ 6 ร  8 heures de travail par unitรฉ. Cependant, vous pouvez prendre tout le temps nรฉcessaire pour le suivre. - **Oรน puis-je poser une question si j'en ai une ?** Si vous avez une question sur l'une des sections du cours, il vous suffit de cliquer sur la banniรจre ยซ *Ask a question* ยป en haut de la page pour รชtre automatiquement redirigรฉ vers le [Discord de Hugging Face](https://discord.com/invite/JfAtkvEtRb) pour poser votre question dans le channel `#diffusion-models-class`. <img src="https://huggingface.co/datasets/huggingface-course/documentation-images/resolve/main/en/chapter1/forum-button.png" alt="Link to the Hugging Face forums" width="75%"> - **Oรน puis-je obtenir le code du cours ?** Pour chaque section, vous pouvez cliquer sur la banniรจre en haut de la page pour exรฉcuter son code : <img src="https://huggingface.co/datasets/huggingface-course/documentation-images/resolve/main/en/chapter1/notebook-buttons.png" alt="Link to the Hugging Face course notebooks" width="75%"> - **Comment puis-je contribuer au cours ?** Il existe de nombreuses faรงons de contribuer au cours ! Si vous trouvez une coquille ou un bug, veuillez ouvrir une ยซ *Issue* ยป sur le dรฉpรดt [`diffusion-models-class`](https://github.com/huggingface/diffusion-models-class). Si vous souhaitez aider ร  traduire le cours dans votre langue maternelle, consultez les instructions [ici](https://github.com/huggingface/diffusion-models-class#translating-the-course-into-your-language). - **Peut-on rรฉutiliser ce cours?** Bien sรปr ! Le cours est publiรฉ sous la licence [Apache 2 license](https://www.apache.org/licenses/LICENSE-2.0.html). Cela signifie que vous devez crรฉditer de maniรจre appropriรฉe, fournir un lien vers la licence et indiquer si des modifications ont รฉtรฉ apportรฉes. Vous pouvez le faire de toute maniรจre raisonnable, mais pas d'une faรงon qui suggรจre que le distributeur de la licence vous approuve ou approuve votre utilisation. Si vous souhaitez citer le cours, veuillez utiliser le BibTeX suivant : ``` @misc{huggingfacecourse, author = {Hugging Face}, title = {The Hugging Face Diffusion Models Course, 2022}, howpublished = "\url{https://huggingface.co/course}", year = {2022}, note = "[Online; accessed <today>]" } ``` ## C'est parti ! รŠtes-vous prรชt ร  commencer ? Alors rendez vous ร  la premiรจre unitรฉ pour dรฉbuter le cours.
diffusion-models-class/units/fr/unit0/1.mdx/0
{ "file_path": "diffusion-models-class/units/fr/unit0/1.mdx", "repo_id": "diffusion-models-class", "token_count": 1801 }
141
<jupyter_start><jupyter_text>Prรฉparer des donnรฉes (TensorFlow) Installez les bibliothรจques ๐Ÿค— *Transformers* et ๐Ÿค— *Datasets* pour exรฉcuter ce *notebook*.<jupyter_code>!pip install datasets transformers[sentencepiece] import tensorflow as tf import numpy as np from transformers import AutoTokenizer, TFAutoModelForSequenceClassification # Same as before checkpoint = "camembert-base" tokenizer = AutoTokenizer.from_pretrained(checkpoint) model = TFAutoModelForSequenceClassification.from_pretrained(checkpoint) sequences = [ "J'ai attendu un cours d'HuggingFace toute ma vie.", "Je dรฉteste tellement รงa !"] batch = dict(tokenizer(sequences, padding=True, truncation=True, return_tensors="tf")) # This is new model.compile(optimizer="adam", loss="sparse_categorical_crossentropy") labels = tf.convert_to_tensor([1, 1]) model.train_on_batch(batch, labels) from datasets import load_dataset raw_datasets = load_dataset("paws-x", "fr") raw_datasets raw_train_dataset = raw_datasets["train"] raw_train_dataset[0] raw_train_dataset.features from transformers import AutoTokenizer checkpoint = "camembert-base" tokenizer = AutoTokenizer.from_pretrained(checkpoint) tokenized_sentences_1 = tokenizer(raw_datasets["train"]["sentence1"]) tokenized_sentences_2 = tokenizer(raw_datasets["train"]["sentence2"]) inputs = tokenizer("C'est la premiรจre phrase.", "C'est la deuxiรจme.") inputs tokenizer.convert_ids_to_tokens(inputs["input_ids"]) tokenized_dataset = tokenizer( raw_datasets["train"]["sentence1"], raw_datasets["train"]["sentence2"], padding=True, truncation=True, ) def tokenize_function(example): return tokenizer(example["sentence1"], example["sentence2"], truncation=True) tokenized_datasets = raw_datasets.map(tokenize_function, batched=True) tokenized_datasets from transformers import DataCollatorWithPadding data_collator = DataCollatorWithPadding(tokenizer=tokenizer, return_tensors="tf") samples = tokenized_datasets["train"][:8] samples = {k: v for k, v in samples.items() if k not in ["idx", "sentence1", "sentence2"]} [len(x) for x in samples["input_ids"]] batch = data_collator(samples) {k: v.shape for k, v in batch.items()} tf_train_dataset = tokenized_datasets["train"].to_tf_dataset( columns=["attention_mask", "input_ids", "token_type_ids"], label_cols=["labels"], shuffle=True, collate_fn=data_collator, batch_size=8, ) tf_validation_dataset = tokenized_datasets["validation"].to_tf_dataset( columns=["attention_mask", "input_ids", "token_type_ids"], label_cols=["labels"], shuffle=False, collate_fn=data_collator, batch_size=8, )<jupyter_output><empty_output>
notebooks/course/fr/chapter3/section2_tf.ipynb/0
{ "file_path": "notebooks/course/fr/chapter3/section2_tf.ipynb", "repo_id": "notebooks", "token_count": 1005 }
142
<jupyter_start><jupyter_text>Les pouvoirs spรฉciaux des *tokenizers* rapides (PyTorch) Installez les bibliothรจques ๐Ÿค— *Transformers* et ๐Ÿค— *Datasets* pour exรฉcuter ce *notebook*.<jupyter_code>!pip install datasets transformers[sentencepiece] from transformers import AutoTokenizer tokenizer = AutoTokenizer.from_pretrained("camembert-base") example = "Je m'appelle Sylvain et je travaille ร  Hugging Face ร  Brooklyn." encoding = tokenizer(example) print(type(encoding)) tokenizer.is_fast encoding.is_fast encoding.tokens() encoding.word_ids() start, end = encoding.word_to_chars(3) example[start:end] from transformers import pipeline token_classifier = pipeline("token-classification", model="Jean-Baptiste/camembert-ner") token_classifier("Je m'appelle Sylvain et je travaille ร  Hugging Face ร  Brooklyn.") from transformers import pipeline token_classifier = pipeline("token-classification", model="Jean-Baptiste/camembert-ner", aggregation_strategy="simple") token_classifier("Je m'appelle Sylvain et je travaille ร  Hugging Face ร  Brooklyn.") from transformers import AutoTokenizer, AutoModelForTokenClassification model_checkpoint = "Jean-Baptiste/camembert-ner" tokenizer = AutoTokenizer.from_pretrained(model_checkpoint) model = AutoModelForTokenClassification.from_pretrained(model_checkpoint) example = "Je m'appelle Sylvain et je travaille ร  Hugging Face ร  Brooklyn." inputs = tokenizer(example, return_tensors="pt") outputs = model(**inputs) print(inputs["input_ids"].shape) print(outputs.logits.shape) import torch probabilities = torch.nn.functional.softmax(outputs.logits, dim=-1)[0].tolist() predictions = outputs.logits.argmax(dim=-1)[0].tolist() print(predictions) model.config.id2label results = [] tokens = inputs.tokens() for idx, pred in enumerate(predictions): label = model.config.id2label[pred] if label != "O": results.append( {"entity": label, "score": probabilities[idx][pred], "word": tokens[idx]} ) print(results) inputs_with_offsets = tokenizer(example, return_offsets_mapping=True) inputs_with_offsets["offset_mapping"] example[12:14] results = [] inputs_with_offsets = tokenizer(example, return_offsets_mapping=True) tokens = inputs_with_offsets.tokens() offsets = inputs_with_offsets["offset_mapping"] for idx, pred in enumerate(predictions): label = model.config.id2label[pred] if label != "O": start, end = offsets[idx] results.append( { "entity": label, "score": probabilities[idx][pred], "word": tokens[idx], "start": start, "end": end, } ) print(results) example[39:51] import numpy as np results = [] inputs_with_offsets = tokenizer(example, return_offsets_mapping=True) tokens = inputs_with_offsets.tokens() offsets = inputs_with_offsets["offset_mapping"] idx = 0 while idx < len(predictions): pred = predictions[idx] label = model.config.id2label[pred] if label != "O": # Enlevez le B- ou le I- label = label[2:] start, _ = offsets[idx] # Rรฉcupรฉrer tous les tokens รฉtiquetรฉs avec I-label all_scores = [] while ( idx < len(predictions) and model.config.id2label[predictions[idx]] == f"I-{label}" ): all_scores.append(probabilities[idx][pred]) _, end = offsets[idx] idx += 1 # Le score est la moyenne de tous les scores des tokens de cette entitรฉ groupรฉe score = np.mean(all_scores).item() word = example[start:end] results.append( { "entity_group": label, "score": score, "word": word, "start": start, "end": end, } ) idx += 1 print(results)<jupyter_output><empty_output>
notebooks/course/fr/chapter6/section3_pt.ipynb/0
{ "file_path": "notebooks/course/fr/chapter6/section3_pt.ipynb", "repo_id": "notebooks", "token_count": 1610 }
143
<jupyter_start><jupyter_text>Rรฉsumรฉ (TensorFlow) Installez les bibliothรจques ๐Ÿค— *Datasets* et ๐Ÿค— *Transformers* pour exรฉcuter ce *notebook*.<jupyter_code>!pip install datasets transformers[sentencepiece] !apt install git-lfs<jupyter_output><empty_output><jupyter_text>Vous aurez besoin de configurer git, adaptez votre email et votre nom dans la cellule suivante.<jupyter_code>!git config --global user.email "[email protected]" !git config --global user.name "Your Name"<jupyter_output><empty_output><jupyter_text>Vous devrez รฉgalement รชtre connectรฉ au Hub d'Hugging Face. Exรฉcutez ce qui suit et entrez vos informations d'identification.<jupyter_code>from huggingface_hub import notebook_login notebook_login() from datasets import load_dataset french_dataset = load_dataset("amazon_reviews_multi", "fr") english_dataset = load_dataset("amazon_reviews_multi", "en") french_dataset def show_samples(dataset, num_samples=3, seed=42): sample = dataset["train"].shuffle(seed=seed).select(range(num_samples)) for example in sample: print(f"\n'>> Title: {example['review_title']}'") print(f"'>> Review: {example['review_body']}'") show_samples(french_dataset) french_dataset.set_format("pandas") french_df = french_dataset["train"][:] # Afficher les comptes des 20 premiers produits french_df["product_category"].value_counts()[:20] def filter_books(example): return ( example["product_category"] == "book" or example["product_category"] == "digital_ebook_purchase" ) french_dataset.reset_format() french_books = french_dataset.filter(filter_books) english_books = english_dataset.filter(filter_books) show_samples(french_dataset) from datasets import concatenate_datasets, DatasetDict books_dataset = DatasetDict() for split in english_books.keys(): books_dataset[split] = concatenate_datasets( [english_books[split], french_books[split]] ) books_dataset[split] = books_dataset[split].shuffle(seed=42) # Quelques exemples show_samples(books_dataset) books_dataset = books_dataset.filter(lambda x: len(x["review_title"].split()) > 2) from transformers import AutoTokenizer model_checkpoint = "google/mt5-small" tokenizer = AutoTokenizer.from_pretrained(model_checkpoint) inputs = tokenizer("J'ai adorรฉ lire les Hunger Games !") inputs tokenizer.convert_ids_to_tokens(inputs.input_ids) max_input_length = 512 max_target_length = 30 def preprocess_function(examples): model_inputs = tokenizer( examples["review_body"], max_length=max_input_length, truncation=True ) # Configurer le tokenizer pour les cibles with tokenizer.as_target_tokenizer(): labels = tokenizer( examples["review_title"], max_length=max_target_length, truncation=True ) model_inputs["labels"] = labels["input_ids"] return model_inputs tokenized_datasets = books_dataset.map(preprocess_function, batched=True) generated_summary = "J'ai absolument adorรฉ lire les Hunger Games" reference_summary = "J'ai adorรฉ lire les Hunger Games" !pip install rouge_score from datasets import load_metric rouge_score = load_metric("rouge") scores = rouge_score.compute( predictions=[generated_summary], references=[reference_summary] ) scores scores["rouge1"].mid !pip install nltk import nltk nltk.download("punkt") from nltk.tokenize import sent_tokenize def three_sentence_summary(text): return "\n".join(sent_tokenize(text)[:3]) print(three_sentence_summary(books_dataset["train"][1]["review_body"])) def evaluate_baseline(dataset, metric): summaries = [three_sentence_summary(text) for text in dataset["review_body"]] return metric.compute(predictions=summaries, references=dataset["review_title"]) import pandas as pd score = evaluate_baseline(books_dataset["validation"], rouge_score) rouge_names = ["rouge1", "rouge2", "rougeL", "rougeLsum"] rouge_dict = dict((rn, round(score[rn].mid.fmeasure * 100, 2)) for rn in rouge_names) rouge_dict from transformers import TFAutoModelForSeq2SeqLM model = TFAutoModelForSeq2SeqLM.from_pretrained(model_checkpoint) from transformers import DataCollatorForSeq2Seq data_collator = DataCollatorForSeq2Seq(tokenizer, model=model, return_tensors="tf") tokenized_datasets = tokenized_datasets.remove_columns( books_dataset["train"].column_names ) features = [tokenized_datasets["train"][i] for i in range(2)] data_collator(features) tf_train_dataset = model.prepare_tf_dataset( tokenized_datasets["train"], collate_fn=data_collator, shuffle=True, batch_size=8, ) tf_eval_dataset = model.prepare_tf_dataset( tokenized_datasets["validation"], collate_fn=data_collator, shuffle=False, batch_size=8) from transformers import create_optimizer import tensorflow as tf # Le nombre d'รฉtapes d'entraรฎnement est le nombre d'รฉchantillons dans le jeu de donnรฉes, divisรฉ par la taille du batch puis multipliรฉ # par le nombre total d'รฉpoques. Notez que le jeu de donnรฉes tf_train_dataset est ici un lot de donnรฉes tf.data.Dataset, # pas le jeu de donnรฉes original Hugging Face, donc son len() est dรฉjร  num_samples // batch_size. num_train_epochs = 8 num_train_steps = len(tf_train_dataset) * num_train_epochs model_name = model_checkpoint.split("/")[-1] optimizer, schedule = create_optimizer( init_lr=5.6e-5, num_warmup_steps=0, num_train_steps=num_train_steps, weight_decay_rate=0.01, ) model.compile(optimizer=optimizer) # Entraรฎner en mixed-precision float16 tf.keras.mixed_precision.set_global_policy("mixed_float16") tf.config.run_functions_eagerly(True) from transformers.keras_callbacks import PushToHubCallback callback = PushToHubCallback( output_dir=f"{model_name}-finetuned-amazon-en-fr", tokenizer=tokenizer ) model.fit( tf_train_dataset, validation_data=tf_eval_dataset, callbacks=[callback], epochs=2 ) from tqdm import tqdm import numpy as np generation_data_collator = DataCollatorForSeq2Seq( tokenizer, model=model, return_tensors="tf", pad_to_multiple_of=320 ) tf_generate_dataset = model.prepare_tf_dataset( tokenized_datasets["validation"], collate_fn=generation_data_collator, shuffle=False, batch_size=8, drop_remainder=True, ) @tf.function(jit_compile=True) def generate_with_xla(batch): return model.generate( input_ids=batch["input_ids"], attention_mask=batch["attention_mask"], max_new_tokens=32, ) all_preds = [] all_labels = [] for batch, labels in tqdm(tf_generate_dataset): predictions = generate_with_xla(batch) decoded_preds = tokenizer.batch_decode(predictions, skip_special_tokens=True) labels = labels.numpy() labels = np.where(labels != -100, labels, tokenizer.pad_token_id) decoded_labels = tokenizer.batch_decode(labels, skip_special_tokens=True) decoded_preds = ["\n".join(sent_tokenize(pred.strip())) for pred in decoded_preds] decoded_labels = ["\n".join(sent_tokenize(label.strip())) for label in decoded_labels] all_preds.extend(decoded_preds) all_labels.extend(decoded_labels) result = rouge_score.compute( predictions=decoded_preds, references=decoded_labels, use_stemmer=True ) result = {key: value.mid.fmeasure * 100 for key, value in result.items()} {k: round(v, 4) for k, v in result.items()} result from transformers import pipeline hub_model_id = "huggingface-course/mt5-small-finetuned-amazon-en-fr" summarizer = pipeline("summarization", model=hub_model_id) def print_summary(idx): review = books_dataset["test"][idx]["review_body"] title = books_dataset["test"][idx]["review_title"] summary = summarizer(books_dataset["test"][idx]["review_body"])[0]["summary_text"] print(f"'>>> Review: {review}'") print(f"\n'>>> Title: {title}'") print(f"\n'>>> Summary: {summary}'") print_summary(100) print_summary(0)<jupyter_output><empty_output>
notebooks/course/fr/chapter7/section5_tf.ipynb/0
{ "file_path": "notebooks/course/fr/chapter7/section5_tf.ipynb", "repo_id": "notebooks", "token_count": 3014 }
144
<jupyter_start><jupyter_text>Introduction aux Blocks Installez les bibliothรจques ๐Ÿค— Transformers et ๐Ÿค— Gradio pour exรฉcuter ce *notebook*.<jupyter_code>!pip install datasets transformers[sentencepiece] !pip install gradio import gradio as gr def flip_text(x): return x[::-1] demo = gr.Blocks() with demo: gr.Markdown( """ # Inverser le texte ! Commencer ร  taper ci-dessous pour voir le rรฉsultat. """ ) input = gr.Textbox(placeholder="Inverser ce texte") output = gr.Textbox() input.change(fn=flip_text, inputs=input, outputs=output) demo.launch() import numpy as np import gradio as gr demo = gr.Blocks() def flip_text(x): return x[::-1] def flip_image(x): return np.fliplr(x) with demo: gr.Markdown("Inverser des fichiers texte ou image ร  l'aide de cette dรฉmo.") with gr.Tabs(): with gr.TabItem("Inverser le texte"): with gr.Row(): text_input = gr.Textbox() text_output = gr.Textbox() text_button = gr.Button("Inverser") with gr.TabItem("Inverser l'image"): with gr.Row(): image_input = gr.Image() image_output = gr.Image() image_button = gr.Button("Inverser") text_button.click(flip_text, inputs=text_input, outputs=text_output) image_button.click(flip_image, inputs=image_input, outputs=image_output) demo.launch() import gradio as gr api = gr.Interface.load("huggingface/asi/gpt-fr-cased-small") def complete_with_gpt(text): # Utilisez les 50 derniers caractรจres du texte comme contexte. return text[:-50] + api(text[-50:]) with gr.Blocks() as demo: textbox = gr.Textbox(placeholder="Tapez ici et appuyez sur la touche Entrรฉe...", lines=4) btn = gr.Button("Gรฉnรฉrer") btn.click(complete_with_gpt, textbox, textbox) demo.launch() from transformers import pipeline import gradio as gr asr = pipeline("automatic-speech-recognition", "wav2vec2-large-xlsr-53-french") classifier = pipeline("text-classification", model="tblard/tf-allocine") def speech_to_text(speech): text = asr(speech)["text"] return text def text_to_sentiment(text): return classifier(text)[0]["label"] demo = gr.Blocks() with demo: audio_file = gr.Audio(type="filepath") text = gr.Textbox() label = gr.Label() b1 = gr.Button("Reconnaรฎtre la parole") b2 = gr.Button("Classifier le sentiment") b1.click(speech_to_text, inputs=audio_file, outputs=text) b2.click(text_to_sentiment, inputs=text, outputs=label) demo.launch() import gradio as gr def change_textbox(choice): if choice == "court": return gr.Textbox.update(lines=2, visible=True) elif choice == "long": return gr.Textbox.update(lines=8, visible=True) else: return gr.Textbox.update(visible=False) with gr.Blocks() as block: radio = gr.Radio( ["court", "long", "none"], label="Quel genre d'essai souhaitez-vous รฉcrire ?" ) text = gr.Textbox(lines=2, interactive=True) radio.change(fn=change_textbox, inputs=radio, outputs=text) block.launch()<jupyter_output><empty_output>
notebooks/course/fr/chapter9/section7.ipynb/0
{ "file_path": "notebooks/course/fr/chapter9/section7.ipynb", "repo_id": "notebooks", "token_count": 1332 }
145
<jupyter_start><jupyter_text>InstructPix2Pix: Learning to Follow Image Editing InstructionsA demo notebook for [InstructPix2Pix](https://www.timothybrooks.com/instruct-pix2pix/) using [diffusers](https://github.com/huggingface/diffusers). InstructPix2Pix is fine-tuned stable diffusion model which allows you to edit images using language instructions.<jupyter_code>!pip install -qqq git+https://github.com/huggingface/diffusers.git gradio transformers accelerate safetensors<jupyter_output><empty_output><jupyter_text>Download the image for our example<jupyter_code>%%capture !wget https://raw.githubusercontent.com/timothybrooks/instruct-pix2pix/main/imgs/example.jpg<jupyter_output><empty_output><jupyter_text>Load the `StableDiffusionInstructPix2PixPipeline` pipeline<jupyter_code>import PIL import requests import torch from diffusers import StableDiffusionInstructPix2PixPipeline, EulerAncestralDiscreteScheduler model_id = "timbrooks/instruct-pix2pix" pipe = StableDiffusionInstructPix2PixPipeline.from_pretrained(model_id, torch_dtype=torch.float16, revision="fp16", safety_checker=None) pipe.to("cuda") pipe.enable_attention_slicing()<jupyter_output><empty_output><jupyter_text>Load the image<jupyter_code>image = PIL.Image.open("./example.jpg") image = PIL.ImageOps.exif_transpose(image) image = image.convert("RGB") image prompt = "turn him into cyborg" pipe(prompt, image=image, num_inference_steps=20, image_guidance_scale=1).images[0] #@title Gradio Demo from __future__ import annotations import math import random import gradio as gr import torch from PIL import Image, ImageOps from diffusers import StableDiffusionInstructPix2PixPipeline help_text = """ If you're not getting what you want, there may be a few reasons: 1. Is the image not changing enough? Your Image CFG weight may be too high. This value dictates how similar the output should be to the input. It's possible your edit requires larger changes from the original image, and your Image CFG weight isn't allowing that. Alternatively, your Text CFG weight may be too low. This value dictates how much to listen to the text instruction. The default Image CFG of 1.5 and Text CFG of 7.5 are a good starting point, but aren't necessarily optimal for each edit. Try: * Decreasing the Image CFG weight, or * Increasing the Text CFG weight, or 2. Conversely, is the image changing too much, such that the details in the original image aren't preserved? Try: * Increasing the Image CFG weight, or * Decreasing the Text CFG weight 3. Try generating results with different random seeds by setting "Randomize Seed" and running generation multiple times. You can also try setting "Randomize CFG" to sample new Text CFG and Image CFG values each time. 4. Rephrasing the instruction sometimes improves results (e.g., "turn him into a dog" vs. "make him a dog" vs. "as a dog"). 5. Increasing the number of steps sometimes improves results. 6. Do faces look weird? The Stable Diffusion autoencoder has a hard time with faces that are small in the image. Try: * Cropping the image so the face takes up a larger portion of the frame. """ example_instructions = [ "Make it a picasso painting", "as if it were by modigliani", "convert to a bronze statue", "Turn it into an anime.", "have it look like a graphic novel", "make him gain weight", "what would he look like bald?", "Have him smile", "Put him in a cocktail party.", "move him at the beach.", "add dramatic lighting", "Convert to black and white", "What if it were snowing?", "Give him a leather jacket", "Turn him into a cyborg!", "make him wear a beanie", ] model_id = "timbrooks/instruct-pix2pix" def main(): pipe = StableDiffusionInstructPix2PixPipeline.from_pretrained(model_id, torch_dtype=torch.float16, revision="fp16", safety_checker=None).to("cuda") example_image = Image.open("./example.jpg").convert("RGB") def load_example( steps: int, randomize_seed: bool, seed: int, randomize_cfg: bool, text_cfg_scale: float, image_cfg_scale: float, ): example_instruction = random.choice(example_instructions) return [example_image, example_instruction] + generate( example_image, example_instruction, steps, randomize_seed, seed, randomize_cfg, text_cfg_scale, image_cfg_scale, ) def generate( input_image: Image.Image, instruction: str, steps: int, randomize_seed: bool, seed: int, randomize_cfg: bool, text_cfg_scale: float, image_cfg_scale: float, ): seed = random.randint(0, 100000) if randomize_seed else seed text_cfg_scale = round(random.uniform(6.0, 9.0), ndigits=2) if randomize_cfg else text_cfg_scale image_cfg_scale = round(random.uniform(1.2, 1.8), ndigits=2) if randomize_cfg else image_cfg_scale width, height = input_image.size factor = 512 / max(width, height) factor = math.ceil(min(width, height) * factor / 64) * 64 / min(width, height) width = int((width * factor) // 64) * 64 height = int((height * factor) // 64) * 64 input_image = ImageOps.fit(input_image, (width, height)) if instruction == "": return [input_image, seed] generator = torch.manual_seed(seed) edited_image = pipe( instruction, image=input_image, guidance_scale=text_cfg_scale, image_guidance_scale=image_cfg_scale, num_inference_steps=steps, generator=generator, ).images[0] return [seed, text_cfg_scale, image_cfg_scale, edited_image] def reset(): return [0, "Randomize Seed", 1371, "Fix CFG", 7.5, 1.5, None] with gr.Blocks() as demo: with gr.Row(): with gr.Column(scale=1, min_width=100): generate_button = gr.Button("Generate") with gr.Column(scale=1, min_width=100): load_button = gr.Button("Load Example") with gr.Column(scale=1, min_width=100): reset_button = gr.Button("Reset") with gr.Column(scale=3): instruction = gr.Textbox(lines=1, label="Edit Instruction", interactive=True) with gr.Row(): input_image = gr.Image(label="Input Image", type="pil", interactive=True) edited_image = gr.Image(label=f"Edited Image", type="pil", interactive=False) input_image.style(height=512, width=512) edited_image.style(height=512, width=512) with gr.Row(): steps = gr.Number(value=10, precision=0, label="Steps", interactive=True) randomize_seed = gr.Radio( ["Fix Seed", "Randomize Seed"], value="Randomize Seed", type="index", show_label=False, interactive=True, ) seed = gr.Number(value=1371, precision=0, label="Seed", interactive=True) randomize_cfg = gr.Radio( ["Fix CFG", "Randomize CFG"], value="Fix CFG", type="index", show_label=False, interactive=True, ) text_cfg_scale = gr.Number(value=7.5, label=f"Text CFG", interactive=True) image_cfg_scale = gr.Number(value=1.5, label=f"Image CFG", interactive=True) gr.Markdown(help_text) load_button.click( fn=load_example, inputs=[ steps, randomize_seed, seed, randomize_cfg, text_cfg_scale, image_cfg_scale, ], outputs=[input_image, instruction, seed, text_cfg_scale, image_cfg_scale, edited_image], ) generate_button.click( fn=generate, inputs=[ input_image, instruction, steps, randomize_seed, seed, randomize_cfg, text_cfg_scale, image_cfg_scale, ], outputs=[seed, text_cfg_scale, image_cfg_scale, edited_image], ) reset_button.click( fn=reset, inputs=[], outputs=[steps, randomize_seed, seed, randomize_cfg, text_cfg_scale, image_cfg_scale, edited_image], ) demo.launch(share=True, debug=True) if __name__ == "__main__": main()<jupyter_output><empty_output>
notebooks/diffusers/InstructPix2Pix_using_diffusers.ipynb/0
{ "file_path": "notebooks/diffusers/InstructPix2Pix_using_diffusers.ipynb", "repo_id": "notebooks", "token_count": 3610 }
146
<jupyter_start><jupyter_text>Dreambooth fine-tuning for Stable Diffusion using d๐Ÿงจffusers This notebook shows how to "teach" Stable Diffusion a new concept via Dreambooth using ๐Ÿค— Hugging Face [๐Ÿงจ Diffusers library](https://github.com/huggingface/diffusers). _By using just 3-5 images you can teach new concepts to Stable Diffusion and personalize the model on your own images_ Differently from Textual Inversion, this approach trains the whole model, which can yield better results to the cost of bigger models.For a general introduction to the Stable Diffusion model please refer to this [colab](https://colab.research.google.com/github/huggingface/notebooks/blob/main/diffusers/stable_diffusion.ipynb). Initial setup<jupyter_code>#@title Install the required libs !pip install -U -qq git+https://github.com/huggingface/diffusers.git !pip install -qq accelerate tensorboard transformers ftfy gradio !pip install -qq "ipywidgets>=7,<8" !pip install -qq bitsandbytes #@title [Optional] Install xformers for faster and memory efficient training #@markdown Acknowledgement: The xformers wheel are taken from [TheLastBen/fast-stable-diffusion](https://github.com/TheLastBen/fast-stable-diffusion). Thanks a lot for building these wheels! %%time !pip install -U --pre triton from subprocess import getoutput from IPython.display import HTML from IPython.display import clear_output import time s = getoutput('nvidia-smi') if 'T4' in s: gpu = 'T4' elif 'P100' in s: gpu = 'P100' elif 'V100' in s: gpu = 'V100' elif 'A100' in s: gpu = 'A100' while True: try: gpu=='T4'or gpu=='P100'or gpu=='V100'or gpu=='A100' break except: pass print('[1;31mit seems that your GPU is not supported at the moment') time.sleep(5) if (gpu=='T4'): %pip install -q https://github.com/TheLastBen/fast-stable-diffusion/raw/main/precompiled/T4/xformers-0.0.13.dev0-py3-none-any.whl elif (gpu=='P100'): %pip install -q https://github.com/TheLastBen/fast-stable-diffusion/raw/main/precompiled/P100/xformers-0.0.13.dev0-py3-none-any.whl elif (gpu=='V100'): %pip install -q https://github.com/TheLastBen/fast-stable-diffusion/raw/main/precompiled/V100/xformers-0.0.13.dev0-py3-none-any.whl elif (gpu=='A100'): %pip install -q https://github.com/TheLastBen/fast-stable-diffusion/raw/main/precompiled/A100/xformers-0.0.13.dev0-py3-none-any.whl #@title Import required libraries import argparse import itertools import math import os from contextlib import nullcontext import random import numpy as np import torch import torch.nn.functional as F import torch.utils.checkpoint from torch.utils.data import Dataset import PIL from accelerate import Accelerator from accelerate.logging import get_logger from accelerate.utils import set_seed from diffusers import AutoencoderKL, DDPMScheduler, PNDMScheduler, StableDiffusionPipeline, UNet2DConditionModel from diffusers.optimization import get_scheduler from diffusers.pipelines.stable_diffusion import StableDiffusionSafetyChecker from PIL import Image from torchvision import transforms from tqdm.auto import tqdm from transformers import CLIPFeatureExtractor, CLIPTextModel, CLIPTokenizer import bitsandbytes as bnb def image_grid(imgs, rows, cols): assert len(imgs) == rows*cols w, h = imgs[0].size grid = Image.new('RGB', size=(cols*w, rows*h)) grid_w, grid_h = grid.size for i, img in enumerate(imgs): grid.paste(img, box=(i%cols*w, i//cols*h)) return grid<jupyter_output><empty_output><jupyter_text>Settings for teaching your new concept<jupyter_code>#@markdown `pretrained_model_name_or_path` which Stable Diffusion checkpoint you want to use pretrained_model_name_or_path = "stabilityai/stable-diffusion-2" #@param ["stabilityai/stable-diffusion-2", "stabilityai/stable-diffusion-2-base", "CompVis/stable-diffusion-v1-4", "runwayml/stable-diffusion-v1-5"] {allow-input: true} #@markdown Add here the URLs to the images of the concept you are adding. 3-5 should be fine urls = [ "https://huggingface.co/datasets/valhalla/images/resolve/main/2.jpeg", "https://huggingface.co/datasets/valhalla/images/resolve/main/3.jpeg", "https://huggingface.co/datasets/valhalla/images/resolve/main/5.jpeg", "https://huggingface.co/datasets/valhalla/images/resolve/main/6.jpeg", ## You can add additional images here ] #@title Setup and check the images you have just added import requests import glob from io import BytesIO def download_image(url): try: response = requests.get(url) except: return None return Image.open(BytesIO(response.content)).convert("RGB") images = list(filter(None,[download_image(url) for url in urls])) save_path = "./my_concept" if not os.path.exists(save_path): os.mkdir(save_path) [image.save(f"{save_path}/{i}.jpeg") for i, image in enumerate(images)] image_grid(images, 1, len(images)) #@title Settings for your newly created concept #@markdown `instance_prompt` is a prompt that should contain a good description of what your object or style is, together with the initializer word `cat_toy` instance_prompt = "<cat-toy> toy" #@param {type:"string"} #@markdown Check the `prior_preservation` option if you would like class of the concept (e.g.: toy, dog, painting) is guaranteed to be preserved. This increases the quality and helps with generalization at the cost of training time prior_preservation = False #@param {type:"boolean"} prior_preservation_class_prompt = "a photo of a cat clay toy" #@param {type:"string"} num_class_images = 12 sample_batch_size = 2 prior_loss_weight = 0.5 prior_preservation_class_folder = "./class_images" class_data_root=prior_preservation_class_folder class_prompt=prior_preservation_class_prompt<jupyter_output><empty_output><jupyter_text>Advanced settings for prior preservation (optional)<jupyter_code>num_class_images = 12 #@param {type: "number"} sample_batch_size = 2 #@markdown `prior_preservation_weight` determins how strong the class for prior preservation should be prior_loss_weight = 1 #@param {type: "number"} #@markdown If the `prior_preservation_class_folder` is empty, images for the class will be generated with the class prompt. Otherwise, fill this folder with images of items on the same class as your concept (but not images of the concept itself) prior_preservation_class_folder = "./class_images" #@param {type:"string"} class_data_root=prior_preservation_class_folder<jupyter_output><empty_output><jupyter_text>Teach the model the new concept (fine-tuning with Dreambooth)Execute this this sequence of cells to run the training process. The whole process may take from 15 min to 2 hours. (Open this block if you are interested in how this process works under the hood or if you want to change advanced training settings or hyperparameters)<jupyter_code>#@title Setup the Classes from pathlib import Path from torchvision import transforms class DreamBoothDataset(Dataset): def __init__( self, instance_data_root, instance_prompt, tokenizer, class_data_root=None, class_prompt=None, size=512, center_crop=False, ): self.size = size self.center_crop = center_crop self.tokenizer = tokenizer self.instance_data_root = Path(instance_data_root) if not self.instance_data_root.exists(): raise ValueError("Instance images root doesn't exists.") self.instance_images_path = list(Path(instance_data_root).iterdir()) self.num_instance_images = len(self.instance_images_path) self.instance_prompt = instance_prompt self._length = self.num_instance_images if class_data_root is not None: self.class_data_root = Path(class_data_root) self.class_data_root.mkdir(parents=True, exist_ok=True) self.class_images_path = list(Path(class_data_root).iterdir()) self.num_class_images = len(self.class_images_path) self._length = max(self.num_class_images, self.num_instance_images) self.class_prompt = class_prompt else: self.class_data_root = None self.image_transforms = transforms.Compose( [ transforms.Resize(size, interpolation=transforms.InterpolationMode.BILINEAR), transforms.CenterCrop(size) if center_crop else transforms.RandomCrop(size), transforms.ToTensor(), transforms.Normalize([0.5], [0.5]), ] ) def __len__(self): return self._length def __getitem__(self, index): example = {} instance_image = Image.open(self.instance_images_path[index % self.num_instance_images]) if not instance_image.mode == "RGB": instance_image = instance_image.convert("RGB") example["instance_images"] = self.image_transforms(instance_image) example["instance_prompt_ids"] = self.tokenizer( self.instance_prompt, padding="do_not_pad", truncation=True, max_length=self.tokenizer.model_max_length, ).input_ids if self.class_data_root: class_image = Image.open(self.class_images_path[index % self.num_class_images]) if not class_image.mode == "RGB": class_image = class_image.convert("RGB") example["class_images"] = self.image_transforms(class_image) example["class_prompt_ids"] = self.tokenizer( self.class_prompt, padding="do_not_pad", truncation=True, max_length=self.tokenizer.model_max_length, ).input_ids return example class PromptDataset(Dataset): def __init__(self, prompt, num_samples): self.prompt = prompt self.num_samples = num_samples def __len__(self): return self.num_samples def __getitem__(self, index): example = {} example["prompt"] = self.prompt example["index"] = index return example #@title Generate Class Images import gc if(prior_preservation): class_images_dir = Path(class_data_root) if not class_images_dir.exists(): class_images_dir.mkdir(parents=True) cur_class_images = len(list(class_images_dir.iterdir())) if cur_class_images < num_class_images: pipeline = StableDiffusionPipeline.from_pretrained( pretrained_model_name_or_path, revision="fp16", torch_dtype=torch.float16 ).to("cuda") pipeline.enable_attention_slicing() pipeline.set_progress_bar_config(disable=True) num_new_images = num_class_images - cur_class_images print(f"Number of class images to sample: {num_new_images}.") sample_dataset = PromptDataset(class_prompt, num_new_images) sample_dataloader = torch.utils.data.DataLoader(sample_dataset, batch_size=sample_batch_size) for example in tqdm(sample_dataloader, desc="Generating class images"): images = pipeline(example["prompt"]).images for i, image in enumerate(images): image.save(class_images_dir / f"{example['index'][i] + cur_class_images}.jpg") pipeline = None gc.collect() del pipeline with torch.no_grad(): torch.cuda.empty_cache() #@title Load the Stable Diffusion model # Load models and create wrapper for stable diffusion text_encoder = CLIPTextModel.from_pretrained( pretrained_model_name_or_path, subfolder="text_encoder" ) vae = AutoencoderKL.from_pretrained( pretrained_model_name_or_path, subfolder="vae" ) unet = UNet2DConditionModel.from_pretrained( pretrained_model_name_or_path, subfolder="unet" ) tokenizer = CLIPTokenizer.from_pretrained( pretrained_model_name_or_path, subfolder="tokenizer", ) #@title Setting up all training args from argparse import Namespace args = Namespace( pretrained_model_name_or_path=pretrained_model_name_or_path, resolution=vae.sample_size, center_crop=True, train_text_encoder=False, instance_data_dir=save_path, instance_prompt=instance_prompt, learning_rate=5e-06, max_train_steps=300, save_steps=50, train_batch_size=2, # set to 1 if using prior preservation gradient_accumulation_steps=2, max_grad_norm=1.0, mixed_precision="fp16", # set to "fp16" for mixed-precision training. gradient_checkpointing=True, # set this to True to lower the memory usage. use_8bit_adam=True, # use 8bit optimizer from bitsandbytes seed=3434554, with_prior_preservation=prior_preservation, prior_loss_weight=prior_loss_weight, sample_batch_size=2, class_data_dir=prior_preservation_class_folder, class_prompt=prior_preservation_class_prompt, num_class_images=num_class_images, lr_scheduler="constant", lr_warmup_steps=100, output_dir="dreambooth-concept", ) #@title Training function from accelerate.utils import set_seed def training_function(text_encoder, vae, unet): logger = get_logger(__name__) set_seed(args.seed) accelerator = Accelerator( gradient_accumulation_steps=args.gradient_accumulation_steps, mixed_precision=args.mixed_precision, ) # Currently, it's not possible to do gradient accumulation when training two models with accelerate.accumulate # This will be enabled soon in accelerate. For now, we don't allow gradient accumulation when training two models. # TODO (patil-suraj): Remove this check when gradient accumulation with two models is enabled in accelerate. if args.train_text_encoder and args.gradient_accumulation_steps > 1 and accelerator.num_processes > 1: raise ValueError( "Gradient accumulation is not supported when training the text encoder in distributed training. " "Please set gradient_accumulation_steps to 1. This feature will be supported in the future." ) vae.requires_grad_(False) if not args.train_text_encoder: text_encoder.requires_grad_(False) if args.gradient_checkpointing: unet.enable_gradient_checkpointing() if args.train_text_encoder: text_encoder.gradient_checkpointing_enable() # Use 8-bit Adam for lower memory usage or to fine-tune the model in 16GB GPUs if args.use_8bit_adam: optimizer_class = bnb.optim.AdamW8bit else: optimizer_class = torch.optim.AdamW params_to_optimize = ( itertools.chain(unet.parameters(), text_encoder.parameters()) if args.train_text_encoder else unet.parameters() ) optimizer = optimizer_class( params_to_optimize, lr=args.learning_rate, ) noise_scheduler = DDPMScheduler.from_config(args.pretrained_model_name_or_path, subfolder="scheduler") train_dataset = DreamBoothDataset( instance_data_root=args.instance_data_dir, instance_prompt=args.instance_prompt, class_data_root=args.class_data_dir if args.with_prior_preservation else None, class_prompt=args.class_prompt, tokenizer=tokenizer, size=args.resolution, center_crop=args.center_crop, ) def collate_fn(examples): input_ids = [example["instance_prompt_ids"] for example in examples] pixel_values = [example["instance_images"] for example in examples] # concat class and instance examples for prior preservation if args.with_prior_preservation: input_ids += [example["class_prompt_ids"] for example in examples] pixel_values += [example["class_images"] for example in examples] pixel_values = torch.stack(pixel_values) pixel_values = pixel_values.to(memory_format=torch.contiguous_format).float() input_ids = tokenizer.pad( {"input_ids": input_ids}, padding="max_length", return_tensors="pt", max_length=tokenizer.model_max_length ).input_ids batch = { "input_ids": input_ids, "pixel_values": pixel_values, } return batch train_dataloader = torch.utils.data.DataLoader( train_dataset, batch_size=args.train_batch_size, shuffle=True, collate_fn=collate_fn ) lr_scheduler = get_scheduler( args.lr_scheduler, optimizer=optimizer, num_warmup_steps=args.lr_warmup_steps * args.gradient_accumulation_steps, num_training_steps=args.max_train_steps * args.gradient_accumulation_steps, ) if args.train_text_encoder: unet, text_encoder, optimizer, train_dataloader, lr_scheduler = accelerator.prepare( unet, text_encoder, optimizer, train_dataloader, lr_scheduler ) else: unet, optimizer, train_dataloader, lr_scheduler = accelerator.prepare( unet, optimizer, train_dataloader, lr_scheduler ) weight_dtype = torch.float32 if accelerator.mixed_precision == "fp16": weight_dtype = torch.float16 elif accelerator.mixed_precision == "bf16": weight_dtype = torch.bfloat16 # Move text_encode and vae to gpu. # For mixed precision training we cast the text_encoder and vae weights to half-precision # as these models are only used for inference, keeping weights in full precision is not required. vae.to(accelerator.device, dtype=weight_dtype) vae.decoder.to("cpu") if not args.train_text_encoder: text_encoder.to(accelerator.device, dtype=weight_dtype) # We need to recalculate our total training steps as the size of the training dataloader may have changed. num_update_steps_per_epoch = math.ceil(len(train_dataloader) / args.gradient_accumulation_steps) num_train_epochs = math.ceil(args.max_train_steps / num_update_steps_per_epoch) # Train! total_batch_size = args.train_batch_size * accelerator.num_processes * args.gradient_accumulation_steps logger.info("***** Running training *****") logger.info(f" Num examples = {len(train_dataset)}") logger.info(f" Instantaneous batch size per device = {args.train_batch_size}") logger.info(f" Total train batch size (w. parallel, distributed & accumulation) = {total_batch_size}") logger.info(f" Gradient Accumulation steps = {args.gradient_accumulation_steps}") logger.info(f" Total optimization steps = {args.max_train_steps}") # Only show the progress bar once on each machine. progress_bar = tqdm(range(args.max_train_steps), disable=not accelerator.is_local_main_process) progress_bar.set_description("Steps") global_step = 0 for epoch in range(num_train_epochs): unet.train() for step, batch in enumerate(train_dataloader): with accelerator.accumulate(unet): # Convert images to latent space latents = vae.encode(batch["pixel_values"].to(dtype=weight_dtype)).latent_dist.sample() latents = latents * 0.18215 # Sample noise that we'll add to the latents noise = torch.randn_like(latents) bsz = latents.shape[0] # Sample a random timestep for each image timesteps = torch.randint(0, noise_scheduler.config.num_train_timesteps, (bsz,), device=latents.device) timesteps = timesteps.long() # Add noise to the latents according to the noise magnitude at each timestep # (this is the forward diffusion process) noisy_latents = noise_scheduler.add_noise(latents, noise, timesteps) # Get the text embedding for conditioning encoder_hidden_states = text_encoder(batch["input_ids"])[0] # Predict the noise residual noise_pred = unet(noisy_latents, timesteps, encoder_hidden_states).sample # Get the target for loss depending on the prediction type if noise_scheduler.config.prediction_type == "epsilon": target = noise elif noise_scheduler.config.prediction_type == "v_prediction": target = noise_scheduler.get_velocity(latents, noise, timesteps) else: raise ValueError(f"Unknown prediction type {noise_scheduler.config.prediction_type}") if args.with_prior_preservation: # Chunk the noise and noise_pred into two parts and compute the loss on each part separately. noise_pred, noise_pred_prior = torch.chunk(noise_pred, 2, dim=0) target, target_prior = torch.chunk(target, 2, dim=0) # Compute instance loss loss = F.mse_loss(noise_pred.float(), target.float(), reduction="none").mean([1, 2, 3]).mean() # Compute prior loss prior_loss = F.mse_loss(noise_pred_prior.float(), target_prior.float(), reduction="mean") # Add the prior loss to the instance loss. loss = loss + args.prior_loss_weight * prior_loss else: loss = F.mse_loss(noise_pred.float(), target.float(), reduction="mean") accelerator.backward(loss) if accelerator.sync_gradients: params_to_clip = ( itertools.chain(unet.parameters(), text_encoder.parameters()) if args.train_text_encoder else unet.parameters() ) accelerator.clip_grad_norm_(unet.parameters(), args.max_grad_norm) optimizer.step() optimizer.zero_grad() # Checks if the accelerator has performed an optimization step behind the scenes if accelerator.sync_gradients: progress_bar.update(1) global_step += 1 if global_step % args.save_steps == 0: if accelerator.is_main_process: pipeline = StableDiffusionPipeline.from_pretrained( args.pretrained_model_name_or_path, unet=accelerator.unwrap_model(unet), text_encoder=accelerator.unwrap_model(text_encoder), ) save_path = os.path.join(args.output_dir, f"checkpoint-{global_step}") pipeline.save_pretrained(save_path) logs = {"loss": loss.detach().item()} progress_bar.set_postfix(**logs) if global_step >= args.max_train_steps: break accelerator.wait_for_everyone() # Create the pipeline using using the trained modules and save it. if accelerator.is_main_process: pipeline = StableDiffusionPipeline.from_pretrained( args.pretrained_model_name_or_path, unet=accelerator.unwrap_model(unet), text_encoder=accelerator.unwrap_model(text_encoder), ) pipeline.save_pretrained(args.output_dir) #@title Run training import accelerate accelerate.notebook_launcher(training_function, args=(text_encoder, vae, unet)) for param in itertools.chain(unet.parameters(), text_encoder.parameters()): if param.grad is not None: del param.grad # free some memory torch.cuda.empty_cache()<jupyter_output>Launching training on one GPU.<jupyter_text>Run the code with your newly trained modelIf you have just trained your model with the code above, use the block below to run it.Also explore the [DreamBooth Concepts Library](https://huggingface.co/sd-dreambooth-library)<jupyter_code>#@title Save your newly created concept? you may save it privately to your personal profile or collaborate to the [library of concepts](https://huggingface.co/sd-dreambooth-library)? #@markdown If you wish your model to be avaliable for everyone, add it to the public library. If you prefer to use your model privately, add your own profile. save_concept = True #@param {type:"boolean"} #@markdown Once you save it you can use your concept by loading the model on any `from_pretrained` function name_of_your_concept = "Cat toy" #@param {type:"string"} where_to_save_concept = "public_library" #@param ["public_library", "privately_to_my_profile"] #@markdown `hf_token_write`: leave blank if you logged in with a token with `write access` in the [Initial Setup](#scrollTo=KbzZ9xe6dWwf). If not, [go to your tokens settings and create a write access token](https://huggingface.co/settings/tokens) hf_token_write = "" #@param {type:"string"} if(save_concept): from slugify import slugify from huggingface_hub import HfApi, HfFolder, CommitOperationAdd from huggingface_hub import create_repo from IPython.display import display_markdown api = HfApi() your_username = api.whoami()["name"] pipe = StableDiffusionPipeline.from_pretrained( args.output_dir, torch_dtype=torch.float16, ).to("cuda") os.makedirs("fp16_model",exist_ok=True) pipe.save_pretrained("fp16_model") if(where_to_save_concept == "public_library"): repo_id = f"sd-dreambooth-library/{slugify(name_of_your_concept)}" #Join the Concepts Library organization if you aren't part of it already !curl -X POST -H 'Authorization: Bearer '$hf_token -H 'Content-Type: application/json' https://huggingface.co/organizations/sd-dreambooth-library/share/SSeOwppVCscfTEzFGQaqpfcjukVeNrKNHX else: repo_id = f"{your_username}/{slugify(name_of_your_concept)}" output_dir = args.output_dir if(not hf_token_write): with open(HfFolder.path_token, 'r') as fin: hf_token = fin.read(); else: hf_token = hf_token_write images_upload = os.listdir("my_concept") image_string = "" #repo_id = f"sd-dreambooth-library/{slugify(name_of_your_concept)}" for i, image in enumerate(images_upload): image_string = f'''{image_string}![image {i}](https://huggingface.co/{repo_id}/resolve/main/concept_images/{image}) ''' readme_text = f'''--- license: creativeml-openrail-m tags: - text-to-image --- ### {name_of_your_concept} on Stable Diffusion via Dreambooth #### model by {api.whoami()["name"]} This your the Stable Diffusion model fine-tuned the {name_of_your_concept} concept taught to Stable Diffusion with Dreambooth. It can be used by modifying the `instance_prompt`: **{instance_prompt}** You can also train your own concepts and upload them to the library by using [this notebook](https://colab.research.google.com/github/huggingface/notebooks/blob/main/diffusers/sd_dreambooth_training.ipynb). And you can run your new concept via `diffusers`: [Colab Notebook for Inference](https://colab.research.google.com/github/huggingface/notebooks/blob/main/diffusers/sd_dreambooth_inference.ipynb), [Spaces with the Public Concepts loaded](https://huggingface.co/spaces/sd-dreambooth-library/stable-diffusion-dreambooth-concepts) Here are the images used for training this concept: {image_string} ''' #Save the readme to a file readme_file = open("README.md", "w") readme_file.write(readme_text) readme_file.close() #Save the token identifier to a file text_file = open("token_identifier.txt", "w") text_file.write(instance_prompt) text_file.close() operations = [ CommitOperationAdd(path_in_repo="token_identifier.txt", path_or_fileobj="token_identifier.txt"), CommitOperationAdd(path_in_repo="README.md", path_or_fileobj="README.md"), ] create_repo(repo_id,private=True, token=hf_token) api.create_commit( repo_id=repo_id, operations=operations, commit_message=f"Upload the concept {name_of_your_concept} embeds and token", token=hf_token ) api.upload_folder( folder_path="fp16_model", path_in_repo="", repo_id=repo_id, token=hf_token ) api.upload_folder( folder_path=save_path, path_in_repo="concept_images", repo_id=repo_id, token=hf_token ) display_markdown(f'''## Your concept was saved successfully. [Click here to access it](https://huggingface.co/{repo_id}) ''', raw=True) #@title Set up the pipeline from diffusers import DPMSolverMultistepScheduler try: pipe except NameError: pipe = StableDiffusionPipeline.from_pretrained( args.output_dir, scheduler = DPMSolverMultistepScheduler.from_pretrained(args.output_dir, subfolder="scheduler"), torch_dtype=torch.float16, ).to("cuda") #@title Run the Stable Diffusion pipeline with interactive UI Demo on Gradio #@markdown Run this cell to get an interactive demo where you can run the model using Gradio #@markdown ![](https://i.imgur.com/2ACLWu2.png) import gradio as gr def inference(prompt, num_samples): all_images = [] images = pipe(prompt, num_images_per_prompt=num_samples, num_inference_steps=25).images all_images.extend(images) return all_images with gr.Blocks() as demo: with gr.Row(): with gr.Column(): prompt = gr.Textbox(label="prompt") samples = gr.Slider(label="Samples",value=1) run = gr.Button(value="Run") with gr.Column(): gallery = gr.Gallery(show_label=False) run.click(inference, inputs=[prompt,samples], outputs=gallery) gr.Examples([["a photo of sks toy riding a bicycle", 1,1]], [prompt,samples], gallery, inference, cache_examples=False) demo.launch() #@title Run the Stable Diffusion pipeline on Colab #@markdown Don't forget to use the placeholder token in your prompt prompt = "a \u003Ccat-toy> in mad max fury road" #@param {type:"string"} num_samples = 2 #@param {type:"number"} num_rows = 1 #@param {type:"number"} all_images = [] for _ in range(num_rows): images = pipe(prompt, num_images_per_prompt=num_samples, num_inference_steps=25, guidance_scale=9).images all_images.extend(images) grid = image_grid(all_images, num_rows, num_samples) grid<jupyter_output><empty_output>
notebooks/diffusers/sd_dreambooth_training.ipynb/0
{ "file_path": "notebooks/diffusers/sd_dreambooth_training.ipynb", "repo_id": "notebooks", "token_count": 11907 }
147
#!/bin/bash #SBATCH --job-name=idefics_zero3_finetuning_multinode # name #SBATCH --nodes=2 # nodes #SBATCH --ntasks-per-node=1 # crucial - only 1 task per dist per node! #SBATCH --cpus-per-task=96 # number of cores per tasks #SBATCH --gres=gpu:8 # number of gpus #SBATCH --output=%x-%j.out # output file name export GPUS_PER_NODE=8 export MASTER_ADDR=$(scontrol show hostnames $SLURM_JOB_NODELIST | head -n 1) export MASTER_PORT=9901 source /fsx/m4/conda_installation/etc/profile.d/conda.sh conda activate /fsx/m4/conda/hugo srun --jobid $SLURM_JOBID bash -c 'python -m torch.distributed.run \ --nproc_per_node $GPUS_PER_NODE --nnodes $SLURM_NNODES --node_rank $SLURM_PROCID \ --master_addr $MASTER_ADDR --master_port $MASTER_PORT \ idefics_zero3_finetuning.py'
notebooks/examples/idefics/idefics_zero3_finetuning/slurm_script_idefics_zero3_finetuning_multinode.slurm/0
{ "file_path": "notebooks/examples/idefics/idefics_zero3_finetuning/slurm_script_idefics_zero3_finetuning_multinode.slurm", "repo_id": "notebooks", "token_count": 389 }
148
<jupyter_start><jupyter_text>Protein Folding with ESMFold and ๐Ÿค—`transformers` ESMFold ([paper link](https://www.biorxiv.org/content/10.1101/2022.07.20.500902v2)) is a recently released protein folding model from FAIR. Unlike other protein folding models, it does not require external databases or search tools to predict structures, and is up to 60X faster as a result.The port to the HuggingFace `transformers` library is even easier to use, as we've removed the dependency on tools like `openfold` - once you `pip install transformers`, you're ready to use this model! Note that all the code that follows will be running the model **locally**, rather than calling an external API. This means that no rate limiting applies here - you can predict as many structures as your computer can handle. In testing, we found that ESMFold needs about 16-24GB of GPU memory to run well, depending on protein length. This may be too much for the smaller free GPUs on Colab. First step, make sure you're up to date - you'll need the most recent release of `transformers` and `accelerate`! If you want to visualize your predicted protein structure in the notebook, you should also install py3Dmol.<jupyter_code>! pip install --upgrade transformers py3Dmol accelerate<jupyter_output><empty_output><jupyter_text>We also quickly upload some telemetry - this tells us which examples and software versions are getting used so we know where to prioritize our maintenance efforts. We don't collect (or care about) any personally identifiable information, but if you'd prefer not to be counted, feel free to skip this step or delete this cell entirely.<jupyter_code>from transformers.utils import send_example_telemetry send_example_telemetry("protein_folding_notebook", framework="pytorch")<jupyter_output><empty_output><jupyter_text>Preparing your model and tokenizer Now we load our model and tokenizer. If using GPU, use `model.cuda()` to transfer the model to GPU.<jupyter_code>from transformers import AutoTokenizer, EsmForProteinFolding tokenizer = AutoTokenizer.from_pretrained("facebook/esmfold_v1") model = EsmForProteinFolding.from_pretrained("facebook/esmfold_v1", low_cpu_mem_usage=True) model = model.cuda()<jupyter_output><empty_output><jupyter_text>Performance optimizations Since ESMFold is quite a large model, there are some considerations regarding memory usage and performance.Firstly, we can optionally convert the language model stem to float16 to improve performance and memory usage when running on a modern GPU. This was used during model training, and so should not make the outputs from the rest of the model invalid.<jupyter_code># Uncomment to switch the stem to float16 model.esm = model.esm.half()<jupyter_output><empty_output><jupyter_text>Secondly, you can enable TensorFloat32 computation for a general speedup if your hardware supports it. This line has no effect if your hardware doesn't support it.<jupyter_code>import torch torch.backends.cuda.matmul.allow_tf32 = True<jupyter_output><empty_output><jupyter_text>Finally, we can reduce the 'chunk_size' used in the folding trunk. Smaller chunk sizes use less memory, but have slightly worse performance.<jupyter_code># Uncomment this line if your GPU memory is 16GB or less, or if you're folding longer (over 600 or so) sequences model.trunk.set_chunk_size(64)<jupyter_output><empty_output><jupyter_text>Folding a single chain First, we tokenize our input. If you've used `transformers` before, proteins are processed like any other input string. Make sure **not** to add special tokens - ESM was trained with them, but ESMFold was trained without them.<jupyter_code># This is the sequence for human GNAT1, because I worked on it when # I was a postdoc and so everyone else has to learn to appreciate it too. # Feel free to substitute your own peptides of interest # Depending on memory constraints you may wish to use shorter sequences. test_protein = "MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFFEKIKKAHLSICFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF" tokenized_input = tokenizer([test_protein], return_tensors="pt", add_special_tokens=False)['input_ids']<jupyter_output><empty_output><jupyter_text>If you're using a GPU, you'll need to move the tokenized data to the GPU now.<jupyter_code>tokenized_input = tokenized_input.cuda()<jupyter_output><empty_output><jupyter_text>With our preparations out of the way, getting your model outputs is as simple as...<jupyter_code>import torch with torch.no_grad(): output = model(tokenized_input)<jupyter_output><empty_output><jupyter_text>Now here's the tricky bit - we convert the model outputs to a PDB file. This will likely be moved to a function in `transformers` in the future, but everything's still quite new, so it lives here for now! This code comes from the original ESMFold repo, and uses some functions from `openfold` that have been ported to `transformers`.<jupyter_code>from transformers.models.esm.openfold_utils.protein import to_pdb, Protein as OFProtein from transformers.models.esm.openfold_utils.feats import atom14_to_atom37 def convert_outputs_to_pdb(outputs): final_atom_positions = atom14_to_atom37(outputs["positions"][-1], outputs) outputs = {k: v.to("cpu").numpy() for k, v in outputs.items()} final_atom_positions = final_atom_positions.cpu().numpy() final_atom_mask = outputs["atom37_atom_exists"] pdbs = [] for i in range(outputs["aatype"].shape[0]): aa = outputs["aatype"][i] pred_pos = final_atom_positions[i] mask = final_atom_mask[i] resid = outputs["residue_index"][i] + 1 pred = OFProtein( aatype=aa, atom_positions=pred_pos, atom_mask=mask, residue_index=resid, b_factors=outputs["plddt"][i], chain_index=outputs["chain_index"][i] if "chain_index" in outputs else None, ) pdbs.append(to_pdb(pred)) return pdbs pdb = convert_outputs_to_pdb(output)<jupyter_output><empty_output><jupyter_text>Now we have our pdb - can we visualize it?<jupyter_code>import py3Dmol view = py3Dmol.view(js='https://3dmol.org/build/3Dmol.js', width=800, height=400) view.addModel("".join(pdb), 'pdb') view.setStyle({'model': -1}, {"cartoon": {'color': 'spectrum'}})<jupyter_output><empty_output><jupyter_text>Looks good! We can colour it differently, though - our model outputs a `plddt` field containing probabilities for each atom, indicating how confident it is in that part of the structure. In the conversion function above we added the `plddt` field in the `b_factors` argument, so it was included in our `pdb` string. Let's use it so that we can see high- and low-confidence areas of the structure visually!<jupyter_code># The plddt field is scaled from 0-1 on earlier versions of ESMFold but will be updated # to match AlphaFold's scale of 0-100 in future versions. # We check here so that this code will work on either: if torch.max(output['plddt']) <= 1.0: vmin = 0.5 vmax = 0.95 else: vmin = 50 vmax = 95 view.setStyle({'cartoon': {'colorscheme': {'prop':'b','gradient': 'roygb','min': vmin,'max': vmax}}})<jupyter_output><empty_output><jupyter_text>Blue indicates high confidence, so that's a pretty high-quality prediction! Not too surprising considering GNAT1 was almost certainly in the training data, but nevertheless good to see. Finally, we can write our PDB string out to a file, which you can download and use in other tools.<jupyter_code>with open("output_structure.pdb", "w") as f: f.write("".join(pdb))<jupyter_output><empty_output><jupyter_text>If you're running this in Colab (and haven't run out of memory by now!) then you can download the file we just created using the file browser interface at the left - the button looks like a little folder icon. Folding multiple chains Many proteins exist as complexes, either as multiple copies of the same peptide (a homopolymer), or a complex of different ones (a heteropolymer). To generate folds for such structures in ESMFold, we use a trick from the paper - we insert a "linker" of flexible glycine residues between each chain we want to fold simultaneously, and then we offset the position IDs for each chain from each other, so that the model treats them as being very distant portions of the same long chain. This works quite well, so let's see it in action! We'll use Glucosamine-6-phosphate deaminase (Uniprot: Q9CMF4) from the paper as an example. First, we define the sequence of the monomer, and the poly-G linker we want to use. Then we stick two copies of the monomer together with the linker in between.<jupyter_code>sequence = "MRLIPLHNVDQVAKWSARYIVDRINQFQPTEARPFVLGLPTGGTPLKTYEALIELYKAGEVSFKHVVTFNMDEYVGLPKEHPESYHSFMYKNFFDHVDIQEKNINILNGNTEDHDAECQRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLSSRTRIKTLTEDTLIANSRFFDNDVNKVPKYALTIGVGTLLDAEEVMILVTGYNKAQALQAAVEGSINHLWTVTALQMHRRAIIVCDEPATQELKVKTVKYFTELEASAIRSVK" linker = 'G' * 25 homodimer_sequence = sequence + linker + sequence<jupyter_output><empty_output><jupyter_text>Now we tokenize the full homodimer sequence just like we did with the monomer sequence above.<jupyter_code>tokenized_homodimer = tokenizer([homodimer_sequence], return_tensors="pt", add_special_tokens=False)<jupyter_output><empty_output><jupyter_text>Now here's the tricky bit - we need to tweak the inputs a bit so the model doesn't think this is just a single peptide. The way we do that is by using the `position_ids` input to the model. The `position_ids` input tells the model the position of each amino acid in the input chain. By default, the model assumes that you've passed it one linear, contiguous chain - in other words, if you give it a peptide with 100 amino acids, it will assume the `position_ids` are just `[0, 1, ..., 98, 99]` unless you tell it otherwise.We want to make very clear that the two subunits aren't connected, though, so let's add a large offset to the position IDs of the second chain. The original repo uses 512, so let's stick with that.<jupyter_code>with torch.no_grad(): position_ids = torch.arange(len(homodimer_sequence), dtype=torch.long) position_ids[len(sequence) + len(linker):] += 512 print(position_ids)<jupyter_output>tensor([ 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 1[...]<jupyter_text>Now we're ready to predict! Let's add our `position_ids` to the tokenized inputs, but make sure to add a singleton batch dimension first to match the other arrays in there! Once that's done we can transfer that dict to the GPU and we're ready to get our folded structure.<jupyter_code>tokenized_homodimer['position_ids'] = position_ids.unsqueeze(0) tokenized_homodimer = {key: tensor.cuda() for key, tensor in tokenized_homodimer.items()}<jupyter_output><empty_output><jupyter_text>Now we compute predictions just like before.<jupyter_code>with torch.no_grad(): output = model(**tokenized_homodimer)<jupyter_output><empty_output><jupyter_text>Next, we need to remove the poly-G linker from the output, so we can display the structure as fully independent chains. To do that, we'll alter the `atom37_atom_exists` field in the output. This field indicates, for display purposes, which atoms are present at each residue position. We will simply set all of the atoms for each of the linker residues to 0.<jupyter_code>linker_mask = torch.tensor([1] * len(sequence) + [0] * len(linker) + [1] * len(sequence))[None, :, None] output['atom37_atom_exists'] = output['atom37_atom_exists'] * linker_mask.to(output['atom37_atom_exists'].device)<jupyter_output><empty_output><jupyter_text>With those output tweaks done, now we can convert the output to PDB and view it as before.<jupyter_code>pdb = convert_outputs_to_pdb(output) view = py3Dmol.view(js='https://3dmol.org/build/3Dmol.js', width=800, height=400) view.addModel("".join(pdb), 'pdb') # The plddt field is scaled from 0-1 on earlier versions of ESMFold but will be updated # to match AlphaFold's scale of 0-100 in future versions. # We check here so that this code will work on either: if torch.max(output['plddt']) <= 1.0: vmin = 0.5 vmax = 0.95 else: vmin = 50 vmax = 95 view.setStyle({'cartoon': {'colorscheme': {'prop':'b','gradient': 'roygb','min': vmin,'max': vmax}}})<jupyter_output><empty_output><jupyter_text>And there's our dimer structure! As in the first example, we can now write this structure out to a PDB file and use it in downstream tools:<jupyter_code>with open("output_structure.pdb", "w") as f: f.write("".join(pdb))<jupyter_output><empty_output><jupyter_text>**Tip**: If you're trying to predict a multimeric structure and you're getting low-quality outputs, try varying the order of the chains (if it's a heteropolymer) or the length of the linker. Bulk predictions Predicting single structures is nice, but the great advantage of running ESMFold locally is the fact that it's extremely fast while still producing highly accurate predictions. This makes it very suitable for proteomics work. Let's see that in action here - we're going to grab a set of monomeric proteins in E. Coli from Uniprot and fold all of them with high accuracy on a single GPU in a couple of minutes (depending on your GPU!)We do this because we can, and to upset any crystallographer friends we may have. First, you may need to install `requests`, `tqdm` and `pandas` if you don't have them already, to handle the data we grab from Uniprot.<jupyter_code># Uncomment and run this cell to install #! pip install requests pandas tqdm<jupyter_output><empty_output><jupyter_text>Next, let's prepare the URL for our Uniprot query.<jupyter_code>import requests uniprot_url = "https://rest.uniprot.org/uniprotkb/stream?compressed=true&fields=accession%2Csequence&format=tsv&query=%28%28taxonomy_id%3A83333%29%20AND%20%28reviewed%3Atrue%29%20AND%20%28length%3A%5B128%20TO%20512%5D%29%20AND%20%28cc_subunit%3Amonomer%29%29"<jupyter_output><empty_output><jupyter_text>This uniprot URL might seem mysterious, but it isn't! To get it, we searched for `(taxonomy_id:83333) AND (reviewed:true) AND (length:[128 TO 512]) AND (cc_subunit:monomer)` on UniProt to get all monomeric E.coli proteins of reasonable length, then selected 'Download', and set the format to TSV and the columns to `Sequence`.Once that's done, selecting `Generate URL for API` gives you a URL you can pass to Requests. Alternatively, if you're not on Colab you can just download the data through the web interface and open the file locally.<jupyter_code>uniprot_request = requests.get(uniprot_url)<jupyter_output><empty_output><jupyter_text>To get this data into Pandas, we use a `BytesIO` object, which Pandas will treat like a file. If you downloaded the data as a file you can skip this bit and just pass the filepath directly to `read_csv`.<jupyter_code>from io import BytesIO import pandas bio = BytesIO(uniprot_request.content) df = pandas.read_csv(bio, compression='gzip', sep='\t') df = df.dropna() # Remove empty columns, just in case df<jupyter_output><empty_output><jupyter_text>If you have time, you could process this entire list, giving you folded structures for the entire monomeric proteome of E. Coli. For the sake of this demo, though, let's limit ourselves to 10:<jupyter_code>df = df.iloc[:10]<jupyter_output><empty_output><jupyter_text>Now let's pull out the sequences and batch-tokenize all of them.<jupyter_code>ecoli_tokenized = tokenizer(df.Sequence.tolist(), padding=False, add_special_tokens=False)['input_ids']<jupyter_output><empty_output><jupyter_text>Now we loop over our tokenized data, passing each sequence into our model:<jupyter_code>from tqdm import tqdm outputs = [] with torch.no_grad(): for input_ids in tqdm(ecoli_tokenized): input_ids = torch.tensor(input_ids, device='cuda').unsqueeze(0) output = model(input_ids) outputs.append({key: val.cpu() for key, val in output.items()})<jupyter_output>100%|โ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆ| 10/10 [02:04<00:00, 12.40s/it]<jupyter_text>Now we have 10 model outputs, which we can convert to PDB in bulk. If you get an error here, make sure you've run the cell above that defines the convert_outputs_to_pdb function!<jupyter_code>pdb_list = [convert_outputs_to_pdb(output) for output in outputs]<jupyter_output><empty_output><jupyter_text>Let's inspect one of them to see what we got.<jupyter_code>import py3Dmol view = py3Dmol.view(js='https://3dmol.org/build/3Dmol.js', width=800, height=400) view.addModel("".join(pdb_list[0]), 'pdb') # The plddt field is scaled from 0-1 on earlier versions of ESMFold but will be updated # to match AlphaFold's scale of 0-100 in future versions. # We check here so that this code will work on either: if torch.max(output['plddt']) <= 1.0: vmin = 0.5 vmax = 0.95 else: vmin = 50 vmax = 95 view.setStyle({'cartoon': {'colorscheme': {'prop':'b','gradient': 'roygb','min': vmin,'max': vmax}}})<jupyter_output><empty_output><jupyter_text>Looks good to me! Now we can save all of these to disc together.<jupyter_code>protein_identifiers = df.Entry.tolist() for identifier, pdb in zip(protein_identifiers, pdb_list): with open(f"{identifier}.pdb", "w") as f: f.write("".join(pdb))<jupyter_output><empty_output>
notebooks/examples/protein_folding.ipynb/0
{ "file_path": "notebooks/examples/protein_folding.ipynb", "repo_id": "notebooks", "token_count": 6321 }
149
from transformers import ViTForImageClassification, Trainer, TrainingArguments,default_data_collator,ViTFeatureExtractor from datasets import load_from_disk,load_metric import random import logging import sys import argparse import os import numpy as np import subprocess subprocess.run([ "git", "config", "--global", "user.email", "[email protected]", ], check=True) subprocess.run([ "git", "config", "--global", "user.name", "sagemaker", ], check=True) if __name__ == "__main__": parser = argparse.ArgumentParser() # hyperparameters sent by the client are passed as command-line arguments to the script. parser.add_argument("--model_name", type=str) parser.add_argument("--output_dir", type=str,default="/opt/ml/model") parser.add_argument("--extra_model_name", type=str,default="sagemaker") parser.add_argument("--dataset", type=str,default="cifar10") parser.add_argument("--task", type=str,default="image-classification") parser.add_argument("--use_auth_token", type=str, default="") parser.add_argument("--num_train_epochs", type=int, default=3) parser.add_argument("--per_device_train_batch_size", type=int, default=32) parser.add_argument("--per_device_eval_batch_size", type=int, default=64) parser.add_argument("--warmup_steps", type=int, default=500) parser.add_argument("--weight_decay", type=float, default=0.01) parser.add_argument("--learning_rate", type=str, default=2e-5) parser.add_argument("--training_dir", type=str, default=os.environ["SM_CHANNEL_TRAIN"]) parser.add_argument("--test_dir", type=str, default=os.environ["SM_CHANNEL_TEST"]) args, _ = parser.parse_known_args() # Set up logging logger = logging.getLogger(__name__) logging.basicConfig( level=logging.getLevelName("INFO"), handlers=[logging.StreamHandler(sys.stdout)], format="%(asctime)s - %(name)s - %(levelname)s - %(message)s", ) # load datasets train_dataset = load_from_disk(args.training_dir) test_dataset = load_from_disk(args.test_dir) num_classes = train_dataset.features["label"].num_classes logger.info(f" loaded train_dataset length is: {len(train_dataset)}") logger.info(f" loaded test_dataset length is: {len(test_dataset)}") metric_name = "accuracy" # compute metrics function for binary classification metric = load_metric(metric_name) def compute_metrics(eval_pred): predictions, labels = eval_pred predictions = np.argmax(predictions, axis=1) return metric.compute(predictions=predictions, references=labels) # download model from model hub model = ViTForImageClassification.from_pretrained(args.model_name,num_labels=num_classes) # change labels id2label = {key:train_dataset.features["label"].names[index] for index,key in enumerate(model.config.id2label.keys())} label2id = {train_dataset.features["label"].names[index]:value for index,value in enumerate(model.config.label2id.values())} model.config.id2label = id2label model.config.label2id = label2id # define training args training_args = TrainingArguments( output_dir=args.output_dir, num_train_epochs=args.num_train_epochs, per_device_train_batch_size=args.per_device_train_batch_size, per_device_eval_batch_size=args.per_device_eval_batch_size, warmup_steps=args.warmup_steps, weight_decay=args.weight_decay, evaluation_strategy="epoch", logging_dir=f"{args.output_dir}/logs", learning_rate=float(args.learning_rate), load_best_model_at_end=True, metric_for_best_model=metric_name, ) # create Trainer instance trainer = Trainer( model=model, args=training_args, compute_metrics=compute_metrics, train_dataset=train_dataset, eval_dataset=test_dataset, data_collator=default_data_collator, ) # train model trainer.train() # evaluate model eval_result = trainer.evaluate(eval_dataset=test_dataset) # writes eval result to file which can be accessed later in s3 ouput with open(os.path.join(args.output_dir, "eval_results.txt"), "w") as writer: print(f"***** Eval results *****") for key, value in sorted(eval_result.items()): writer.write(f"{key} = {value}\n") # Saves the model to s3 trainer.save_model(args.output_dir) if args.use_auth_token != "": kwargs = { "finetuned_from": args.model_name.split("/")[1], "tags": "image-classification", "dataset": args.dataset, } repo_name = ( f"{args.model_name.split('/')[1]}-{args.task}" if args.extra_model_name == "" else f"{args.model_name.split('/')[1]}-{args.task}-{args.extra_model_name}" ) trainer.push_to_hub( repo_name=repo_name, use_auth_token=args.use_auth_token, **kwargs, )
notebooks/sagemaker/09_image_classification_vision_transformer/scripts/train.py/0
{ "file_path": "notebooks/sagemaker/09_image_classification_vision_transformer/scripts/train.py", "repo_id": "notebooks", "token_count": 2150 }
150
<jupyter_start><jupyter_text>Hugging Face Transformers BERT fine-tuning using Amazon SageMaker and Training Compiler Compile and fine-tune a Multi-Class Classification Transformers with `Trainer` and `emotion` dataset using Amazon SageMaker Training Compiler Introduction SageMaker Training Compiler Overview[SageMaker Training Compiler](https://docs.aws.amazon.com/sagemaker/latest/dg/training-compiler.html) optimizes DL models to accelerate training by more efficiently using SageMaker machine learning (ML) GPU instances. SageMaker Training Compiler is available at no additional charge within SageMaker and can help reduce total billable time as it accelerates training.SageMaker Training Compiler is integrated into the AWS Deep Learning Containers (DLCs). Using the SageMaker Training Compiler enabled AWS DLCs, you can compile and optimize training jobs on GPU instances with minimal changes to your code. In this demo, we will use the Hugging Faces `transformers` and `datasets` library together with Amazon SageMaker and the new Amazon SageMaker Training Compiler to fine-tune a pre-trained transformer for multi-class text classification. In particular, the pre-trained model will be fine-tuned using the `emotion` dataset. To get started, we need to set up the environment with a few prerequisite steps, for permissions, configurations, and so on. _**NOTE: You can run this demo in Sagemaker Studio, your local machine or Sagemaker Notebook Instances**_ Development Environment and Permissions Installation_*Note:* we only install the required libraries from Hugging Face and AWS. You also need PyTorch or Tensorflow, if you havenยดt it installed_<jupyter_code>!pip install "sagemaker>=2.70.0" "transformers==4.11.0" --upgrade # using older dataset due to incompatibility of sagemaker notebook & aws-cli with > s3fs and fsspec to >= 2021.10 !pip install "datasets==1.13" --upgrade import sagemaker assert sagemaker.__version__ >= "2.70.0" import sagemaker.huggingface<jupyter_output><empty_output><jupyter_text>Permissions _If you are going to use Sagemaker in a local environment. You need access to an IAM Role with the required permissions for Sagemaker. You can find [here](https://docs.aws.amazon.com/sagemaker/latest/dg/sagemaker-roles.html) more about it._<jupyter_code>import sagemaker sess = sagemaker.Session() # sagemaker session bucket -> used for uploading data, models and logs # sagemaker will automatically create this bucket if it not exists sagemaker_session_bucket=None if sagemaker_session_bucket is None and sess is not None: # set to default bucket if a bucket name is not given sagemaker_session_bucket = sess.default_bucket() role = sagemaker.get_execution_role() sess = sagemaker.Session(default_bucket=sagemaker_session_bucket) print(f"sagemaker role arn: {role}") print(f"sagemaker bucket: {sess.default_bucket()}") print(f"sagemaker session region: {sess.boto_region_name}")<jupyter_output><empty_output><jupyter_text>PreprocessingWe are using the `datasets` library to download and preprocess the `emotion` dataset. After preprocessing, the dataset will be uploaded to our `sagemaker_session_bucket` to be used within our training job. The [emotion](https://github.com/dair-ai/emotion_dataset) dataset consists of 16000 training examples, 2000 validation examples, and 2000 testing examples. Tokenization<jupyter_code>from datasets import load_dataset from transformers import AutoTokenizer # tokenizer used in preprocessing model_id = 'bert-base-uncased' # dataset used dataset_name = 'emotion' # s3 key prefix for the data s3_prefix = 'samples/datasets/emotion' # download tokenizer tokenizer = AutoTokenizer.from_pretrained(model_id) # tokenizer helper function def tokenize(batch): return tokenizer(batch['text'], padding='max_length', truncation=True) # load dataset train_dataset, test_dataset = load_dataset(dataset_name, split=['train', 'test']) # tokenize dataset train_dataset = train_dataset.map(tokenize, batched=True) test_dataset = test_dataset.map(tokenize, batched=True) # set format for pytorch train_dataset = train_dataset.rename_column("label", "labels") train_dataset.set_format('torch', columns=['input_ids', 'attention_mask', 'labels']) test_dataset = test_dataset.rename_column("label", "labels") test_dataset.set_format('torch', columns=['input_ids', 'attention_mask', 'labels'])<jupyter_output>Downloading: 3.62kB [00:00, 629kB/s] Downloading: 3.28kB [00:00, 998kB/s] Using custom data configuration default Reusing dataset emotion (/Users/philipp/.cache/huggingface/datasets/emotion/default/0.0.0/348f63ca8e27b3713b6c04d723efe6d824a56fb3d1449794716c0f0296072705) 100%|โ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆ| 2/2 [00:00<00:00, 99.32it/s] 100%|โ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆ| 16/16 [00:02<00:00, 7.47ba/s] 100%|โ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆโ–ˆ| 2/2 [00:00<00:00, 6.47ba/s]<jupyter_text>Uploading data to `sagemaker_session_bucket`After we processed the `datasets` we are going to use the new `FileSystem` [integration](https://huggingface.co/docs/datasets/filesystems.html) to upload our dataset to S3.<jupyter_code>import botocore from datasets.filesystems import S3FileSystem s3 = S3FileSystem() # save train_dataset to s3 training_input_path = f's3://{sess.default_bucket()}/{s3_prefix}/train' train_dataset.save_to_disk(training_input_path, fs=s3) # save test_dataset to s3 test_input_path = f's3://{sess.default_bucket()}/{s3_prefix}/test' test_dataset.save_to_disk(test_input_path, fs=s3)<jupyter_output><empty_output><jupyter_text>Creating an Estimator and start a training job The Amazon Training Compiler works best with Encoder Type models, like `BERT`, `RoBERTa`, `ALBERT`, `DistilBERT`. The Model compilation using Amazon SageMaker Training compiler increases efficiency and lowers the memory footprint of your Transformers model, which allows larger batch sizes and more efficient and faster training. We tested long classification tasks with `BERT`, `DistilBERT` and `RoBERTa and achieved up 33% higher batch sizes and 1.4x faster Training. For best performance, set batch size to a multiple of 8. The longer your training job, the larger the benefit of using Amazon SageMaker Training Compiler. 30 minutes seems to be the sweet spot to offset model compilation time in the beginning of your training. Initial pre-training jobs are excellent candidates for using the new Amazon SageMaker Training Compiler.<jupyter_code>from sagemaker.huggingface import HuggingFace, TrainingCompilerConfig # initialize the Amazon Training Compiler compiler_config=TrainingCompilerConfig() # hyperparameters, which are passed into the training job hyperparameters={'epochs': 4, # number of training epochs 'train_batch_size': 24, # batch size for training 'eval_batch_size': 32, # batch size for evaluation 'learning_rate': 3e-5, # learning rate used during training 'model_id':model_id, # pre-trained model 'fp16': True, # Whether to use 16-bit (mixed) precision training } # job name for sagemaker training job_name=f"training-compiler-{hyperparameters['model_id']}-{dataset_name}"<jupyter_output><empty_output><jupyter_text>Create a `SageMakerEstimator` with the `SageMakerTrainingCompiler` and the `hyperparemters`, instance configuration and training script.<jupyter_code># create the Estimator huggingface_estimator = HuggingFace( entry_point = 'train.py', # fine-tuning script used in training jon source_dir = './scripts', # directory where fine-tuning script is stored instance_type = 'ml.p3.2xlarge', # instances type used for the training job instance_count = 1, # the number of instances used for training base_job_name = job_name, # the name of the training job role = role, # Iam role used in training job to access AWS ressources, e.g. S3 transformers_version = '4.11.0', # the transformers version used in the training job pytorch_version = '1.9.0', # the pytorch_version version used in the training job py_version = 'py38', # the python version used in the training job hyperparameters = hyperparameters, # the hyperparameter used for running the training job compiler_config = compiler_config, # the compiler configuration used in the training job disable_profiler = True, # whether to disable the profiler during training used to gain maximum performance debugger_hook_config = False, # whether to enable the debugger hook during training used to gain maximum performance )<jupyter_output><empty_output><jupyter_text>Start the training with the uploaded datsets on s3 with `huggingface_estimator.fit()`.<jupyter_code># define a data input dictonary with our uploaded s3 uris data = { 'train': training_input_path, 'test': test_input_path } # starting the train job with our uploaded datasets as input huggingface_estimator.fit(data)<jupyter_output><empty_output><jupyter_text>Deploying the endpointTo deploy our endpoint, we call `deploy()` on our HuggingFace estimator object, passing in our desired number of instances and instance type.<jupyter_code>predictor = huggingface_estimator.deploy(1,"ml.g4dn.xlarge")<jupyter_output><empty_output><jupyter_text>Then, we use the returned predictor object to call the endpoint.<jupyter_code>sentiment_input= {"inputs": "Winter is coming and it will be dark soon."} predictor.predict(sentiment_input)<jupyter_output><empty_output><jupyter_text>Finally, we delete the inference endpoint.<jupyter_code>predictor.delete_endpoint()<jupyter_output><empty_output>
notebooks/sagemaker/15_training_compiler/sagemaker-notebook.ipynb/0
{ "file_path": "notebooks/sagemaker/15_training_compiler/sagemaker-notebook.ipynb", "repo_id": "notebooks", "token_count": 3361 }
151
<jupyter_start><jupyter_text>Automatic Speech Recogntion with Hugging Face's Transformers & Amazon SageMaker Transformer models are changing the world of machine learning, starting with natural language processing, and now, with audio and computer vision. Hugging Face's mission is to democratize good machine learning and give anyone the opportunity to use these new state-of-the-art machine learning models. Together with Amazon SageMaker and AWS have we been working on extending the functionalities of the Hugging Face Inference DLC and the Python SageMaker SDK to make it easier to use speech and vision models together with `transformers`. You can now use the Hugging Face Inference DLC to do [automatic speech recognition](https://huggingface.co/tasks/automatic-speech-recognition) using MetaAIs [wav2vec2](https://arxiv.org/abs/2006.11477) model or Microsofts [WavLM](https://arxiv.org/abs/2110.13900) or use NVIDIAs [SegFormer](https://arxiv.org/abs/2105.15203) for [semantic segmentation](https://huggingface.co/tasks/image-segmentation).This guide will walk you through how to do [automatic speech recognition](https://huggingface.co/tasks/automatic-speech-recognition) using [wav2veec2](https://huggingface.co/facebook/wav2vec2-base-960h) and new `DataSerializer`.In this example you will learn how to: 1. Setup a development Environment and permissions for deploying Amazon SageMaker Inference Endpoints.2. Deploy a wav2vec2 model to Amazon SageMaker for automatic speech recogntion3. Send requests to the endpoint to do speech recognition. Let's get started! ๐Ÿš€---*If you are going to use Sagemaker in a local environment (not SageMaker Studio or Notebook Instances). You need access to an IAM Role with the required permissions for Sagemaker. You can findย [here](https://docs.aws.amazon.com/sagemaker/latest/dg/sagemaker-roles.html)ย more about it.* 1. Setup a development Environment and permissions for deploying Amazon SageMaker Inference Endpoints.Setting up the development environment and permissions needs to be done for the automatic-speech-recognition example and the semantic-segmentation example. First we update the `sagemaker` SDK to make sure we have new `DataSerializer`.<jupyter_code>%pip install sagemaker --upgrade<jupyter_output><empty_output><jupyter_text>After we have update the SDK we can set the permissions._If you are going to use Sagemaker in a local environment (not SageMaker Studio or Notebook Instances). You need access to an IAM Role with the required permissions for Sagemaker. You can find [here](https://docs.aws.amazon.com/sagemaker/latest/dg/sagemaker-roles.html) more about it._<jupyter_code>import sagemaker import boto3 sess = sagemaker.Session() # sagemaker session bucket -> used for uploading data, models and logs # sagemaker will automatically create this bucket if it not exists sagemaker_session_bucket=None if sagemaker_session_bucket is None and sess is not None: # set to default bucket if a bucket name is not given sagemaker_session_bucket = sess.default_bucket() try: role = sagemaker.get_execution_role() except ValueError: iam = boto3.client('iam') role = iam.get_role(RoleName='sagemaker_execution_role')['Role']['Arn'] sess = sagemaker.Session(default_bucket=sagemaker_session_bucket) print(f"sagemaker role arn: {role}") print(f"sagemaker bucket: {sess.default_bucket()}") print(f"sagemaker session region: {sess.boto_region_name}")<jupyter_output>sagemaker role arn: arn:aws:iam::558105141721:role/sagemaker_execution_role sagemaker bucket: sagemaker-us-east-1-558105141721 sagemaker session region: us-east-1<jupyter_text>2. Deploy a wav2vec2 model to Amazon SageMaker for automatic speech recogntionAutomatic Speech Recognition (ASR), also known as Speech to Text (STT), is the task of transcribing a given audio to text. It has many applications, such as voice user interfaces.We use the [facebook/wav2vec2-base-960h](https://huggingface.co/facebook/wav2vec2-base-960h) model running our recognition endpoint. This model is a fine-tune checkpoint of [facebook/wav2vec2-base](https://huggingface.co/facebook/wav2vec2-base) pretrained and fine-tuned on 960 hours of Librispeech on 16kHz sampled speech audio achieving 1.8/3.3 WER on the clean/other test sets.<jupyter_code>from sagemaker.huggingface.model import HuggingFaceModel from sagemaker.serializers import DataSerializer # Hub Model configuration. <https://huggingface.co/models> hub = { 'HF_MODEL_ID':'facebook/wav2vec2-base-960h', 'HF_TASK':'automatic-speech-recognition', } # create Hugging Face Model Class huggingface_model = HuggingFaceModel( env=hub, # configuration for loading model from Hub role=role, # iam role with permissions to create an Endpoint transformers_version="4.26", # transformers version used pytorch_version="1.13", # pytorch version used py_version='py39', # python version used )<jupyter_output><empty_output><jupyter_text>Before we are able to deploy our `HuggingFaceModel` class we need to create a new serializer, which supports our audio data. The Serializer are used in Predictor and in the `predict` method to serializer our data to a specific `mime-type`, which send to the endpoint. The default serialzier for the HuggingFacePredcitor is a JSNON serializer, but since we are not going to send text data to the endpoint we will use the DataSerializer.<jupyter_code># create a serializer for the data audio_serializer = DataSerializer(content_type='audio/x-audio') # using x-audio to support multiple audio formats # deploy model to SageMaker Inference predictor = huggingface_model.deploy( initial_instance_count=1, # number of instances instance_type='ml.g4dn.xlarge', # ec2 instance type serializer=audio_serializer, # serializer for our audio data. )<jupyter_output>-----------!<jupyter_text>3. Send requests to the endpoint to do speech recognition.The `.deploy()` returns an `HuggingFacePredictor` object with our `DataSeriliazer` which can be used to request inference. This `HuggingFacePredictor` makes it easy to send requests to your endpoint and get the results back.We will use 3 different methods to send requests to the endpoint:a. Provide a audio file via path to the predictor b. Provide binary audio data object to the predictor a. Provide a audio file via path to the predictorUsing a audio file as input is easy as easy as providing the path to its location. The `DataSerializer` will then read it and send the bytes to the endpoint. We can use a `libirispeech` sample hosted on huggingface.co<jupyter_code>!wget https://cdn-media.huggingface.co/speech_samples/sample1.flac<jupyter_output>--2023-03-21 08:27:32-- https://cdn-media.huggingface.co/speech_samples/sample1.flac Resolving cdn-media.huggingface.co (cdn-media.huggingface.co)... 18.160.46.12, 18.160.46.81, 18.160.46.78, ... Connecting to cdn-media.huggingface.co (cdn-media.huggingface.co)|18.160.46.12|:443... connected. HTTP request sent, awaiting response... 200 OK Length: 282378 (276K) [audio/flac] Saving to: โ€˜sample1.flacโ€™ 100%[======================================>] 282,378 --.-K/s in 0.004s 2023-03-21 08:27:32 (69.1 MB/s) - โ€˜sample1.flacโ€™ saved [282378/282378]<jupyter_text>To send a request with provide our path to the audio file we can use the following code:<jupyter_code>audio_path = "sample1.flac" res = predictor.predict(data=audio_path) print(res)<jupyter_output>{'text': "GOING ALONG SLUSHY COUNTRY ROADS AND SPEAKING TO DAMP AUDIENCES IN DRAUGHTY SCHOOL ROOMS DAY AFTER DAY FOR A FORTNIGHT HE'LL HAVE TO PUT IN AN APPEARANCE AT SOME PLACE OF WORSHIP ON SUNDAY MORNING AND HE CAN COME TO US IMMEDIATELY AFTERWARDS"}<jupyter_text>b. Provide binary audio data object to the predictorInstead of providing a path to the audio file we can also directy provide the bytes of it reading the file in python._make sure `sample1.flac` is in the directory_<jupyter_code>audio_path = "sample1.flac" with open(audio_path, "rb") as data_file: audio_data = data_file.read() res = predictor.predict(data=audio_data) print(res)<jupyter_output>{'text': "GOING ALONG SLUSHY COUNTRY ROADS AND SPEAKING TO DAMP AUDIENCES IN DRAUGHTY SCHOOL ROOMS DAY AFTER DAY FOR A FORTNIGHT HE'LL HAVE TO PUT IN AN APPEARANCE AT SOME PLACE OF WORSHIP ON SUNDAY MORNING AND HE CAN COME TO US IMMEDIATELY AFTERWARDS"}<jupyter_text>Clean up<jupyter_code>predictor.delete_model() predictor.delete_endpoint()<jupyter_output><empty_output>
notebooks/sagemaker/20_automatic_speech_recognition_inference/sagemaker-notebook.ipynb/0
{ "file_path": "notebooks/sagemaker/20_automatic_speech_recognition_inference/sagemaker-notebook.ipynb", "repo_id": "notebooks", "token_count": 2639 }
152
<jupyter_start><jupyter_text>How to deploy Large Language Models (LLMs) to Amazon SageMaker using new Hugging Face LLM DLCThis is an example on how to deploy the open-source LLMs, like [BLOOM](bigscience/bloom) to Amazon SageMaker for inference using the new Hugging Face LLM Inference Container. We will deploy the 12B [Open Assistant Model](OpenAssistant/pythia-12b-sft-v8-7k-steps) an open-source Chat LLM trained by the Open Assistant initativeThe example covers:1. [Setup development environment](1-setup-development-environment)2. [Retrieve the new Hugging Face LLM DLC](2-retrieve-the-new-hugging-face-llm-dlc)3. [Deploy Open Assistant 12B to Amazon SageMaker](3-deploy-open-assistant-12b-to-amazon-sagemaker)4. [Run inference and chat with our model](4-run-inference-and-chat-with-our-model)5. [Clean up](5-clean-up) What is Hugging Face LLM Inference DLC?Hugging Face LLM DLC is a new purpose-built Inference Container to easily deploy LLMs in a secure and managed environment. The DLC is powered by [Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference), an open-source, purpose-built solution for deploying and serving Large Language Models (LLMs). TGI enables high-performance text generation using Tensor Parallelism and dynamic batching for the most popular open-source LLMs, including StarCoder, BLOOM, GPT-NeoX, Llama, and T5. Text Generation Inference is already used by customers such as IBM, Grammarly, and the Open-Assistant initiative implements optimization for all supported model architectures, including:* Tensor Parallelism and custom cuda kernels* Optimized transformers code for inference using [flash-attention](https://github.com/HazyResearch/flash-attention) on the most popular architectures* Quantization with [bitsandbytes](https://github.com/TimDettmers/bitsandbytes)* [Continuous batching of incoming requests](https://github.com/huggingface/text-generation-inference/tree/main/router) for increased total throughput* Accelerated weight loading (start-up time) with [safetensors](https://github.com/huggingface/safetensors)* Logits warpers (temperature scaling, topk, repetition penalty ...)* Watermarking with [A Watermark for Large Language Models](https://arxiv.org/abs/2301.10226)* Stop sequences, Log probabilities* Token streaming using Server-Sent Events (SSE)Officially supported model architectures are currently: * [BLOOM](https://huggingface.co/bigscience/bloom) / [BLOOMZ](https://huggingface.co/bigscience/bloomz)* [MT0-XXL](https://huggingface.co/bigscience/mt0-xxl)* [Galactica](https://huggingface.co/facebook/galactica-120b)* [SantaCoder](https://huggingface.co/bigcode/santacoder)* [GPT-Neox 20B](https://huggingface.co/EleutherAI/gpt-neox-20b) (joi, pythia, lotus, rosey, chip, RedPajama, open assistant)* [FLAN-T5-XXL](https://huggingface.co/google/flan-t5-xxl) (T5-11B)* [Llama](https://github.com/facebookresearch/llama) (vicuna, alpaca, koala)* [Starcoder](https://huggingface.co/bigcode/starcoder) / [SantaCoder](https://huggingface.co/bigcode/santacoder)* [Falcon 7B](https://huggingface.co/tiiuae/falcon-7b) / [Falcon 40B](https://huggingface.co/tiiuae/falcon-40b)With the new Hugging Face LLM Inference DLCs on Amazon SageMaker, AWS customers can benefit from the same technologies that power highly concurrent, low latency LLM experiences like [HuggingChat](https://hf.co/chat), [OpenAssistant](https://open-assistant.io/), and Inference API for LLM models on the Hugging Face Hub. Lets get started! 1. Setup development environmentWe are going to use the `sagemaker` python SDK to deploy BLOOM to Amazon SageMaker. We need to make sure to have an AWS account configured and the `sagemaker` python SDK installed.<jupyter_code>!pip install "sagemaker==2.163.0" --upgrade --quiet<jupyter_output><empty_output><jupyter_text>If you are going to use Sagemaker in a local environment. You need access to an IAM Role with the required permissions for Sagemaker. You can find [here](https://docs.aws.amazon.com/sagemaker/latest/dg/sagemaker-roles.html) more about it.<jupyter_code>import sagemaker import boto3 sess = sagemaker.Session() # sagemaker session bucket -> used for uploading data, models and logs # sagemaker will automatically create this bucket if it not exists sagemaker_session_bucket=None if sagemaker_session_bucket is None and sess is not None: # set to default bucket if a bucket name is not given sagemaker_session_bucket = sess.default_bucket() try: role = sagemaker.get_execution_role() except ValueError: iam = boto3.client('iam') role = iam.get_role(RoleName='sagemaker_execution_role')['Role']['Arn'] sess = sagemaker.Session(default_bucket=sagemaker_session_bucket) print(f"sagemaker role arn: {role}") print(f"sagemaker session region: {sess.boto_region_name}")<jupyter_output>Couldn't call 'get_role' to get Role ARN from role name philippschmid to get Role path.<jupyter_text>2. Retrieve the new Hugging Face LLM DLCCompared to deploying regular Hugging Face models we first need to retrieve the container uri and provide it to our `HuggingFaceModel` model class with a `image_uri` pointing to the image. To retrieve the new Hugging Face LLM DLC in Amazon SageMaker, we can use the `get_huggingface_llm_image_uri` method provided by the `sagemaker` SDK. This method allows us to retrieve the URI for the desired Hugging Face LLM DLC based on the specified `backend`, `session`, `region`, and `version`. You can find the available versions [here](https://github.com/aws/deep-learning-containers/blob/master/available_images.mdhuggingface-text-generation-inference-containers)<jupyter_code>from sagemaker.huggingface import get_huggingface_llm_image_uri # retrieve the llm image uri llm_image = get_huggingface_llm_image_uri( "huggingface", version="0.8.2" ) # print ecr image uri print(f"llm image uri: {llm_image}")<jupyter_output>llm image uri: 763104351884.dkr.ecr.us-east-1.amazonaws.com/huggingface-pytorch-tgi-inference:2.0.0-tgi0.6.0-gpu-py39-cu118-ubuntu20.04<jupyter_text>3. Deploy Deploy Open Assistant 12B to Amazon SageMakerTo deploy [Open Assistant Model](OpenAssistant/pythia-12b-sft-v8-7k-steps) to Amazon SageMaker we create a `HuggingFaceModel` model class and define our endpoint configuration including the `hf_model_id`, `instance_type` etc. We will use a `g5.12xlarge` instance type, which has 4 NVIDIA A10G GPUs and 96GB of GPU memory._Note: We could also optimize the deployment for cost and use `g5.2xlarge` instance type and enable int-8 quantization._<jupyter_code>import json from sagemaker.huggingface import HuggingFaceModel # sagemaker config instance_type = "ml.g5.12xlarge" number_of_gpu = 4 health_check_timeout = 300 # Define Model and Endpoint configuration parameter config = { 'HF_MODEL_ID': "OpenAssistant/pythia-12b-sft-v8-7k-steps", # model_id from hf.co/models 'SM_NUM_GPUS': json.dumps(number_of_gpu), # Number of GPU used per replica 'MAX_INPUT_LENGTH': json.dumps(1024), # Max length of input text 'MAX_TOTAL_TOKENS': json.dumps(2048), # Max length of the generation (including input text) # 'HF_MODEL_QUANTIZE': "bitsandbytes", # comment in to quantize } # create HuggingFaceModel with the image uri llm_model = HuggingFaceModel( role=role, image_uri=llm_image, env=config )<jupyter_output><empty_output><jupyter_text>After we have created the `HuggingFaceModel` we can deploy it to Amazon SageMaker using the `deploy` method. We will deploy the model with the `ml.g5.12xlarge` instance type. TGI will automatically distribute and shard the model across all GPUs.<jupyter_code># Deploy model to an endpoint # https://sagemaker.readthedocs.io/en/stable/api/inference/model.html#sagemaker.model.Model.deploy llm = llm_model.deploy( initial_instance_count=1, instance_type=instance_type, # volume_size=400, # If using an instance with local SSD storage, volume_size must be None, e.g. p4 but not p3 container_startup_health_check_timeout=health_check_timeout, # 10 minutes to be able to load the model )<jupyter_output>-------------!<jupyter_text>SageMaker will now create our endpoint and deploy the model to it. This can takes a 10-15 minutes. 4. Run inference and chat with our modelAfter our endpoint is deployed we can run inference on it. We will use the `predict` method from the `predictor` to run inference on our endpoint. We can inference with different parameters to impact the generation. Parameters can be defined as in the `parameters` attribute of the payload. As of today the TGI supports the following parameters:* `temperature`: Controls randomness in the model. Lower values will make the model more deterministic and higher values will make the model more random. Default value is 1.0.* `max_new_tokens`: The maximum number of tokens to generate. Default value is 20, max value is 512.* `repetition_penalty`: Controls the likelihood of repetition, defaults to `null`.* `seed`: The seed to use for random generation, default is `null`.* `stop`: A list of tokens to stop the generation. The generation will stop when one of the tokens is generated.* `top_k`: The number of highest probability vocabulary tokens to keep for top-k-filtering. Default value is `null`, which disables top-k-filtering.* `top_p`: The cumulative probability of parameter highest probability vocabulary tokens to keep for nucleus sampling, default to `null`* `do_sample`: Whether or not to use sampling ; use greedy decoding otherwise. Default value is `false`.* `best_of`: Generate best_of sequences and return the one if the highest token logprobs, default to `null`.* `details`: Whether or not to return details about the generation. Default value is `false`.* `return_full_text`: Whether or not to return the full text or only the generated part. Default value is `false`.* `truncate`: Whether or not to truncate the input to the maximum length of the model. Default value is `true`.* `typical_p`: The typical probability of a token. Default value is `null`.* `watermark`: The watermark to use for the generation. Default value is `false`.You can find the open api specification of the TGI in the [swagger documentation](https://huggingface.github.io/text-generation-inference/)The `OpenAssistant/pythia-12b-sft-v8-7k-steps` is a conversational chat model meaning we can chat with it using the following prompt: ```[Instruction]```lets give it a first try and ask about some cool ideas to do in the summer:<jupyter_code>chat = llm.predict({ "inputs": """<|prompter|>What are some cool ideas to do in the summer?<|endoftext|><|assistant|>""" }) print(chat[0]["generated_text"])<jupyter_output><|prompter|>What are some cool ideas to do in the summer?<|endoftext|><|assistant|>There are many fun and exciting things you can do in the summer. Here are some ideas:<jupyter_text>Now we will run inference with different parameters to impact the generation. Parameters can be defined as in the `parameters` attribute of the payload. This can be used to have the model stop the generation after the turn of the `bot`.<jupyter_code># define payload prompt="""<|prompter|>How can i stay more active during winter? Give me 3 tips.<|endoftext|><|assistant|>""" # hyperparameters for llm payload = { "inputs": prompt, "parameters": { "do_sample": True, "top_p": 0.7, "temperature": 0.7, "top_k": 50, "max_new_tokens": 256, "repetition_penalty": 1.03, "stop": ["<|endoftext|>"] } } # send request to endpoint response = llm.predict(payload) # print(response[0]["generated_text"][:-len("<human>:")]) print(response[0]["generated_text"])<jupyter_output><|prompter|>How can i stay more active during winter? Give me 3 tips.<|endoftext|><|assistant|>1. Get outside and go for a walk in the snow! 2. Go sledding! 3. Go skiing!<jupyter_text>Nice, now lets build a quick gradio application to chat with it.<jupyter_code>!pip install gradio --upgrade import gradio as gr # hyperparameters for llm parameters = { "do_sample": True, "top_p": 0.7, "temperature": 0.7, "top_k": 50, "max_new_tokens": 256, "repetition_penalty": 1.03, "stop": ["<|endoftext|>"] } with gr.Blocks() as demo: gr.Markdown("## Chat with Amazon SageMaker") with gr.Column(): chatbot = gr.Chatbot() with gr.Row(): with gr.Column(): message = gr.Textbox(label="Chat Message Box", placeholder="Chat Message Box", show_label=False) with gr.Column(): with gr.Row(): submit = gr.Button("Submit") clear = gr.Button("Clear") def respond(message, chat_history): # convert chat history to prompt converted_chat_history = "" if len(chat_history) > 0: for c in chat_history: converted_chat_history += f"<|prompter|>{c[0]}<|endoftext|><|assistant|>{c[1]}<|endoftext|>" prompt = f"{converted_chat_history}<|prompter|>{message}<|endoftext|><|assistant|>" # send request to endpoint llm_response = llm.predict({"inputs": prompt, "parameters": parameters}) # remove prompt from response parsed_response = llm_response[0]["generated_text"][len(prompt):] chat_history.append((message, parsed_response)) return "", chat_history submit.click(respond, [message, chatbot], [message, chatbot], queue=False) clear.click(lambda: None, None, chatbot, queue=False) demo.launch(share=True)<jupyter_output>Running on local URL: http://127.0.0.1:7862 Running on public URL: https://48c4c5606be32ee0a0.gradio.live This share link expires in 72 hours. For free permanent hosting and GPU upgrades (NEW!), check out Spaces: https://huggingface.co/spaces<jupyter_text>Awesome! ๐Ÿš€ We have successfully deployed Open Assistant Model to Amazon SageMaker and run inference on it. Additionally, we have built a quick gradio application to chat with our model. Now, its time for you to try it out yourself and build Generation AI applications with the new Hugging Face LLM DLC on Amazon SageMaker. 6. Clean upTo clean up, we can delete the model and endpoint.<jupyter_code>llm.delete_model() llm.delete_endpoint()<jupyter_output><empty_output>
notebooks/sagemaker/27_deploy_large_language_models/sagemaker-notebook.ipynb/0
{ "file_path": "notebooks/sagemaker/27_deploy_large_language_models/sagemaker-notebook.ipynb", "repo_id": "notebooks", "token_count": 4572 }
153
<!--Copyright 2023 The HuggingFace Team. All rights reserved. Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License. โš ๏ธ Note that this file is in Markdown but contain specific syntax for our doc-builder (similar to MDX) that may not be rendered properly in your Markdown viewer. --> # Contributing to PEFT We are happy to accept contributions to PEFT. If you plan to contribute, please read this document to make the process as smooth as possible. ## Installation The installation instructions can be found [here](https://huggingface.co/docs/peft/install). If you want to provide code contributions to PEFT, you should choose the "source" installation method. If you are new to creating a pull request, follow [these instructions from GitHub](https://docs.github.com/en/pull-requests/collaborating-with-pull-requests/proposing-changes-to-your-work-with-pull-requests/creating-a-pull-request). ## Running tests and code quality checks Regardless of the type of contribution (unless itโ€™s only about the docs), you should run tests and code quality checks before creating a PR to ensure that your contribution doesnโ€™t break anything and follows the standards of the project. We provide a Makefile to facilitate those steps. Run the code below for the unit test: ```sh make test ``` Run one of the following to either check or check and fix code quality and style: ```sh make quality # just check make style # check and fix ``` Running all the tests can take a couple of minutes. Therefore, during development, it can be useful to run only those tests specific to your change: ```sh pytest tests/ -k <name-of-test> ``` This should finish much quicker and allow faster iteration. Before creating the PR, however, please still run the whole test suite, as some changes can inadvertently break tests that at first glance are unrelated. If your change is specific to a hardware setting (e.g. it requires CUDA), take a look at `tests/test_gpu_examples.py` and `tests/test_common_gpu.py` โ€“ maybe it makes sense to add a test there. If your change could have an effect on saving and loading models, please run the tests with the `--regression` flag to trigger regression tests. It can happen that while youโ€™re working on your PR, the underlying code base changes due to other changes being merged. If that happens โ€“ especially when there is a merge conflict โ€“ please update your branch to be on the latest changes. This can be a merge or a rebase, whatever you prefer. We will squash and merge the PR once itโ€™s ready. ## PR description When opening the PR, please provide a nice description of the change you provide. If it relates to other issues or PRs, please reference them. Providing a good description will not only help the reviewers review your code better and faster, it can also later be used (as a basis) for the commit message, which helps with long term maintenance of the project. If your code makes some non-trivial changes, it can also be a good idea to add comments to the code to explain those changes. For example, if you had to iterate on your implementation multiple times because the most obvious way didnโ€™t work, itโ€™s a good indication that a code comment is needed. ## Providing a bugfix Please give a description of the circumstances that lead to the bug. If there is an existing issue, please link to it (e.g. โ€œResolves #12345โ€). Ideally, when a bugfix is provided, it should be accompanied by a test for this bug. The test should fail with the current code and pass with the bugfix. Add a comment to the test that references the issue or PR. Without such a test, it is difficult to prevent regressions in the future. ## Adding a new fine-tuning method New parameter-efficient fine-tuning methods are developed all the time. If you would like to add a new, promising method to PEFT, please follow these steps. **Requirements** 1. Please add a link to the source (usually a paper) of the method. 2. Some evidence should be provided that there is general interest in using the method. We will not add new methods that are freshly published but without evidence that there is demand for it. 3. Ideally, we want to not only add the implementation of the new method, but also examples (notebooks, scripts), documentation, and an extensive test suite that proves that the method works with a variety of tasks. However, this can be very daunting. Therefore, it is also acceptable to only provide the implementation and at least one working example. Documentation and tests can be added in follow up PRs. **Steps** Before you start to implement the new method, please open an issue on GitHub with your proposal. That way, the maintainers can give you some early feedback. When implementing the method, it makes sense to look for existing implementations that already exist as a guide. Moreover, when you structure your code, please take inspiration from the other PEFT methods. For example, if your method is similar to LoRA, it makes sense to structure your code similarly or even re-use some functions or classes where it makes sense (but donโ€™t overdo it, some code duplication is okay). Once you have something that seems to be working, donโ€™t hesitate to create a draft PR, even if itโ€™s not in a mergeable state yet. The maintainers will be happy to give you feedback and guidance along the way. ## Adding other features It is best if you first open an issue on GitHub with a proposal to add the new feature. That way, you can discuss with the maintainers if it makes sense to add the feature before spending too much time on implementing it. New features should generally be accompanied by tests and documentation or examples. Without the latter, users will have a hard time discovering your cool new feature. Changes to the code should be implemented in a backward-compatible way. For example, existing code should continue to work the same way after the feature is merged.
peft/docs/source/developer_guides/contributing.md/0
{ "file_path": "peft/docs/source/developer_guides/contributing.md", "repo_id": "peft", "token_count": 1510 }
154
<!--โš ๏ธ Note that this file is in Markdown but contain specific syntax for our doc-builder (similar to MDX) that may not be rendered properly in your Markdown viewer. --> # LoRA for semantic similarity tasks Low-Rank Adaptation (LoRA) is a reparametrization method that aims to reduce the number of trainable parameters with low-rank representations. The weight matrix is broken down into low-rank matrices that are trained and updated. All the pretrained model parameters remain frozen. After training, the low-rank matrices are added back to the original weights. This makes it more efficient to store and train a LoRA model because there are significantly fewer parameters. <Tip> ๐Ÿ’ก Read [LoRA: Low-Rank Adaptation of Large Language Models](https://arxiv.org/abs/2106.09685) to learn more about LoRA. </Tip> In this guide, we'll be using a LoRA [script](https://github.com/huggingface/peft/tree/main/examples/lora_dreambooth) to fine-tune a [`intfloat/e5-large-v2`](https://huggingface.co/intfloat/e5-large-v2) model on the [`smangrul/amazon_esci`](https://huggingface.co/datasets/smangrul/amazon_esci) dataset for semantic similarity tasks. Feel free to explore the script to learn how things work in greater detail! ## Setup Start by installing ๐Ÿค— PEFT from [source](https://github.com/huggingface/peft), and then navigate to the directory containing the training scripts for fine-tuning DreamBooth with LoRA: ```bash cd peft/examples/feature_extraction ``` Install all the necessary required libraries with: ```bash pip install -r requirements.txt ``` Next, import all the necessary libraries: - ๐Ÿค— Transformers for loading the `intfloat/e5-large-v2` model and tokenizer - ๐Ÿค— Accelerate for the training loop - ๐Ÿค— Datasets for loading and preparing the `smangrul/amazon_esci` dataset for training and inference - ๐Ÿค— Evaluate for evaluating the model's performance - ๐Ÿค— PEFT for setting up the LoRA configuration and creating the PEFT model - ๐Ÿค— huggingface_hub for uploading the trained model to HF hub - hnswlib for creating the search index and doing fast approximate nearest neighbor search <Tip> It is assumed that PyTorch with CUDA support is already installed. </Tip> ## Train Launch the training script with `accelerate launch` and pass your hyperparameters along with the `--use_peft` argument to enable LoRA. This guide uses the following [`LoraConfig`]: ```py peft_config = LoraConfig( r=8, lora_alpha=16, bias="none", task_type=TaskType.FEATURE_EXTRACTION, target_modules=["key", "query", "value"], ) ``` Here's what a full set of script arguments may look like when running in Colab on a V100 GPU with standard RAM: ```bash accelerate launch \ --mixed_precision="fp16" \ peft_lora_embedding_semantic_search.py \ --dataset_name="smangrul/amazon_esci" \ --max_length=70 --model_name_or_path="intfloat/e5-large-v2" \ --per_device_train_batch_size=64 \ --per_device_eval_batch_size=128 \ --learning_rate=5e-4 \ --weight_decay=0.0 \ --num_train_epochs 3 \ --gradient_accumulation_steps=1 \ --output_dir="results/peft_lora_e5_ecommerce_semantic_search_colab" \ --seed=42 \ --push_to_hub \ --hub_model_id="smangrul/peft_lora_e5_ecommerce_semantic_search_colab" \ --with_tracking \ --report_to="wandb" \ --use_peft \ --checkpointing_steps "epoch" ``` ## Dataset for semantic similarity The dataset we'll be using is a small subset of the [esci-data](https://github.com/amazon-science/esci-data.git) dataset (it can be found on Hub at [smangrul/amazon_esci](https://huggingface.co/datasets/smangrul/amazon_esci)). Each sample contains a tuple of `(query, product_title, relevance_label)` where `relevance_label` is `1` if the product matches the intent of the `query`, otherwise it is `0`. Our task is to build an embedding model that can retrieve semantically similar products given a product query. This is usually the first stage in building a product search engine to retrieve all the potentially relevant products of a given query. Typically, this involves using Bi-Encoder models to cross-join the query and millions of products which could blow up quickly. Instead, you can use a Transformer model to retrieve the top K nearest similar products for a given query by embedding the query and products in the same latent embedding space. The millions of products are embedded offline to create a search index. At run time, only the query is embedded by the model, and products are retrieved from the search index with a fast approximate nearest neighbor search library such as [FAISS](https://github.com/facebookresearch/faiss) or [HNSWlib](https://github.com/nmslib/hnswlib). The next stage involves reranking the retrieved list of products to return the most relevant ones; this stage can utilize cross-encoder based models as the cross-join between the query and a limited set of retrieved products. The diagram below from [awesome-semantic-search](https://github.com/rom1504/awesome-semantic-search) outlines a rough semantic search pipeline: <div class="flex justify-center"> <img src="https://huggingface.co/datasets/huggingface/documentation-images/resolve/main/peft/semantic_search_pipeline.png" alt="Semantic Search Pipeline"/> </div> For this task guide, we will explore the first stage of training an embedding model to predict semantically similar products given a product query. ## Training script deep dive We finetune [e5-large-v2](https://huggingface.co/intfloat/e5-large-v2) which tops the [MTEB benchmark](https://huggingface.co/spaces/mteb/leaderboard) using PEFT-LoRA. [`AutoModelForSentenceEmbedding`] returns the query and product embeddings, and the `mean_pooling` function pools them across the sequence dimension and normalizes them: ```py class AutoModelForSentenceEmbedding(nn.Module): def __init__(self, model_name, tokenizer, normalize=True): super(AutoModelForSentenceEmbedding, self).__init__() self.model = AutoModel.from_pretrained(model_name) self.normalize = normalize self.tokenizer = tokenizer def forward(self, **kwargs): model_output = self.model(**kwargs) embeddings = self.mean_pooling(model_output, kwargs["attention_mask"]) if self.normalize: embeddings = torch.nn.functional.normalize(embeddings, p=2, dim=1) return embeddings def mean_pooling(self, model_output, attention_mask): token_embeddings = model_output[0] # First element of model_output contains all token embeddings input_mask_expanded = attention_mask.unsqueeze(-1).expand(token_embeddings.size()).float() return torch.sum(token_embeddings * input_mask_expanded, 1) / torch.clamp(input_mask_expanded.sum(1), min=1e-9) def __getattr__(self, name: str): """Forward missing attributes to the wrapped module.""" try: return super().__getattr__(name) # defer to nn.Module's logic except AttributeError: return getattr(self.model, name) def get_cosine_embeddings(query_embs, product_embs): return torch.sum(query_embs * product_embs, axis=1) def get_loss(cosine_score, labels): return torch.mean(torch.square(labels * (1 - cosine_score) + torch.clamp((1 - labels) * cosine_score, min=0.0))) ``` The `get_cosine_embeddings` function computes the cosine similarity and the `get_loss` function computes the loss. The loss enables the model to learn that a cosine score of `1` for query and product pairs is relevant, and a cosine score of `0` or below is irrelevant. Define the [`PeftConfig`] with your LoRA hyperparameters, and create a [`PeftModel`]. We use ๐Ÿค— Accelerate for handling all device management, mixed precision training, gradient accumulation, WandB tracking, and saving/loading utilities. ## Results The table below compares the training time, the batch size that could be fit in Colab, and the best ROC-AUC scores between a PEFT model and a fully fine-tuned model: | Training Type | Training time per epoch (Hrs) | Batch Size that fits | ROC-AUC score (higher is better) | | ----------------- | ------------- | ---------- | -------- | | Pre-Trained e5-large-v2 | - | - | 0.68 | | PEFT | 1.73 | 64 | 0.787 | | Full Fine-Tuning | 2.33 | 32 | 0.7969 | The PEFT-LoRA model trains **1.35X** faster and can fit **2X** batch size compared to the fully fine-tuned model, and the performance of PEFT-LoRA is comparable to the fully fine-tuned model with a relative drop of **-1.24%** in ROC-AUC. This gap can probably be closed with bigger models as mentioned in [The Power of Scale for Parameter-Efficient Prompt Tuning ](https://huggingface.co/papers/2104.08691). ## Inference Let's go! Now we have the model, we need to create a search index of all the products in our catalog. Please refer to `peft_lora_embedding_semantic_similarity_inference.ipynb` for the complete inference code. 1. Get a list of ids to products which we can call `ids_to_products_dict`: ```bash {0: 'RamPro 10" All Purpose Utility Air Tires/Wheels with a 5/8" Diameter Hole with Double Sealed Bearings (Pack of 2)', 1: 'MaxAuto 2-Pack 13x5.00-6 2PLY Turf Mower Tractor Tire with Yellow Rim, (3" Centered Hub, 3/4" Bushings )', 2: 'NEIKO 20601A 14.5 inch Steel Tire Spoon Lever Iron Tool Kit | Professional Tire Changing Tool for Motorcycle, Dirt Bike, Lawn Mower | 3 pcs Tire Spoons | 3 Rim Protector | Valve Tool | 6 Valve Cores', 3: '2PK 13x5.00-6 13x5.00x6 13x5x6 13x5-6 2PLY Turf Mower Tractor Tire with Gray Rim', 4: '(Set of 2) 15x6.00-6 Husqvarna/Poulan Tire Wheel Assy .75" Bearing', 5: 'MaxAuto 2 Pcs 16x6.50-8 Lawn Mower Tire for Garden Tractors Ridings, 4PR, Tubeless', 6: 'Dr.Roc Tire Spoon Lever Dirt Bike Lawn Mower Motorcycle Tire Changing Tools with Durable Bag 3 Tire Irons 2 Rim Protectors 1 Valve Stems Set TR412 TR413', 7: 'MARASTAR 21446-2PK 15x6.00-6" Front Tire Assembly Replacement-Craftsman Mower, Pack of 2', 8: '15x6.00-6" Front Tire Assembly Replacement for 100 and 300 Series John Deere Riding Mowers - 2 pack', 9: 'Honda HRR Wheel Kit (2 Front 44710-VL0-L02ZB, 2 Back 42710-VE2-M02ZE)', 10: 'Honda 42710-VE2-M02ZE (Replaces 42710-VE2-M01ZE) Lawn Mower Rear Wheel Set of 2' ... ``` 2. Use the trained [smangrul/peft_lora_e5_ecommerce_semantic_search_colab](https://huggingface.co/smangrul/peft_lora_e5_ecommerce_semantic_search_colab) model to get the product embeddings: ```py # base model model = AutoModelForSentenceEmbedding(model_name_or_path, tokenizer) # peft config and wrapping model = PeftModel.from_pretrained(model, peft_model_id) device = "cuda" model.to(device) model.eval() model = model.merge_and_unload() import numpy as np num_products= len(dataset) d = 1024 product_embeddings_array = np.zeros((num_products, d)) for step, batch in enumerate(tqdm(dataloader)): with torch.no_grad(): with torch.amp.autocast(dtype=torch.bfloat16, device_type="cuda"): product_embs = model(**{k:v.to(device) for k, v in batch.items()}).detach().float().cpu() start_index = step*batch_size end_index = start_index+batch_size if (start_index+batch_size) < num_products else num_products product_embeddings_array[start_index:end_index] = product_embs del product_embs, batch ``` 3. Create a search index using HNSWlib: ```py def construct_search_index(dim, num_elements, data): # Declaring index search_index = hnswlib.Index(space = 'ip', dim = dim) # possible options are l2, cosine or ip # Initializing index - the maximum number of elements should be known beforehand search_index.init_index(max_elements = num_elements, ef_construction = 200, M = 100) # Element insertion (can be called several times): ids = np.arange(num_elements) search_index.add_items(data, ids) return search_index product_search_index = construct_search_index(d, num_products, product_embeddings_array) ``` 4. Get the query embeddings and nearest neighbors: ```py def get_query_embeddings(query, model, tokenizer, device): inputs = tokenizer(query, padding="max_length", max_length=70, truncation=True, return_tensors="pt") model.eval() with torch.no_grad(): query_embs = model(**{k:v.to(device) for k, v in inputs.items()}).detach().cpu() return query_embs[0] def get_nearest_neighbours(k, search_index, query_embeddings, ids_to_products_dict, threshold=0.7): # Controlling the recall by setting ef: search_index.set_ef(100) # ef should always be > k # Query dataset, k - number of the closest elements (returns 2 numpy arrays) labels, distances = search_index.knn_query(query_embeddings, k = k) return [(ids_to_products_dict[label], (1-distance)) for label, distance in zip(labels[0], distances[0]) if (1-distance)>=threshold] ``` 5. Let's test it out with the query `deep learning books`: ```py query = "deep learning books" k = 10 query_embeddings = get_query_embeddings(query, model, tokenizer, device) search_results = get_nearest_neighbours(k, product_search_index, query_embeddings, ids_to_products_dict, threshold=0.7) print(f"{query=}") for product, cosine_sim_score in search_results: print(f"cosine_sim_score={round(cosine_sim_score,2)} {product=}") ``` Output: ```bash query='deep learning books' cosine_sim_score=0.95 product='Deep Learning (The MIT Press Essential Knowledge series)' cosine_sim_score=0.93 product='Practical Deep Learning: A Python-Based Introduction' cosine_sim_score=0.9 product='Hands-On Machine Learning with Scikit-Learn and TensorFlow: Concepts, Tools, and Techniques to Build Intelligent Systems' cosine_sim_score=0.9 product='Machine Learning: A Hands-On, Project-Based Introduction to Machine Learning for Absolute Beginners: Mastering Engineering ML Systems using Scikit-Learn and TensorFlow' cosine_sim_score=0.9 product='Mastering Machine Learning on AWS: Advanced machine learning in Python using SageMaker, Apache Spark, and TensorFlow' cosine_sim_score=0.9 product='The Hundred-Page Machine Learning Book' cosine_sim_score=0.89 product='Hands-On Machine Learning with Scikit-Learn, Keras, and TensorFlow: Concepts, Tools, and Techniques to Build Intelligent Systems' cosine_sim_score=0.89 product='Machine Learning: A Journey from Beginner to Advanced Including Deep Learning, Scikit-learn and Tensorflow' cosine_sim_score=0.88 product='Mastering Machine Learning with scikit-learn' cosine_sim_score=0.88 product='Mastering Machine Learning with scikit-learn - Second Edition: Apply effective learning algorithms to real-world problems using scikit-learn' ``` Books on deep learning and machine learning are retrieved even though `machine learning` wasn't included in the query. This means the model has learned that these books are semantically relevant to the query based on the purchase behavior of customers on Amazon. The next steps would ideally involve using ONNX/TensorRT to optimize the model and using a Triton server to host it. Check out ๐Ÿค— [Optimum](https://huggingface.co/docs/optimum/index) for related optimizations for efficient serving!
peft/docs/source/task_guides/semantic-similarity-lora.md/0
{ "file_path": "peft/docs/source/task_guides/semantic-similarity-lora.md", "repo_id": "peft", "token_count": 5002 }
155
<jupyter_start><jupyter_code>from transformers import AutoModelForSeq2SeqLM from peft import get_peft_config, get_peft_model, get_peft_model_state_dict, LoraConfig, TaskType import torch from datasets import load_dataset import os os.environ["TOKENIZERS_PARALLELISM"] = "false" from transformers import AutoTokenizer from torch.utils.data import DataLoader from transformers import default_data_collator, get_linear_schedule_with_warmup from tqdm import tqdm from datasets import load_dataset device = "cuda" model_name_or_path = "bigscience/mt0-large" tokenizer_name_or_path = "bigscience/mt0-large" checkpoint_name = "financial_sentiment_analysis_lora_v1.pt" text_column = "sentence" label_column = "text_label" max_length = 128 lr = 1e-3 num_epochs = 3 batch_size = 8 # creating model peft_config = LoraConfig(task_type=TaskType.SEQ_2_SEQ_LM, inference_mode=False, r=8, lora_alpha=32, lora_dropout=0.1) model = AutoModelForSeq2SeqLM.from_pretrained(model_name_or_path) model = get_peft_model(model, peft_config) model.print_trainable_parameters() model # loading dataset dataset = load_dataset("financial_phrasebank", "sentences_allagree") dataset = dataset["train"].train_test_split(test_size=0.1) dataset["validation"] = dataset["test"] del dataset["test"] classes = dataset["train"].features["label"].names dataset = dataset.map( lambda x: {"text_label": [classes[label] for label in x["label"]]}, batched=True, num_proc=1, ) dataset["train"][0] # data preprocessing tokenizer = AutoTokenizer.from_pretrained(model_name_or_path) def preprocess_function(examples): inputs = examples[text_column] targets = examples[label_column] model_inputs = tokenizer(inputs, max_length=max_length, padding="max_length", truncation=True, return_tensors="pt") labels = tokenizer(targets, max_length=3, padding="max_length", truncation=True, return_tensors="pt") labels = labels["input_ids"] labels[labels == tokenizer.pad_token_id] = -100 model_inputs["labels"] = labels return model_inputs processed_datasets = dataset.map( preprocess_function, batched=True, num_proc=1, remove_columns=dataset["train"].column_names, load_from_cache_file=False, desc="Running tokenizer on dataset", ) train_dataset = processed_datasets["train"] eval_dataset = processed_datasets["validation"] train_dataloader = DataLoader( train_dataset, shuffle=True, collate_fn=default_data_collator, batch_size=batch_size, pin_memory=True ) eval_dataloader = DataLoader(eval_dataset, collate_fn=default_data_collator, batch_size=batch_size, pin_memory=True) # optimizer and lr scheduler optimizer = torch.optim.AdamW(model.parameters(), lr=lr) lr_scheduler = get_linear_schedule_with_warmup( optimizer=optimizer, num_warmup_steps=0, num_training_steps=(len(train_dataloader) * num_epochs), ) # training and evaluation model = model.to(device) for epoch in range(num_epochs): model.train() total_loss = 0 for step, batch in enumerate(tqdm(train_dataloader)): batch = {k: v.to(device) for k, v in batch.items()} outputs = model(**batch) loss = outputs.loss total_loss += loss.detach().float() loss.backward() optimizer.step() lr_scheduler.step() optimizer.zero_grad() model.eval() eval_loss = 0 eval_preds = [] for step, batch in enumerate(tqdm(eval_dataloader)): batch = {k: v.to(device) for k, v in batch.items()} with torch.no_grad(): outputs = model(**batch) loss = outputs.loss eval_loss += loss.detach().float() eval_preds.extend( tokenizer.batch_decode(torch.argmax(outputs.logits, -1).detach().cpu().numpy(), skip_special_tokens=True) ) eval_epoch_loss = eval_loss / len(eval_dataloader) eval_ppl = torch.exp(eval_epoch_loss) train_epoch_loss = total_loss / len(train_dataloader) train_ppl = torch.exp(train_epoch_loss) print(f"{epoch=}: {train_ppl=} {train_epoch_loss=} {eval_ppl=} {eval_epoch_loss=}") # print accuracy correct = 0 total = 0 for pred, true in zip(eval_preds, dataset["validation"]["text_label"]): if pred.strip() == true.strip(): correct += 1 total += 1 accuracy = correct / total * 100 print(f"{accuracy=} % on the evaluation dataset") print(f"{eval_preds[:10]=}") print(f"{dataset['validation']['text_label'][:10]=}") # saving model peft_model_id = f"{model_name_or_path}_{peft_config.peft_type}_{peft_config.task_type}" model.save_pretrained(peft_model_id) ckpt = f"{peft_model_id}/adapter_model.bin" !du -h $ckpt from peft import PeftModel, PeftConfig peft_model_id = f"{model_name_or_path}_{peft_config.peft_type}_{peft_config.task_type}" config = PeftConfig.from_pretrained(peft_model_id) model = AutoModelForSeq2SeqLM.from_pretrained(config.base_model_name_or_path) model = PeftModel.from_pretrained(model, peft_model_id) model.eval() i = 13 inputs = tokenizer(dataset["validation"][text_column][i], return_tensors="pt") print(dataset["validation"][text_column][i]) print(inputs) with torch.no_grad(): outputs = model.generate(input_ids=inputs["input_ids"], max_new_tokens=10) print(outputs) print(tokenizer.batch_decode(outputs.detach().cpu().numpy(), skip_special_tokens=True))<jupyter_output>- Demand for fireplace products was lower than expected , especially in Germany . {'input_ids': tensor([[ 259, 264, 259, 82903, 332, 1090, 10040, 10371, 639, 259, 19540, 2421, 259, 25505, 259, 261, 259, 21230, 281, 17052, 259, 260, 1]]), 'attention_mask': tensor([[1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1]])} tensor([[ 0, 259, 32588, 1]]) ['negative']
peft/examples/conditional_generation/peft_lora_seq2seq.ipynb/0
{ "file_path": "peft/examples/conditional_generation/peft_lora_seq2seq.ipynb", "repo_id": "peft", "token_count": 2336 }
156
<jupyter_start><jupyter_text>Fine-tune large models using ๐Ÿค— `peft` adapters, `transformers` & `bitsandbytes`In this tutorial we will cover how we can fine-tune large language models using the very recent `peft` library and `bitsandbytes` for loading large models in 8-bit.The fine-tuning method will rely on a recent method called "Low Rank Adapters" (LoRA), instead of fine-tuning the entire model you just have to fine-tune these adapters and load them properly inside the model. After fine-tuning the model you can also share your adapters on the ๐Ÿค— Hub and load them very easily. Let's get started! Install requirementsFirst, run the cells below to install the requirements:<jupyter_code>!pip install -q bitsandbytes datasets accelerate !pip install -q git+https://github.com/huggingface/transformers.git@main git+https://github.com/huggingface/peft.git<jupyter_output> โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ” 76.3/76.3 MB 10.3 MB/s eta 0:00:00  โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ” 462.8/462.8 KB 25.4 MB/s eta 0:00:00  โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ” 199.7/199.7 KB 25.5 MB/s eta 0:00:00  โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ” 190.3/190.3 KB 23.1 MB/s eta 0:00:00  โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ” 213.0/213.0 KB 26.4 MB/s eta 0:00:00  โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ” 132.0/132.0 KB 18.5 MB/s eta 0:00:00  โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ”โ” 140.6/140.6 KB 20.2 MB/s eta 0:00:00 [?25h Installing build dependencies ... [?25l[?25hdone Getting requirements to build wheel ... [?25l[?25hdone Preparing metadata (pyproject.tom[...]<jupyter_text>Model loadingHere let's load the `opt-6.7b` model, its weights in half-precision (float16) are about 13GB on the Hub! If we load them in 8-bit we would require around 7GB of memory instead.<jupyter_code>import os import torch import torch.nn as nn import bitsandbytes as bnb from transformers import AutoTokenizer, AutoConfig, AutoModelForCausalLM model = AutoModelForCausalLM.from_pretrained("facebook/opt-6.7b", load_in_8bit=True) tokenizer = AutoTokenizer.from_pretrained("facebook/opt-6.7b")<jupyter_output><empty_output><jupyter_text>Prepare model for trainingSome pre-processing needs to be done before training such an int8 model using `peft`, therefore let's import an utiliy function `prepare_model_for_int8_training` that will: - Casts all the non `int8` modules to full precision (`fp32`) for stability- Add a `forward_hook` to the input embedding layer to enable gradient computation of the input hidden states- Enable gradient checkpointing for more memory-efficient training<jupyter_code>from peft import prepare_model_for_int8_training model = prepare_model_for_int8_training(model)<jupyter_output><empty_output><jupyter_text>Apply LoRAHere comes the magic with `peft`! Let's load a `PeftModel` and specify that we are going to use low-rank adapters (LoRA) using `get_peft_model` utility function from `peft`.<jupyter_code>def print_trainable_parameters(model): """ Prints the number of trainable parameters in the model. """ trainable_params = 0 all_param = 0 for _, param in model.named_parameters(): all_param += param.numel() if param.requires_grad: trainable_params += param.numel() print( f"trainable params: {trainable_params} || all params: {all_param} || trainable%: {100 * trainable_params / all_param}" ) from peft import LoraConfig, get_peft_model config = LoraConfig( r=16, lora_alpha=32, target_modules=["q_proj", "v_proj"], lora_dropout=0.05, bias="none", task_type="CAUSAL_LM" ) model = get_peft_model(model, config) print_trainable_parameters(model)<jupyter_output>trainable params: 8388608 || all params: 6666862592 || trainable%: 0.12582542214183376<jupyter_text>Training<jupyter_code>import transformers from datasets import load_dataset data = load_dataset("Abirate/english_quotes") data = data.map(lambda samples: tokenizer(samples["quote"]), batched=True) trainer = transformers.Trainer( model=model, train_dataset=data["train"], args=transformers.TrainingArguments( per_device_train_batch_size=4, gradient_accumulation_steps=4, warmup_steps=100, max_steps=200, learning_rate=2e-4, fp16=True, logging_steps=1, output_dir="outputs", ), data_collator=transformers.DataCollatorForLanguageModeling(tokenizer, mlm=False), ) model.config.use_cache = False # silence the warnings. Please re-enable for inference! trainer.train()<jupyter_output><empty_output><jupyter_text>Share adapters on the ๐Ÿค— Hub<jupyter_code>from huggingface_hub import notebook_login notebook_login() model.push_to_hub("ybelkada/opt-6.7b-lora", use_auth_token=True)<jupyter_output>Uploading the following files to ybelkada/opt-6.7b-lora: adapter_config.json,adapter_model.bin<jupyter_text>Load adapters from the HubYou can also directly load adapters from the Hub using the commands below:<jupyter_code>import torch from peft import PeftModel, PeftConfig from transformers import AutoModelForCausalLM, AutoTokenizer peft_model_id = "ybelkada/opt-6.7b-lora" config = PeftConfig.from_pretrained(peft_model_id) model = AutoModelForCausalLM.from_pretrained( config.base_model_name_or_path, return_dict=True, load_in_8bit=True, device_map="auto" ) tokenizer = AutoTokenizer.from_pretrained(config.base_model_name_or_path) # Load the Lora model model = PeftModel.from_pretrained(model, peft_model_id)<jupyter_output><empty_output><jupyter_text>InferenceYou can then directly use the trained model or the model that you have loaded from the ๐Ÿค— Hub for inference as you would do it usually in `transformers`.<jupyter_code>batch = tokenizer("Two things are infinite: ", return_tensors="pt") with torch.cuda.amp.autocast(): output_tokens = model.generate(**batch, max_new_tokens=50) print("\n\n", tokenizer.decode(output_tokens[0], skip_special_tokens=True))<jupyter_output>/home/marc/anaconda3/envs/accelerate/lib/python3.10/site-packages/transformers/generation/utils.py:1448: UserWarning: You are calling .generate() with the `input_ids` being on a device type different than your model's device. `input_ids` is on cpu, whereas the model is on cuda. You may experience unexpected behaviors or slower generation. Please make sure that you have put `input_ids` to the correct device by calling for example input_ids = input_ids.to('cuda') before running `.generate()`. warnings.warn(
peft/examples/int8_training/Finetune_opt_bnb_peft.ipynb/0
{ "file_path": "peft/examples/int8_training/Finetune_opt_bnb_peft.ipynb", "repo_id": "peft", "token_count": 2723 }
157
<jupyter_start><jupyter_text>Using PEFT with custom models `peft` allows us to fine-tune models efficiently with LoRA. In this short notebook, we will demonstrate how to train a simple multilayer perceptron (MLP) using `peft`. Imports Make sure that you have the latest version of `peft` installed. To ensure that, run this in your Python environment: python -m pip install --upgrade peft<jupyter_code>import copy import os # ignore bnb warnings os.environ["BITSANDBYTES_NOWELCOME"] = "1" import peft import torch from torch import nn import torch.nn.functional as F torch.manual_seed(0)<jupyter_output><empty_output><jupyter_text>Data We will create a toy dataset consisting of random data for a classification task. There is a little bit of signal in the data, so we should expect that the loss of the model can improve during training.<jupyter_code>X = torch.rand((1000, 20)) y = (X.sum(1) > 10).long() n_train = 800 batch_size = 64 train_dataloader = torch.utils.data.DataLoader( torch.utils.data.TensorDataset(X[:n_train], y[:n_train]), batch_size=batch_size, shuffle=True, ) eval_dataloader = torch.utils.data.DataLoader( torch.utils.data.TensorDataset(X[n_train:], y[n_train:]), batch_size=batch_size, )<jupyter_output><empty_output><jupyter_text>Model As a model, we use a simple multilayer perceptron (MLP). For demonstration purposes, we use a very large number of hidden units. This is totally overkill for this task but it helps to demonstrate the advantages of `peft`. In more realistic settings, models will also be quite large on average, so this is not far-fetched.<jupyter_code>class MLP(nn.Module): def __init__(self, num_units_hidden=2000): super().__init__() self.seq = nn.Sequential( nn.Linear(20, num_units_hidden), nn.ReLU(), nn.Linear(num_units_hidden, num_units_hidden), nn.ReLU(), nn.Linear(num_units_hidden, 2), nn.LogSoftmax(dim=-1), ) def forward(self, X): return self.seq(X)<jupyter_output><empty_output><jupyter_text>Training Here are just a few training hyper-parameters and a simple function that performs the training and evaluation loop.<jupyter_code>lr = 0.002 batch_size = 64 max_epochs = 30 device = "cpu" if not torch.cuda.is_available() else "cuda" def train(model, optimizer, criterion, train_dataloader, eval_dataloader, epochs): for epoch in range(epochs): model.train() train_loss = 0 for xb, yb in train_dataloader: xb = xb.to(device) yb = yb.to(device) outputs = model(xb) loss = criterion(outputs, yb) train_loss += loss.detach().float() loss.backward() optimizer.step() optimizer.zero_grad() model.eval() eval_loss = 0 for xb, yb in eval_dataloader: xb = xb.to(device) yb = yb.to(device) with torch.no_grad(): outputs = model(xb) loss = criterion(outputs, yb) eval_loss += loss.detach().float() eval_loss_total = (eval_loss / len(eval_dataloader)).item() train_loss_total = (train_loss / len(train_dataloader)).item() print(f"{epoch=:<2} {train_loss_total=:.4f} {eval_loss_total=:.4f}")<jupyter_output><empty_output><jupyter_text>Training without peft Let's start without using `peft` to see what we can expect from the model training.<jupyter_code>module = MLP().to(device) optimizer = torch.optim.Adam(module.parameters(), lr=lr) criterion = nn.CrossEntropyLoss() %time train(module, optimizer, criterion, train_dataloader, eval_dataloader, epochs=max_epochs)<jupyter_output>epoch=0 train_loss_total=0.7970 eval_loss_total=0.6472 epoch=1 train_loss_total=0.5597 eval_loss_total=0.4898 epoch=2 train_loss_total=0.3696 eval_loss_total=0.3323 epoch=3 train_loss_total=0.2364 eval_loss_total=0.5454 epoch=4 train_loss_total=0.2428 eval_loss_total=0.2843 epoch=5 train_loss_total=0.1251 eval_loss_total=0.2514 epoch=6 train_loss_total=0.0952 eval_loss_total=0.2068 epoch=7 train_loss_total=0.0831 eval_loss_total=0.2395 epoch=8 train_loss_total=0.0655 eval_loss_total=0.2524 epoch=9 train_loss_total=0.0380 eval_loss_total=0.3650 epoch=10 train_loss_total=0.0363 eval_loss_total=0.3495 epoch=11 train_loss_total=0.0231 eval_loss_total=0.2360 epoch=12 train_loss_total=0.0162 eval_loss_total=0.2276 epoch=13 train_loss_total=0.0094 eval_loss_total=0.2716 epoch=14 train_loss_total=0.0065 eval_loss_total=0.2237 epoch=15 train_loss_total=0.0054 eval_loss_total=0.2366 epoch=16 train_loss_total=0.0035 eval_loss_total=0.2673 epoch=17 trai[...]<jupyter_text>Okay, so we got an eval loss of ~0.26, which is much better than random. Training with peft Now let's train with `peft`. First we check the names of the modules, so that we can configure `peft` to fine-tune the right modules.<jupyter_code>[(n, type(m)) for n, m in MLP().named_modules()]<jupyter_output><empty_output><jupyter_text>Next we can define the LoRA config. There is nothing special going on here. We set the LoRA rank to 8 and select the layers `seq.0` and `seq.2` to be used for LoRA fine-tuning. As for `seq.4`, which is the output layer, we set it as `module_to_save`, which means it is also trained but no LoRA is applied. *Note: Not all layers types can be fine-tuned with LoRA. At the moment, linear layers, embeddings, `Conv2D` and `transformers.pytorch_utils.Conv1D` are supported.<jupyter_code>config = peft.LoraConfig( r=8, target_modules=["seq.0", "seq.2"], modules_to_save=["seq.4"], )<jupyter_output><empty_output><jupyter_text>Now let's create the `peft` model by passing our initial MLP, as well as the config we just defined, to `get_peft_model`.<jupyter_code>module = MLP().to(device) module_copy = copy.deepcopy(module) # we keep a copy of the original model for later peft_model = peft.get_peft_model(module, config) optimizer = torch.optim.Adam(peft_model.parameters(), lr=lr) criterion = nn.CrossEntropyLoss() peft_model.print_trainable_parameters()<jupyter_output>trainable params: 56,164 || all params: 4,100,164 || trainable%: 1.369798866581922<jupyter_text>Checking the numbers, we see that only ~1% of parameters are actually trained, which is what we like to see.Now let's start the training:<jupyter_code>%time train(peft_model, optimizer, criterion, train_dataloader, eval_dataloader, epochs=max_epochs)<jupyter_output>epoch=0 train_loss_total=0.6918 eval_loss_total=0.6518 epoch=1 train_loss_total=0.5975 eval_loss_total=0.6125 epoch=2 train_loss_total=0.5402 eval_loss_total=0.4929 epoch=3 train_loss_total=0.3886 eval_loss_total=0.3476 epoch=4 train_loss_total=0.2677 eval_loss_total=0.3185 epoch=5 train_loss_total=0.1938 eval_loss_total=0.2294 epoch=6 train_loss_total=0.1712 eval_loss_total=0.2653 epoch=7 train_loss_total=0.1555 eval_loss_total=0.2764 epoch=8 train_loss_total=0.1218 eval_loss_total=0.2104 epoch=9 train_loss_total=0.0846 eval_loss_total=0.1756 epoch=10 train_loss_total=0.0710 eval_loss_total=0.1873 epoch=11 train_loss_total=0.0372 eval_loss_total=0.1539 epoch=12 train_loss_total=0.0350 eval_loss_total=0.2348 epoch=13 train_loss_total=0.0298 eval_loss_total=0.4605 epoch=14 train_loss_total=0.0355 eval_loss_total=0.2208 epoch=15 train_loss_total=0.0099 eval_loss_total=0.1583 epoch=16 train_loss_total=0.0051 eval_loss_total=0.2042 epoch=17 trai[...]<jupyter_text>In the end, we see that the eval loss is very similar to the one we saw earlier when we trained without `peft`. This is quite nice to see, given that we are training a much smaller number of parameters. Check which parameters were updated Finally, just to check that LoRA was applied as expected, we check what original weights were updated what weights stayed the same.<jupyter_code>for name, param in peft_model.base_model.named_parameters(): if "lora" not in name: continue print(f"New parameter {name:<13} | {param.numel():>5} parameters | updated") params_before = dict(module_copy.named_parameters()) for name, param in peft_model.base_model.named_parameters(): if "lora" in name: continue name_before = ( name.partition(".")[-1].replace("original_", "").replace("module.", "").replace("modules_to_save.default.", "") ) param_before = params_before[name_before] if torch.allclose(param, param_before): print(f"Parameter {name_before:<13} | {param.numel():>7} parameters | not updated") else: print(f"Parameter {name_before:<13} | {param.numel():>7} parameters | updated")<jupyter_output>Parameter seq.0.weight | 40000 parameters | not updated Parameter seq.0.bias | 2000 parameters | not updated Parameter seq.2.weight | 4000000 parameters | not updated Parameter seq.2.bias | 2000 parameters | not updated Parameter seq.4.weight | 4000 parameters | not updated Parameter seq.4.bias | 2 parameters | not updated Parameter seq.4.weight | 4000 parameters | updated Parameter seq.4.bias | 2 parameters | updated<jupyter_text>So we can see that apart from the new LoRA weights that were added, only the last layer was updated. Since the LoRA weights and the last layer have comparitively few parameters, this gives us a big boost in efficiency. Sharing the model through Hugging Face Hub Pushing the model to HF Hub With the `peft` model, it is also very easy to push a model the Hugging Face Hub. Below, we demonstrate how it works. It is assumed that you have a valid Hugging Face account and are logged in:<jupyter_code>user = "BenjaminB" # put your user name here model_name = "peft-lora-with-custom-model" model_id = f"{user}/{model_name}" peft_model.push_to_hub(model_id);<jupyter_output><empty_output><jupyter_text>As we can see, the adapter size is only 211 kB. Loading the model from HF Hub Now, it only takes one step to load the model from HF Hub. To do this, we can use `PeftModel.from_pretrained`, passing our base model and the model ID:<jupyter_code>loaded = peft.PeftModel.from_pretrained(module_copy, model_id) type(loaded)<jupyter_output><empty_output><jupyter_text>Let's check that the two models produce the same output:<jupyter_code>y_peft = peft_model(X.to(device)) y_loaded = loaded(X.to(device)) torch.allclose(y_peft, y_loaded)<jupyter_output><empty_output><jupyter_text>Clean up Finally, as a clean up step, you may want to delete the repo.<jupyter_code>from huggingface_hub import delete_repo delete_repo(model_id)<jupyter_output><empty_output>
peft/examples/multilayer_perceptron/multilayer_perceptron_lora.ipynb/0
{ "file_path": "peft/examples/multilayer_perceptron/multilayer_perceptron_lora.ipynb", "repo_id": "peft", "token_count": 4094 }
158
# flake8: noqa # There's no way to ignore "F401 '...' imported but unused" warnings in this # module, but to preserve other warnings. So, don't check this module at all # coding=utf-8 # Copyright 2023-present the HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from .adaption_prompt import AdaptionPromptConfig, AdaptionPromptModel from .lora import LoraConfig, LoraModel, LoftQConfig from .loha import LoHaConfig, LoHaModel from .lokr import LoKrConfig, LoKrModel from .ia3 import IA3Config, IA3Model from .adalora import AdaLoraConfig, AdaLoraModel from .p_tuning import PromptEncoder, PromptEncoderConfig, PromptEncoderReparameterizationType from .prefix_tuning import PrefixEncoder, PrefixTuningConfig from .prompt_tuning import PromptEmbedding, PromptTuningConfig, PromptTuningInit from .multitask_prompt_tuning import MultitaskPromptEmbedding, MultitaskPromptTuningConfig, MultitaskPromptTuningInit from .oft import OFTConfig, OFTModel from .mixed import MixedModel from .poly import PolyConfig, PolyModel
peft/src/peft/tuners/__init__.py/0
{ "file_path": "peft/src/peft/tuners/__init__.py", "repo_id": "peft", "token_count": 443 }
159
# coding=utf-8 # Copyright 2023-present the HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from __future__ import annotations import re import warnings from dataclasses import asdict from enum import Enum from typing import List, Optional import torch from torch import nn from transformers.pytorch_utils import Conv1D from peft.import_utils import is_bnb_4bit_available, is_bnb_available from peft.tuners.tuners_utils import BaseTuner, BaseTunerLayer, check_target_module_exists from peft.utils import ( TRANSFORMERS_MODELS_TO_IA3_FEEDFORWARD_MODULES_MAPPING, TRANSFORMERS_MODELS_TO_IA3_TARGET_MODULES_MAPPING, ModulesToSaveWrapper, _get_submodules, ) from .layer import Conv2d, IA3Layer, Linear class IA3Model(BaseTuner): """ Creates a Infused Adapter by Inhibiting and Amplifying Inner Activations ((IA)^3) model from a pretrained transformers model. The method is described in detail in https://arxiv.org/abs/2205.05638 Args: model ([`~transformers.PreTrainedModel`]): The model to be adapted. config ([`IA3Config`]): The configuration of the (IA)^3 model. adapter_name (`str`): The name of the adapter, defaults to `"default"`. Returns: `torch.nn.Module`: The (IA)^3 model. Example: ```py >>> from transformers import AutoModelForSeq2SeqLM, ia3Config >>> from peft import IA3Model, IA3Config >>> config = IA3Config( ... peft_type="IA3", ... task_type="SEQ_2_SEQ_LM", ... target_modules=["k", "v", "w0"], ... feedforward_modules=["w0"], ... ) >>> model = AutoModelForSeq2SeqLM.from_pretrained("t5-base") >>> ia3_model = IA3Model(config, model) ``` **Attributes**: - **model** ([`~transformers.PreTrainedModel`]) -- The model to be adapted. - **peft_config** ([`ia3Config`]): The configuration of the (IA)^3 model. """ prefix: str = "ia3_" def __init__(self, model, config, adapter_name): super().__init__(model, config, adapter_name) @staticmethod def _create_new_module(ia3_config, adapter_name, target, **kwargs): # avoid eager bnb import if is_bnb_available(): import bitsandbytes as bnb from .bnb import Linear8bitLt if is_bnb_4bit_available(): from .bnb import Linear4bit loaded_in_8bit = kwargs.pop("loaded_in_8bit", False) loaded_in_4bit = kwargs.pop("loaded_in_4bit", False) is_feedforward = kwargs.pop("is_feedforward", False) if isinstance(target, BaseTunerLayer): target_base_layer = target.get_base_layer() else: target_base_layer = target if loaded_in_8bit and isinstance(target_base_layer, bnb.nn.Linear8bitLt): eightbit_kwargs = kwargs.copy() eightbit_kwargs.update( { "has_fp16_weights": target_base_layer.state.has_fp16_weights, "memory_efficient_backward": target_base_layer.state.memory_efficient_backward, "threshold": target_base_layer.state.threshold, "index": target_base_layer.index, } ) new_module = Linear8bitLt(target, adapter_name, is_feedforward=is_feedforward, **eightbit_kwargs) elif loaded_in_4bit and isinstance(target_base_layer, bnb.nn.Linear4bit): fourbit_kwargs = kwargs.copy() fourbit_kwargs.update( { "compute_dtype": target_base_layer.compute_dtype, "compress_statistics": target_base_layer.weight.compress_statistics, "quant_type": target_base_layer.weight.quant_type, } ) new_module = Linear4bit(target, adapter_name, is_feedforward=is_feedforward, **fourbit_kwargs) elif isinstance(target, torch.nn.Conv2d): new_module = Conv2d(target, adapter_name, is_feedforward=is_feedforward, **kwargs) elif isinstance(target_base_layer, torch.nn.Linear): if kwargs["fan_in_fan_out"]: warnings.warn( "fan_in_fan_out is set to True but the target module is `torch.nn.Linear`. " "Setting fan_in_fan_out to False." ) kwargs["fan_in_fan_out"] = ia3_config.fan_in_fan_out = False new_module = Linear(target, adapter_name, is_feedforward=is_feedforward, **kwargs) elif isinstance(target_base_layer, Conv1D): if not kwargs["fan_in_fan_out"]: warnings.warn( "fan_in_fan_out is set to False but the target module is `Conv1D`. " "Setting fan_in_fan_out to True." ) kwargs["fan_in_fan_out"] = ia3_config.fan_in_fan_out = True new_module = Linear( target, adapter_name, is_feedforward=is_feedforward, is_target_conv_1d_layer=True, **kwargs ) else: raise ValueError( f"Target module {target} is not supported. " f"Currently, only `torch.nn.Linear`, `torch.nn.Conv2d`, and `Conv1D` are supported." ) return new_module @staticmethod def _check_target_module_exists(ia3_config, key): return check_target_module_exists(ia3_config, key) def _mark_only_adapters_as_trainable(self, model: nn.Module) -> None: for n, p in model.named_parameters(): if self.prefix not in n: p.requires_grad = False def _create_and_replace( self, ia3_config, adapter_name, target, target_name, parent, current_key, ): # check if target module is in feedforward_modules is_feedforward = self._check_target_module_feedforward(ia3_config, current_key) kwargs = { "fan_in_fan_out": ia3_config.fan_in_fan_out, "init_ia3_weights": ia3_config.init_ia3_weights, "is_feedforward": is_feedforward, "loaded_in_8bit": getattr(self.model, "is_loaded_in_8bit", False), "loaded_in_4bit": getattr(self.model, "is_loaded_in_4bit", False), } if isinstance(target, IA3Layer): target.update_layer( adapter_name, ia3_config.init_ia3_weights, ) else: new_module = self._create_new_module(ia3_config, adapter_name, target, **kwargs) if adapter_name != self.active_adapter: # adding an additional adapter: it is not automatically trainable new_module.requires_grad_(False) self._replace_module(parent, target_name, new_module, target) @staticmethod def _check_target_module_feedforward(ia3_config, key) -> bool: """ A helper private method that checks if the target module `key` matches with a feedforward module specified in `ia3_config` """ if isinstance(ia3_config.feedforward_modules, str): is_feedforward = bool(re.fullmatch(ia3_config.feedforward_modules, key)) else: is_feedforward = any(key.endswith(target_key) for target_key in ia3_config.feedforward_modules) return is_feedforward def _replace_module(self, parent, child_name, new_module, child): setattr(parent, child_name, new_module) # child layer wraps the original module, unpack it if hasattr(child, "base_layer"): child = child.base_layer # layers with base_layer don't need the weight to be copied, as they have a reference already if not hasattr(new_module, "base_layer"): new_module.weight = child.weight if hasattr(child, "bias"): new_module.bias = child.bias if getattr(child, "state", None) is not None: if hasattr(new_module, "base_layer"): new_module.base_layer.state = child.state else: new_module.state = child.state new_module.to(child.weight.device) # dispatch to correct device for name, module in new_module.named_modules(): if self.prefix in name: module.to(child.weight.device) def __getattr__(self, name: str): """Forward missing attributes to the wrapped module.""" try: return super().__getattr__(name) # defer to nn.Module's logic except AttributeError: return getattr(self.model, name) def get_peft_config_as_dict(self, inference: bool = False): config_dict = {} for key, value in self.peft_config.items(): config = {k: v.value if isinstance(v, Enum) else v for k, v in asdict(value).items()} if inference: config["inference_mode"] = True config_dict[key] = config return config def _set_adapter_layers(self, enabled=True): for module in self.model.modules(): if isinstance(module, (IA3Layer, ModulesToSaveWrapper)): module.enable_adapters(enabled) def enable_adapter_layers(self) -> None: """Enable all adapters. Call this if you have previously disabled all adapters and want to re-enable them. """ self._set_adapter_layers(enabled=True) def disable_adapter_layers(self) -> None: """Disable all adapters. When disabling all adapters, the model output corresponds to the output of the base model. """ self._set_adapter_layers(enabled=False) def set_adapter(self, adapter_name: str | list[str]) -> None: """Set the active adapter(s). Args: adapter_name (`str` or `list[str]`): Name of the adapter(s) to be activated. """ for module in self.model.modules(): if isinstance(module, IA3Layer): if module.merged: warnings.warn("Adapter cannot be set when the model is merged. Unmerging the model first.") module.unmerge() module.set_adapter(adapter_name) def _prepare_adapter_config(self, peft_config, model_config): if peft_config.target_modules is None: if model_config["model_type"] not in TRANSFORMERS_MODELS_TO_IA3_TARGET_MODULES_MAPPING: raise ValueError("Please specify `target_modules` in `peft_config`") peft_config.target_modules = TRANSFORMERS_MODELS_TO_IA3_TARGET_MODULES_MAPPING[model_config["model_type"]] if peft_config.feedforward_modules is None: if model_config["model_type"] not in TRANSFORMERS_MODELS_TO_IA3_FEEDFORWARD_MODULES_MAPPING: raise ValueError("Please specify `feedforward_modules` in `peft_config`") peft_config.feedforward_modules = TRANSFORMERS_MODELS_TO_IA3_FEEDFORWARD_MODULES_MAPPING[ model_config["model_type"] ] return peft_config def _unload_and_optionally_merge( self, merge: bool = True, safe_merge: bool = False, adapter_names: Optional[List[str]] = None ): r""" This method merges the (IA)^3 layers into the base model. This is needed if someone wants to use the base model as a standalone model. Args: safe_merge (`bool`, `optional`, defaults to `False`): If True, the merge operation will be performed in a copy of the original weights and check for NaNs before merging the weights. This is useful if you want to check if the merge operation will produce NaNs. Defaults to `False`. adapter_names (`List[str]`, *optional*): The list of adapter names that should be merged. If None, all active adapters will be merged. Defaults to `None`. """ if getattr(self.model, "is_loaded_in_8bit", False): raise ValueError("Cannot merge ia3 layers when the model is loaded in 8-bit mode") if getattr(self.model, "is_loaded_in_4bit", False): raise ValueError("Cannot merge ia3 layers when the model is loaded in 4-bit mode") self._unloading_checks(adapter_names) key_list = [key for key, _ in self.model.named_modules() if self.prefix not in key] for key in key_list: try: parent, target, target_name = _get_submodules(self.model, key) except AttributeError: continue if hasattr(target, "base_layer"): if merge: target.merge(safe_merge=safe_merge, adapter_names=adapter_names) self._replace_module(parent, target_name, target.get_base_layer(), target) elif isinstance(target, ModulesToSaveWrapper): # save any additional trainable modules part of `modules_to_save` setattr(parent, target_name, target.modules_to_save[target.active_adapter]) return self.model def merge_and_unload(self, safe_merge: bool = False, adapter_names: Optional[List[str]] = None) -> torch.nn.Module: r""" This method merges the IAยณ layers into the base model. This is needed if someone wants to use the base model as a standalone model. Args: safe_merge (`bool`): whether to activate the safe merging check to check if there is any potential Nan in the adapter weights adapter_names (`List[str]`, *optional*): The list of adapter names that should be merged. If None, all active adapters will be merged. Defaults to `None`. Example: ```py >>> from transformers import AutoModelForCausalLM >>> from peft import PeftModel >>> base_model = AutoModelForCausalLM.from_pretrained("tiiuae/falcon-40b") >>> peft_model_id = "smangrul/falcon-40B-int4-peft-lora-sfttrainer-sample" >>> model = PeftModel.from_pretrained(base_model, peft_model_id) >>> merged_model = model.merge_and_unload() ``` """ return self._unload_and_optionally_merge(safe_merge=safe_merge, adapter_names=adapter_names) def unload(self) -> torch.nn.Module: """ Gets back the base model by removing all the IAยณ modules without merging. This gives back the original base model. """ return self._unload_and_optionally_merge(merge=False) def delete_adapter(self, adapter_name: str) -> None: """ Deletes an existing adapter. Args: adapter_name (str): Name of the adapter to be deleted. """ if adapter_name not in self.peft_config: raise ValueError(f"Adapter {adapter_name} does not exist") del self.peft_config[adapter_name] key_list = [key for key, _ in self.model.named_modules() if self.prefix not in key] new_adapter = None for key in key_list: _, target, _ = _get_submodules(self.model, key) if isinstance(target, IA3Layer): target.delete_adapter(adapter_name) if new_adapter is None: new_adapter = target.active_adapters[:] self.active_adapter = new_adapter or []
peft/src/peft/tuners/ia3/model.py/0
{ "file_path": "peft/src/peft/tuners/ia3/model.py", "repo_id": "peft", "token_count": 7054 }
160
# coding=utf-8 # Copyright 2023-present the HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from __future__ import annotations import warnings from abc import abstractmethod from dataclasses import dataclass, field from typing import Any, Dict, List, Optional, Set, Type, Union import torch import torch.nn as nn from tqdm import tqdm from peft.config import PeftConfig from peft.utils import ( ModulesToSaveWrapper, _get_submodules, ) from .tuners_utils import BaseTuner, BaseTunerLayer, check_adapters_to_merge, check_target_module_exists @dataclass class LycorisConfig(PeftConfig): r""" A base config for LyCORIS like adapters """ rank_pattern: Optional[dict] = field( default_factory=dict, metadata={ "help": ( "The mapping from layer names or regexp expression to ranks which are different from the default rank specified by `r`. " "For example, `{model.decoder.layers.0.encoder_attn.k_proj: 8`}" ) }, ) alpha_pattern: Optional[dict] = field( default_factory=dict, metadata={ "help": ( "The mapping from layer names or regexp expression to alphas which are different from the default alpha specified by `alpha`. " "For example, `{model.decoder.layers.0.encoder_attn.k_proj: 32`}" ) }, ) class LycorisLayer(BaseTunerLayer): r""" A base layer for LyCORIS like adapters """ # adapter_layer_names needs to be defined on the child class other_param_names = ("r", "alpha", "scaling", "rank_dropout", "module_dropout") def __init__(self, base_layer: nn.Module) -> None: self.base_layer = base_layer self.r = {} self.alpha = {} self.scaling = {} self.rank_dropout = {} self.module_dropout = {} # Tuner info self._disable_adapters = False self.merged_adapters = [] @property @abstractmethod def _available_adapters(self) -> Set[str]: ... def _init_empty_weights(self, cls, *args, **kwargs) -> None: # A helper method that allows to initialize the layer of the given class without spending time to initialize the # model weights. The implementation is inspired by # https://pytorch.org/docs/stable/generated/torch.nn.utils.skip_init.html but this function cannot be used # directly. # Instead of this approach, it would be possible to bypass the __init__ of the class but that runs the risk of # omitting important logic inside that __init__. kwargs = kwargs.copy() final_device = kwargs.pop("device", "cpu") cls.__init__(self, *args, device="meta", **kwargs) self.to_empty(device=final_device) @abstractmethod def create_adapter_parameters(self, adapter_name: str, r: int, **kwargs): ... # TODO: refactor LoRA to use the same approach @abstractmethod def _get_delta_activations(self, adapter_name: str, x: torch.Tensor, *args: Any, **kwargs: Any) -> torch.Tensor: """Activations added on top of the base layer output (i.e. after the base layer forward pass)""" @abstractmethod def get_delta_weight(self, adapter_name: str) -> torch.Tensor: ... def merge(self, safe_merge: bool = False, adapter_names: Optional[List[str]] = None) -> None: """ Merge the active adapter weights into the base weights Args: safe_merge (`bool`, *optional*): If `True`, the merge operation will be performed in a copy of the original weights and check for NaNs before merging the weights. This is useful if you want to check if the merge operation will produce NaNs. Defaults to `False`. adapter_names (`List[str]`, *optional*): The list of adapter names that should be merged. If `None`, all active adapters will be merged. Defaults to `None`. """ adapter_names = check_adapters_to_merge(self, adapter_names) if not adapter_names: # no adapter to merge return for active_adapter in adapter_names: if active_adapter in self._available_adapters: base_layer = self.get_base_layer() if safe_merge: orig_weights = base_layer.weight.data orig_weights += self.get_delta_weight(active_adapter) if not torch.isfinite(orig_weights).all(): raise ValueError( f"NaNs detected in the merged weights. The adapter {active_adapter} seems to be broken" ) base_layer.weight.data = orig_weights else: base_layer.weight.data += self.get_delta_weight(active_adapter) self.merged_adapters.append(active_adapter) @abstractmethod def reset_adapter_parameters(self, adapter_name: str): ... def set_scale(self, adapter, scale): if adapter not in self._available_adapters: # Ignore the case where the adapter is not in the layer return self.scaling[adapter] = scale * self.alpha[adapter] / self.r[adapter] def scale_layer(self, scale: float) -> None: if scale == 1: return for active_adapter in self.active_adapters: if active_adapter not in self._available_adapters: continue self.scaling[active_adapter] *= scale def unmerge(self) -> None: """ This method unmerges all merged adapter layers from the base weights. """ if not self.merged: warnings.warn("Already unmerged. Nothing to do.") return while len(self.merged_adapters) > 0: active_adapter = self.merged_adapters.pop() if active_adapter in self._available_adapters: self.get_base_layer().weight.data -= self.get_delta_weight(active_adapter) def unscale_layer(self, scale=None) -> None: for active_adapter in self.active_adapters: if active_adapter not in self._available_adapters: continue if scale is None: self.scaling[active_adapter] = self.alpha[active_adapter] / self.r[active_adapter] else: self.scaling[active_adapter] /= scale @abstractmethod def update_layer(self, adapter_name: str, r: int, alpha: float, **kwargs): ... class LycorisTuner(BaseTuner): r""" A base tuner for LyCORIS like adapters """ prefix: str layers_mapping: Dict[Type[torch.nn.Module], Type[LycorisLayer]] def __init__(self, model, config, adapter_name): super().__init__(model, config, adapter_name) def __getattr__(self, name: str): """Forward missing attributes to the wrapped module.""" try: return super().__getattr__(name) # defer to nn.Module's logic except AttributeError: return getattr(self.model, name) @staticmethod def _check_target_module_exists(config, key): return check_target_module_exists(config, key) @abstractmethod def _create_and_replace( self, config: LycorisConfig, adapter_name: str, target: Union[LycorisLayer, nn.Module], target_name, parent, current_key, ): ... @classmethod def _create_new_module(cls, config: LycorisConfig, adapter_name: str, target: nn.Module, **kwargs) -> LycorisLayer: # Find corresponding subtype of provided target module new_module_cls = None for subtype, target_cls in cls.layers_mapping.items(): if ( hasattr(target, "base_layer") and isinstance(target.get_base_layer(), subtype) and isinstance(target, BaseTunerLayer) ): # nested tuner layers are allowed new_module_cls = target_cls break elif isinstance(target, subtype): new_module_cls = target_cls break # We didn't find corresponding type, so adapter for this layer is not supported if new_module_cls is None: supported_modules = ", ".join(layer.__name__ for layer in cls.layers_mapping.keys()) raise ValueError( f"Target module of type {type(target)} not supported, " f"currently only adapters for {supported_modules} are supported" ) if isinstance(target, BaseTunerLayer): target_base_layer = target.get_base_layer() else: target_base_layer = target if isinstance(target_base_layer, torch.nn.Conv2d): new_module = new_module_cls(target, adapter_name=adapter_name, **kwargs) elif isinstance(target_base_layer, torch.nn.Linear): new_module = new_module_cls(target, adapter_name=adapter_name, **kwargs) else: supported_modules = ", ".join(layer.__name__ for layer in cls.layers_mapping.keys()) raise ValueError( f"Target module of type {type(target)} not supported, " f"currently only adapters for {supported_modules} are supported" ) return new_module def _mark_only_adapters_as_trainable(self, model: nn.Module) -> None: for n, p in model.named_parameters(): if self.prefix not in n: p.requires_grad = False @staticmethod def _prepare_adapter_config(peft_config, model_config): if peft_config.target_modules is None: raise ValueError("Please specify `target_modules` in `peft_config`") return peft_config def _replace_module(self, parent, child_name, new_module, child): setattr(parent, child_name, new_module) # It's not necessary to set requires_grad here, as that is handled by # _mark_only_adapters_as_trainable if not hasattr(new_module, "base_layer"): new_module.weight = child.weight if hasattr(child, "bias"): new_module.bias = child.bias if getattr(child, "state", None) is not None: if hasattr(new_module, "base_layer"): new_module.base_layer.state = child.state else: new_module.state = child.state new_module.to(child.weight.device) # dispatch to correct device for name, module in new_module.named_modules(): if self.prefix in name: module.to(child.weight.device) def _set_adapter_layers(self, enabled=True): for module in self.model.modules(): if isinstance(module, (BaseTunerLayer, ModulesToSaveWrapper)): module.enable_adapters(enabled) def _unload_and_optionally_merge( self, merge: bool = True, progressbar: bool = False, safe_merge: bool = False, adapter_names: Optional[List[str]] = None, ): if merge: if getattr(self.model, "quantization_method", None) == "gptq": raise ValueError("Cannot merge LOHA layers when the model is gptq quantized") self._unloading_checks(adapter_names) key_list = [key for key, _ in self.model.named_modules() if self.prefix not in key] desc = "Unloading " + ("and merging " if merge else "") + "model" for key in tqdm(key_list, disable=not progressbar, desc=desc): try: parent, target, target_name = _get_submodules(self.model, key) except AttributeError: continue if hasattr(target, "base_layer"): if merge: target.merge(safe_merge=safe_merge, adapter_names=adapter_names) self._replace_module(parent, target_name, target.get_base_layer(), target) elif isinstance(target, ModulesToSaveWrapper): # save any additional trainable modules part of `modules_to_save` setattr(parent, target_name, target.modules_to_save[target.active_adapter]) return self.model def enable_adapter_layers(self) -> None: """Enable all adapters. Call this if you have previously disabled all adapters and want to re-enable them. """ self._set_adapter_layers(enabled=True) def disable_adapter_layers(self) -> None: """Disable all adapters. When disabling all adapters, the model output corresponds to the output of the base model. """ self._set_adapter_layers(enabled=False) def merge_and_unload( self, progressbar: bool = False, safe_merge: bool = False, adapter_names: Optional[List[str]] = None ) -> torch.nn.Module: r""" This method merges the adapter layers into the base model. This is needed if someone wants to use the base model as a standalone model. Args: progressbar (`bool`): whether to show a progressbar indicating the unload and merge process safe_merge (`bool`): whether to activate the safe merging check to check if there is any potential Nan in the adapter weights adapter_names (`List[str]`, *optional*): The list of adapter names that should be merged. If None, all active adapters will be merged. Defaults to `None`. """ return self._unload_and_optionally_merge( progressbar=progressbar, safe_merge=safe_merge, adapter_names=adapter_names ) def unload(self) -> torch.nn.Module: """ Gets back the base model by removing all the lora modules without merging. This gives back the original base model. """ return self._unload_and_optionally_merge(merge=False) def set_adapter(self, adapter_name: str | list[str]) -> None: """Set the active adapter(s). Args: adapter_name (`str` or `list[str]`): Name of the adapter(s) to be activated. """ for module in self.model.modules(): if isinstance(module, LycorisLayer): if module.merged: warnings.warn("Adapter cannot be set when the model is merged. Unmerging the model first.") module.unmerge() module.set_adapter(adapter_name) def delete_adapter(self, adapter_name: str) -> None: """ Deletes an existing adapter. Args: adapter_name (`str`): Name of the adapter to be deleted. """ if adapter_name not in list(self.peft_config.keys()): raise ValueError(f"Adapter {adapter_name} does not exist") del self.peft_config[adapter_name] key_list = [key for key, _ in self.model.named_modules() if self.prefix not in key] new_adapter = None for key in key_list: _, target, _ = _get_submodules(self.model, key) if isinstance(target, LycorisLayer): target.delete_adapter(adapter_name) if new_adapter is None: new_adapter = target.active_adapters[:] self.active_adapter = new_adapter or []
peft/src/peft/tuners/lycoris_utils.py/0
{ "file_path": "peft/src/peft/tuners/lycoris_utils.py", "repo_id": "peft", "token_count": 6858 }
161
# coding=utf-8 # Copyright 2023-present the HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. from contextlib import contextmanager from dataclasses import asdict from enum import Enum from typing import Any import torch from torch import nn from peft.tuners.tuners_utils import BaseTuner, BaseTunerLayer, check_target_module_exists from peft.utils import ( TRANSFORMERS_MODELS_TO_LORA_TARGET_MODULES_MAPPING, ModulesToSaveWrapper, ) from .config import PolyConfig from .layer import Linear, PolyLayer class PolyModel(BaseTuner): prefix: str = "poly_" def __init__(self, model, config, adapter_name) -> None: super().__init__(model, config, adapter_name) @staticmethod def _check_target_module_exists(poly_config, key): return check_target_module_exists(poly_config, key) def _create_and_replace( self, poly_config: PolyConfig, adapter_name: str, target: nn.Module, target_name: str, parent: nn.Module, **optional_kwargs: Any, ): if isinstance(target, PolyLayer): target.update_layer(adapter_name, poly_config) else: new_module = self._create_new_module( poly_config, adapter_name, target, ) if adapter_name != self.active_adapter: # adding an additional adapter: it is not automatically trainable new_module.requires_grad_(False) self._replace_module(parent, target_name, new_module, target) def _replace_module(self, parent, child_name, new_module, child): setattr(parent, child_name, new_module) # It's not necessary to set requires_grad here, as that is handled by # _mark_only_adapters_as_trainable # child layer wraps the original module, unpack it if hasattr(child, "base_layer"): child = child.base_layer if not hasattr(new_module, "base_layer"): new_module.weight = child.weight if hasattr(child, "bias"): new_module.bias = child.bias if getattr(child, "state", None) is not None: if hasattr(new_module, "base_layer"): new_module.base_layer.state = child.state else: new_module.state = child.state new_module.to(child.weight.device) # dispatch to correct device for name, module in new_module.named_modules(): if (self.prefix in name) or ("ranknum" in name): weight = child.qweight if hasattr(child, "qweight") else child.weight module.to(weight.device) def _mark_only_adapters_as_trainable(self, model: nn.Module) -> None: for n, p in model.named_parameters(): if self.prefix not in n: p.requires_grad = False @staticmethod def _create_new_module(poly_config, adapter_name, target, **kwargs): if isinstance(target, BaseTunerLayer): target_base_layer = target.get_base_layer() else: target_base_layer = target if isinstance(target_base_layer, torch.nn.Linear): return Linear(target, adapter_name, poly_config, **kwargs) else: raise ValueError( f"Target module {target} is not supported. Currently, only the following modules are supported: " "`torch.nn.Linear`." ) def __getattr__(self, name: str): """Forward missing attributes to the wrapped module.""" try: return super().__getattr__(name) # defer to nn.Module's logic except AttributeError: return getattr(self.model, name) def get_peft_config_as_dict(self, inference: bool = False): config_dict = {} for key, value in self.peft_config.items(): config = {k: v.value if isinstance(v, Enum) else v for k, v in asdict(value).items()} if inference: config["inference_mode"] = True config_dict[key] = config return config def _set_adapter_layers(self, enabled=True): for module in self.model.modules(): if isinstance(module, (PolyLayer, ModulesToSaveWrapper)): module.enable_adapters(enabled) def enable_adapter_layers(self): self._set_adapter_layers(enabled=True) def disable_adapter_layers(self): self._set_adapter_layers(enabled=False) def set_adapter(self, adapter_name): for module in self.model.modules(): if isinstance(module, PolyLayer): module.set_adapter(adapter_name) def _prepare_adapter_config(self, peft_config, model_config): if peft_config.target_modules is None: if model_config["model_type"] not in TRANSFORMERS_MODELS_TO_LORA_TARGET_MODULES_MAPPING: raise ValueError("Please specify `target_modules` in `peft_config`") peft_config.target_modules = set( TRANSFORMERS_MODELS_TO_LORA_TARGET_MODULES_MAPPING[model_config["model_type"]] ) return peft_config def _register_pre_hooks(self, task_ids): """Helper method to register pre hooks.""" if task_ids is None: return [] def pre_hook(_, args, kwargs): kwargs["task_ids"] = task_ids return args, kwargs handles = [] for module in self.model.modules(): if isinstance(module, Linear): handle = module.register_forward_pre_hook(pre_hook, with_kwargs=True) handles.append(handle) return handles @contextmanager def _manage_pre_hooks(self, task_ids): """Context manager to handle the lifecycle of pre hooks.""" handles = self._register_pre_hooks(task_ids) try: yield finally: for handle in handles: handle.remove() def forward(self, *args, task_ids=None, **kwargs): with self._manage_pre_hooks(task_ids): return self.model(*args, **kwargs) def generate(self, *args, task_ids=None, **kwargs): with self._manage_pre_hooks(task_ids): return self.model.generate(*args, **kwargs)
peft/src/peft/tuners/poly/model.py/0
{ "file_path": "peft/src/peft/tuners/poly/model.py", "repo_id": "peft", "token_count": 2931 }
162
# coding=utf-8 # Copyright 2023-present the HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import pytest def pytest_addoption(parser): parser.addoption("--regression", action="store_true", default=False, help="run regression tests") def pytest_configure(config): config.addinivalue_line("markers", "regression: mark regression tests") def pytest_collection_modifyitems(config, items): if config.getoption("--regression"): return skip_regression = pytest.mark.skip(reason="need --regression option to run regression tests") for item in items: if "regression" in item.keywords: item.add_marker(skip_regression)
peft/tests/conftest.py/0
{ "file_path": "peft/tests/conftest.py", "repo_id": "peft", "token_count": 363 }
163
# coding=utf-8 # Copyright 2023-present the HuggingFace Inc. team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. import importlib import os import tempfile from unittest import TestCase import torch from torch.testing import assert_close from peft.mapping import get_peft_model from peft.peft_model import PeftModel from peft.tuners.multitask_prompt_tuning import MultitaskPromptTuningConfig from peft.utils.other import prepare_model_for_int8_training from peft.utils.save_and_load import get_peft_model_state_dict from tests.testing_common import PeftCommonTester def is_llama_available() -> bool: """Check if Llama is available in the transformers library (it's not in earlier versions).""" try: return importlib.util.find_spec("transformers.models.llama.modeling_llama") is not None except ModuleNotFoundError: return False if is_llama_available(): # We guard the import statement so that our unit tests will pass in CI environments # that don't have a transformers package with Llama. from transformers import LlamaConfig, LlamaForCausalLM class MultiTaskPromptTuningTester(TestCase, PeftCommonTester): """ Tests for the AdaptionPrompt model. Some of these tests were adapted from `test_peft_model.py` (which has been refactored since), but since we haven't checked in the test checkpoints for Llama into `hf-internal-testing`, we separate them for now. """ def setUp(self): """Check that llama is available in transformers package before running each test.""" if not is_llama_available(): self.skipTest("Llama not available in transformers. Skipping test.") @staticmethod def _create_test_llama_config(): """Create a test config for a small Llama model for testing.""" return LlamaConfig( vocab_size=16, hidden_size=8, intermediate_size=8, num_hidden_layers=8, num_attention_heads=4, use_cache=False, ) @classmethod def _create_multitask_prompt_tuning_config(cls) -> MultitaskPromptTuningConfig: return MultitaskPromptTuningConfig( task_type="CAUSAL_LM", num_virtual_tokens=50, num_tasks=3, prompt_tuning_init_text="classify the following into either positive or negative, or entailment, neutral or contradiction:", ) def test_prepare_for_training(self) -> None: model = LlamaForCausalLM(self._create_test_llama_config()) model = get_peft_model(model, self._create_multitask_prompt_tuning_config()) model = model.to(self.torch_device) dummy_input = torch.LongTensor([[1, 1, 1]]).to(self.torch_device) dummy_output = model.get_input_embeddings()(dummy_input) self.assertTrue(not dummy_output.requires_grad) def test_prepare_for_int8_training(self) -> None: model = LlamaForCausalLM(self._create_test_llama_config()) model = prepare_model_for_int8_training(model) model = model.to(self.torch_device) for param in model.parameters(): self.assertTrue(not param.requires_grad) model = get_peft_model(model, self._create_multitask_prompt_tuning_config()) # For backward compatibility if hasattr(model, "enable_input_require_grads"): model.enable_input_require_grads() else: def make_inputs_require_grad(module, input, output): output.requires_grad_(True) model.get_input_embeddings().register_forward_hook(make_inputs_require_grad) dummy_input = torch.LongTensor([[1, 1, 1]]).to(self.torch_device) dummy_output = model.get_input_embeddings()(dummy_input) self.assertTrue(dummy_output.requires_grad) def test_save_pretrained(self) -> None: seed = 420 torch.manual_seed(seed) model = LlamaForCausalLM(self._create_test_llama_config()) model = get_peft_model(model, self._create_multitask_prompt_tuning_config()) model = model.to(self.torch_device) with tempfile.TemporaryDirectory() as tmp_dirname: model.save_pretrained(tmp_dirname) torch.manual_seed(seed) model_from_pretrained = LlamaForCausalLM(self._create_test_llama_config()) model_from_pretrained = PeftModel.from_pretrained(model_from_pretrained, tmp_dirname) # check if the state dicts are equal state_dict = get_peft_model_state_dict(model) state_dict_from_pretrained = get_peft_model_state_dict(model_from_pretrained) # check if same keys self.assertEqual(state_dict.keys(), state_dict_from_pretrained.keys()) # Check that the number of saved parameters is 4 -- 2 layers of (tokens and gate). self.assertEqual(len(list(state_dict.keys())), 3) # check if tensors equal for key in state_dict.keys(): self.assertTrue( torch.allclose( state_dict[key].to(self.torch_device), state_dict_from_pretrained[key].to(self.torch_device) ) ) # check if `adapter_model.safetensors` is present self.assertTrue(os.path.exists(os.path.join(tmp_dirname, "adapter_model.safetensors"))) # check if `adapter_config.json` is present self.assertTrue(os.path.exists(os.path.join(tmp_dirname, "adapter_config.json"))) # check if `pytorch_model.bin` is not present self.assertFalse(os.path.exists(os.path.join(tmp_dirname, "pytorch_model.bin"))) # check if `config.json` is not present self.assertFalse(os.path.exists(os.path.join(tmp_dirname, "config.json"))) def test_save_pretrained_regression(self) -> None: seed = 420 torch.manual_seed(seed) model = LlamaForCausalLM(self._create_test_llama_config()) model = get_peft_model(model, self._create_multitask_prompt_tuning_config()) model = model.to(self.torch_device) with tempfile.TemporaryDirectory() as tmp_dirname: model.save_pretrained(tmp_dirname, safe_serialization=False) torch.manual_seed(seed) model_from_pretrained = LlamaForCausalLM(self._create_test_llama_config()) model_from_pretrained = PeftModel.from_pretrained(model_from_pretrained, tmp_dirname) # check if the state dicts are equal state_dict = get_peft_model_state_dict(model) state_dict_from_pretrained = get_peft_model_state_dict(model_from_pretrained) # check if same keys self.assertEqual(state_dict.keys(), state_dict_from_pretrained.keys()) # Check that the number of saved parameters is 4 -- 2 layers of (tokens and gate). self.assertEqual(len(list(state_dict.keys())), 3) # check if tensors equal for key in state_dict.keys(): self.assertTrue( torch.allclose( state_dict[key].to(self.torch_device), state_dict_from_pretrained[key].to(self.torch_device) ) ) # check if `adapter_model.bin` is present for regression self.assertTrue(os.path.exists(os.path.join(tmp_dirname, "adapter_model.bin"))) # check if `adapter_config.json` is present self.assertTrue(os.path.exists(os.path.join(tmp_dirname, "adapter_config.json"))) # check if `pytorch_model.bin` is not present self.assertFalse(os.path.exists(os.path.join(tmp_dirname, "pytorch_model.bin"))) # check if `config.json` is not present self.assertFalse(os.path.exists(os.path.join(tmp_dirname, "config.json"))) def test_generate(self) -> None: model = LlamaForCausalLM(self._create_test_llama_config()) model = get_peft_model(model, self._create_multitask_prompt_tuning_config()) model = model.to(self.torch_device) input_ids = torch.LongTensor([[1, 1, 1], [2, 1, 2]]).to(self.torch_device) attention_mask = torch.LongTensor([[1, 1, 1], [1, 0, 1]]).to(self.torch_device) task_ids = torch.LongTensor([1, 2]).to(self.torch_device) # check if `generate` works _ = model.generate(input_ids=input_ids, attention_mask=attention_mask, task_ids=task_ids) # check if `generate` works if positional arguments are passed _ = model.generate(input_ids, attention_mask=attention_mask, task_ids=task_ids) def test_use_cache(self) -> None: """Test that MultiTaskPromptTuning works when Llama config use_cache=True.""" torch.manual_seed(0) input_ids = torch.LongTensor([[1, 1, 1], [2, 1, 2]]).to(self.torch_device) task_ids = torch.LongTensor([1, 2]).to(self.torch_device) original = LlamaForCausalLM(self._create_test_llama_config()).eval() mpt = get_peft_model(original, self._create_multitask_prompt_tuning_config()) mpt = mpt.to(self.torch_device) expected = mpt.generate(input_ids=input_ids, max_length=8, task_ids=task_ids) # Set use_cache = True and generate output again. mpt.base_model.config.use_cache = True actual = mpt.generate(input_ids=input_ids, max_length=8, task_ids=task_ids) assert_close(expected, actual, rtol=0, atol=0) def test_bf16_inference(self) -> None: """Test that MultiTaskPromptTuning works when Llama using a half-precision model.""" input_ids = torch.LongTensor([[1, 1, 1], [2, 1, 2]]).to(self.torch_device) task_ids = torch.tensor([1, 2]).to(self.torch_device) original = LlamaForCausalLM.from_pretrained( "trl-internal-testing/tiny-random-LlamaForCausalLM", torch_dtype=torch.bfloat16 ) mpt = get_peft_model(original, self._create_multitask_prompt_tuning_config()) mpt = mpt.to(self.torch_device) _ = mpt.generate(input_ids=input_ids, task_ids=task_ids)
peft/tests/test_multitask_prompt_tuning.py/0
{ "file_path": "peft/tests/test_multitask_prompt_tuning.py", "repo_id": "peft", "token_count": 4478 }
164
#!/usr/bin/env python3 """ Checkpoint Cleaning Script Takes training checkpoints with GPU tensors, optimizer state, extra dict keys, etc. and outputs a CPU tensor checkpoint with only the `state_dict` along with SHA256 calculation for model zoo compatibility. Hacked together by / Copyright 2020 Ross Wightman (https://github.com/rwightman) """ import torch import argparse import os import hashlib import shutil import tempfile from timm.models import load_state_dict try: import safetensors.torch _has_safetensors = True except ImportError: _has_safetensors = False parser = argparse.ArgumentParser(description='PyTorch Checkpoint Cleaner') parser.add_argument('--checkpoint', default='', type=str, metavar='PATH', help='path to latest checkpoint (default: none)') parser.add_argument('--output', default='', type=str, metavar='PATH', help='output path') parser.add_argument('--no-use-ema', dest='no_use_ema', action='store_true', help='use ema version of weights if present') parser.add_argument('--no-hash', dest='no_hash', action='store_true', help='no hash in output filename') parser.add_argument('--clean-aux-bn', dest='clean_aux_bn', action='store_true', help='remove auxiliary batch norm layers (from SplitBN training) from checkpoint') parser.add_argument('--safetensors', action='store_true', help='Save weights using safetensors instead of the default torch way (pickle).') def main(): args = parser.parse_args() if os.path.exists(args.output): print("Error: Output filename ({}) already exists.".format(args.output)) exit(1) clean_checkpoint( args.checkpoint, args.output, not args.no_use_ema, args.no_hash, args.clean_aux_bn, safe_serialization=args.safetensors, ) def clean_checkpoint( checkpoint, output, use_ema=True, no_hash=False, clean_aux_bn=False, safe_serialization: bool=False, ): # Load an existing checkpoint to CPU, strip everything but the state_dict and re-save if checkpoint and os.path.isfile(checkpoint): print("=> Loading checkpoint '{}'".format(checkpoint)) state_dict = load_state_dict(checkpoint, use_ema=use_ema) new_state_dict = {} for k, v in state_dict.items(): if clean_aux_bn and 'aux_bn' in k: # If all aux_bn keys are removed, the SplitBN layers will end up as normal and # load with the unmodified model using BatchNorm2d. continue name = k[7:] if k.startswith('module.') else k new_state_dict[name] = v print("=> Loaded state_dict from '{}'".format(checkpoint)) ext = '' if output: checkpoint_root, checkpoint_base = os.path.split(output) checkpoint_base, ext = os.path.splitext(checkpoint_base) else: checkpoint_root = '' checkpoint_base = os.path.split(checkpoint)[1] checkpoint_base = os.path.splitext(checkpoint_base)[0] temp_filename = '__' + checkpoint_base if safe_serialization: assert _has_safetensors, "`pip install safetensors` to use .safetensors" safetensors.torch.save_file(new_state_dict, temp_filename) else: torch.save(new_state_dict, temp_filename) with open(temp_filename, 'rb') as f: sha_hash = hashlib.sha256(f.read()).hexdigest() if ext: final_ext = ext else: final_ext = ('.safetensors' if safe_serialization else '.pth') if no_hash: final_filename = checkpoint_base + final_ext else: final_filename = '-'.join([checkpoint_base, sha_hash[:8]]) + final_ext shutil.move(temp_filename, os.path.join(checkpoint_root, final_filename)) print("=> Saved state_dict to '{}, SHA256: {}'".format(final_filename, sha_hash)) return final_filename else: print("Error: Checkpoint ({}) doesn't exist".format(checkpoint)) return '' if __name__ == '__main__': main()
pytorch-image-models/clean_checkpoint.py/0
{ "file_path": "pytorch-image-models/clean_checkpoint.py", "repo_id": "pytorch-image-models", "token_count": 1771 }
165
# CSP-DarkNet **CSPDarknet53** is a convolutional neural network and backbone for object detection that uses [DarkNet-53](https://paperswithcode.com/method/darknet-53). It employs a CSPNet strategy to partition the feature map of the base layer into two parts and then merges them through a cross-stage hierarchy. The use of a split and merge strategy allows for more gradient flow through the network. This CNN is used as the backbone for [YOLOv4](https://paperswithcode.com/method/yolov4). {% include 'code_snippets.md' %} ## How do I train this model? You can follow the [timm recipe scripts](https://rwightman.github.io/pytorch-image-models/scripts/) for training a new model afresh. ## Citation ```BibTeX @misc{bochkovskiy2020yolov4, title={YOLOv4: Optimal Speed and Accuracy of Object Detection}, author={Alexey Bochkovskiy and Chien-Yao Wang and Hong-Yuan Mark Liao}, year={2020}, eprint={2004.10934}, archivePrefix={arXiv}, primaryClass={cs.CV} } ``` <!-- Type: model-index Collections: - Name: CSP DarkNet Paper: Title: 'YOLOv4: Optimal Speed and Accuracy of Object Detection' URL: https://paperswithcode.com/paper/yolov4-optimal-speed-and-accuracy-of-object Models: - Name: cspdarknet53 In Collection: CSP DarkNet Metadata: FLOPs: 8545018880 Parameters: 27640000 File Size: 110775135 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - Global Average Pooling - Mish - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - CutMix - Label Smoothing - Mosaic - Polynomial Learning Rate Decay - SGD with Momentum - Self-Adversarial Training - Weight Decay Training Data: - ImageNet Training Resources: 1x NVIDIA RTX 2070 GPU ID: cspdarknet53 LR: 0.1 Layers: 53 Crop Pct: '0.887' Momentum: 0.9 Batch Size: 128 Image Size: '256' Warmup Steps: 1000 Weight Decay: 0.0005 Interpolation: bilinear Training Steps: 8000000 FPS (GPU RTX 2070): 66 Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/cspnet.py#L441 Weights: https://github.com/rwightman/pytorch-image-models/releases/download/v0.1-weights/cspdarknet53_ra_256-d05c7c21.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 80.05% Top 5 Accuracy: 95.09% -->
pytorch-image-models/docs/models/.templates/models/csp-darknet.md/0
{ "file_path": "pytorch-image-models/docs/models/.templates/models/csp-darknet.md", "repo_id": "pytorch-image-models", "token_count": 947 }
166
# (Gluon) SE-ResNeXt **SE ResNeXt** is a variant of a [ResNext](https://www.paperswithcode.com/method/resnext) that employs [squeeze-and-excitation blocks](https://paperswithcode.com/method/squeeze-and-excitation-block) to enable the network to perform dynamic channel-wise feature recalibration. The weights from this model were ported from [Gluon](https://cv.gluon.ai/model_zoo/classification.html). {% include 'code_snippets.md' %} ## How do I train this model? You can follow the [timm recipe scripts](https://rwightman.github.io/pytorch-image-models/scripts/) for training a new model afresh. ## Citation ```BibTeX @misc{hu2019squeezeandexcitation, title={Squeeze-and-Excitation Networks}, author={Jie Hu and Li Shen and Samuel Albanie and Gang Sun and Enhua Wu}, year={2019}, eprint={1709.01507}, archivePrefix={arXiv}, primaryClass={cs.CV} } ``` <!-- Type: model-index Collections: - Name: Gloun SEResNeXt Paper: Title: Squeeze-and-Excitation Networks URL: https://paperswithcode.com/paper/squeeze-and-excitation-networks Models: - Name: gluon_seresnext101_32x4d In Collection: Gloun SEResNeXt Metadata: FLOPs: 10302923504 Parameters: 48960000 File Size: 196505510 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - Global Average Pooling - Grouped Convolution - Max Pooling - ReLU - ResNeXt Block - Residual Connection - Softmax - Squeeze-and-Excitation Block Tasks: - Image Classification Training Data: - ImageNet ID: gluon_seresnext101_32x4d Crop Pct: '0.875' Image Size: '224' Interpolation: bicubic Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/gluon_resnet.py#L219 Weights: https://github.com/rwightman/pytorch-pretrained-gluonresnet/releases/download/v0.1/gluon_seresnext101_32x4d-cf52900d.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 80.87% Top 5 Accuracy: 95.29% - Name: gluon_seresnext101_64x4d In Collection: Gloun SEResNeXt Metadata: FLOPs: 19958950640 Parameters: 88230000 File Size: 353875948 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - Global Average Pooling - Grouped Convolution - Max Pooling - ReLU - ResNeXt Block - Residual Connection - Softmax - Squeeze-and-Excitation Block Tasks: - Image Classification Training Data: - ImageNet ID: gluon_seresnext101_64x4d Crop Pct: '0.875' Image Size: '224' Interpolation: bicubic Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/gluon_resnet.py#L229 Weights: https://github.com/rwightman/pytorch-pretrained-gluonresnet/releases/download/v0.1/gluon_seresnext101_64x4d-f9926f93.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 80.88% Top 5 Accuracy: 95.31% - Name: gluon_seresnext50_32x4d In Collection: Gloun SEResNeXt Metadata: FLOPs: 5475179184 Parameters: 27560000 File Size: 110578827 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - Global Average Pooling - Grouped Convolution - Max Pooling - ReLU - ResNeXt Block - Residual Connection - Softmax - Squeeze-and-Excitation Block Tasks: - Image Classification Training Data: - ImageNet ID: gluon_seresnext50_32x4d Crop Pct: '0.875' Image Size: '224' Interpolation: bicubic Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/gluon_resnet.py#L209 Weights: https://github.com/rwightman/pytorch-pretrained-gluonresnet/releases/download/v0.1/gluon_seresnext50_32x4d-90cf2d6e.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 79.92% Top 5 Accuracy: 94.82% -->
pytorch-image-models/docs/models/.templates/models/gloun-seresnext.md/0
{ "file_path": "pytorch-image-models/docs/models/.templates/models/gloun-seresnext.md", "repo_id": "pytorch-image-models", "token_count": 1705 }
167
# PNASNet **Progressive Neural Architecture Search**, or **PNAS**, is a method for learning the structure of convolutional neural networks (CNNs). It uses a sequential model-based optimization (SMBO) strategy, where we search the space of cell structures, starting with simple (shallow) models and progressing to complex ones, pruning out unpromising structures as we go. {% include 'code_snippets.md' %} ## How do I train this model? You can follow the [timm recipe scripts](https://rwightman.github.io/pytorch-image-models/scripts/) for training a new model afresh. ## Citation ```BibTeX @misc{liu2018progressive, title={Progressive Neural Architecture Search}, author={Chenxi Liu and Barret Zoph and Maxim Neumann and Jonathon Shlens and Wei Hua and Li-Jia Li and Li Fei-Fei and Alan Yuille and Jonathan Huang and Kevin Murphy}, year={2018}, eprint={1712.00559}, archivePrefix={arXiv}, primaryClass={cs.CV} } ``` <!-- Type: model-index Collections: - Name: PNASNet Paper: Title: Progressive Neural Architecture Search URL: https://paperswithcode.com/paper/progressive-neural-architecture-search Models: - Name: pnasnet5large In Collection: PNASNet Metadata: FLOPs: 31458865950 Parameters: 86060000 File Size: 345153926 Architecture: - Average Pooling - Batch Normalization - Convolution - Depthwise Separable Convolution - Dropout - ReLU Tasks: - Image Classification Training Techniques: - Label Smoothing - RMSProp - Weight Decay Training Data: - ImageNet Training Resources: 100x NVIDIA P100 GPUs ID: pnasnet5large LR: 0.015 Dropout: 0.5 Crop Pct: '0.911' Momentum: 0.9 Batch Size: 1600 Image Size: '331' Interpolation: bicubic Label Smoothing: 0.1 Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/pnasnet.py#L343 Weights: https://github.com/rwightman/pytorch-image-models/releases/download/v0.1-cadene/pnasnet5large-bf079911.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 0.98% Top 5 Accuracy: 18.58% -->
pytorch-image-models/docs/models/.templates/models/pnasnet.md/0
{ "file_path": "pytorch-image-models/docs/models/.templates/models/pnasnet.md", "repo_id": "pytorch-image-models", "token_count": 813 }
168
# SSL ResNet **Residual Networks**, or **ResNets**, learn residual functions with reference to the layer inputs, instead of learning unreferenced functions. Instead of hoping each few stacked layers directly fit a desired underlying mapping, residual nets let these layers fit a residual mapping. They stack [residual blocks](https://paperswithcode.com/method/residual-block) ontop of each other to form network: e.g. a ResNet-50 has fifty layers using these blocks. The model in this collection utilises semi-supervised learning to improve the performance of the model. The approach brings important gains to standard architectures for image, video and fine-grained classification. Please note the CC-BY-NC 4.0 license on theses weights, non-commercial use only. {% include 'code_snippets.md' %} ## How do I train this model? You can follow the [timm recipe scripts](https://rwightman.github.io/pytorch-image-models/scripts/) for training a new model afresh. ## Citation ```BibTeX @article{DBLP:journals/corr/abs-1905-00546, author = {I. Zeki Yalniz and Herv{\'{e}} J{\'{e}}gou and Kan Chen and Manohar Paluri and Dhruv Mahajan}, title = {Billion-scale semi-supervised learning for image classification}, journal = {CoRR}, volume = {abs/1905.00546}, year = {2019}, url = {http://arxiv.org/abs/1905.00546}, archivePrefix = {arXiv}, eprint = {1905.00546}, timestamp = {Mon, 28 Sep 2020 08:19:37 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1905-00546.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} } ``` <!-- Type: model-index Collections: - Name: SSL ResNet Paper: Title: Billion-scale semi-supervised learning for image classification URL: https://paperswithcode.com/paper/billion-scale-semi-supervised-learning-for Models: - Name: ssl_resnet18 In Collection: SSL ResNet Metadata: FLOPs: 2337073152 Parameters: 11690000 File Size: 46811375 Architecture: - 1x1 Convolution - Batch Normalization - Bottleneck Residual Block - Convolution - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet - YFCC-100M Training Resources: 64x GPUs ID: ssl_resnet18 LR: 0.0015 Epochs: 30 Layers: 18 Crop Pct: '0.875' Batch Size: 1536 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/9a25fdf3ad0414b4d66da443fe60ae0aa14edc84/timm/models/resnet.py#L894 Weights: https://dl.fbaipublicfiles.com/semiweaksupervision/model_files/semi_supervised_resnet18-d92f0530.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 72.62% Top 5 Accuracy: 91.42% - Name: ssl_resnet50 In Collection: SSL ResNet Metadata: FLOPs: 5282531328 Parameters: 25560000 File Size: 102480594 Architecture: - 1x1 Convolution - Batch Normalization - Bottleneck Residual Block - Convolution - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet - YFCC-100M Training Resources: 64x GPUs ID: ssl_resnet50 LR: 0.0015 Epochs: 30 Layers: 50 Crop Pct: '0.875' Batch Size: 1536 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/9a25fdf3ad0414b4d66da443fe60ae0aa14edc84/timm/models/resnet.py#L904 Weights: https://dl.fbaipublicfiles.com/semiweaksupervision/model_files/semi_supervised_resnet50-08389792.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 79.24% Top 5 Accuracy: 94.83% -->
pytorch-image-models/docs/models/.templates/models/ssl-resnet.md/0
{ "file_path": "pytorch-image-models/docs/models/.templates/models/ssl-resnet.md", "repo_id": "pytorch-image-models", "token_count": 1616 }
169
# Scripts A train, validation, inference, and checkpoint cleaning script included in the github root folder. Scripts are not currently packaged in the pip release. The training and validation scripts evolved from early versions of the [PyTorch Imagenet Examples](https://github.com/pytorch/examples). I have added significant functionality over time, including CUDA specific performance enhancements based on [NVIDIA's APEX Examples](https://github.com/NVIDIA/apex/tree/master/examples). ## Training Script The variety of training args is large and not all combinations of options (or even options) have been fully tested. For the training dataset folder, specify the folder to the base that contains a `train` and `validation` folder. To train an SE-ResNet34 on ImageNet, locally distributed, 4 GPUs, one process per GPU w/ cosine schedule, random-erasing prob of 50% and per-pixel random value: `./distributed_train.sh 4 /data/imagenet --model seresnet34 --sched cosine --epochs 150 --warmup-epochs 5 --lr 0.4 --reprob 0.5 --remode pixel --batch-size 256 --amp -j 4` NOTE: It is recommended to use PyTorch 1.9+ w/ PyTorch native AMP and DDP instead of APEX AMP. `--amp` defaults to native AMP as of timm ver 0.4.3. `--apex-amp` will force use of APEX components if they are installed. ## Validation / Inference Scripts Validation and inference scripts are similar in usage. One outputs metrics on a validation set and the other outputs topk class ids in a csv. Specify the folder containing validation images, not the base as in training script. To validate with the model's pretrained weights (if they exist): `python validate.py /imagenet/validation/ --model seresnext26_32x4d --pretrained` To run inference from a checkpoint: `python inference.py /imagenet/validation/ --model mobilenetv3_large_100 --checkpoint ./output/train/model_best.pth.tar`
pytorch-image-models/docs/scripts.md/0
{ "file_path": "pytorch-image-models/docs/scripts.md", "repo_id": "pytorch-image-models", "token_count": 511 }
170
# Deep Layer Aggregation Extending โ€œshallowโ€ skip connections, **Dense Layer Aggregation (DLA)** incorporates more depth and sharing. The authors introduce two structures for deep layer aggregation (DLA): iterative deep aggregation (IDA) and hierarchical deep aggregation (HDA). These structures are expressed through an architectural framework, independent of the choice of backbone, for compatibility with current and future networks. IDA focuses on fusing resolutions and scales while HDA focuses on merging features from all modules and channels. IDA follows the base hierarchy to refine resolution and aggregate scale stage-bystage. HDA assembles its own hierarchy of tree-structured connections that cross and merge stages to aggregate different levels of representation. ## How do I use this model on an image? To load a pretrained model: ```py >>> import timm >>> model = timm.create_model('dla102', pretrained=True) >>> model.eval() ``` To load and preprocess the image: ```py >>> import urllib >>> from PIL import Image >>> from timm.data import resolve_data_config >>> from timm.data.transforms_factory import create_transform >>> config = resolve_data_config({}, model=model) >>> transform = create_transform(**config) >>> url, filename = ("https://github.com/pytorch/hub/raw/master/images/dog.jpg", "dog.jpg") >>> urllib.request.urlretrieve(url, filename) >>> img = Image.open(filename).convert('RGB') >>> tensor = transform(img).unsqueeze(0) # transform and add batch dimension ``` To get the model predictions: ```py >>> import torch >>> with torch.no_grad(): ... out = model(tensor) >>> probabilities = torch.nn.functional.softmax(out[0], dim=0) >>> print(probabilities.shape) >>> # prints: torch.Size([1000]) ``` To get the top-5 predictions class names: ```py >>> # Get imagenet class mappings >>> url, filename = ("https://raw.githubusercontent.com/pytorch/hub/master/imagenet_classes.txt", "imagenet_classes.txt") >>> urllib.request.urlretrieve(url, filename) >>> with open("imagenet_classes.txt", "r") as f: ... categories = [s.strip() for s in f.readlines()] >>> # Print top categories per image >>> top5_prob, top5_catid = torch.topk(probabilities, 5) >>> for i in range(top5_prob.size(0)): ... print(categories[top5_catid[i]], top5_prob[i].item()) >>> # prints class names and probabilities like: >>> # [('Samoyed', 0.6425196528434753), ('Pomeranian', 0.04062102362513542), ('keeshond', 0.03186424449086189), ('white wolf', 0.01739676296710968), ('Eskimo dog', 0.011717947199940681)] ``` Replace the model name with the variant you want to use, e.g. `dla102`. You can find the IDs in the model summaries at the top of this page. To extract image features with this model, follow the [timm feature extraction examples](../feature_extraction), just change the name of the model you want to use. ## How do I finetune this model? You can finetune any of the pre-trained models just by changing the classifier (the last layer). ```py >>> model = timm.create_model('dla102', pretrained=True, num_classes=NUM_FINETUNE_CLASSES) ``` To finetune on your own dataset, you have to write a training loop or adapt [timm's training script](https://github.com/rwightman/pytorch-image-models/blob/master/train.py) to use your dataset. ## How do I train this model? You can follow the [timm recipe scripts](../scripts) for training a new model afresh. ## Citation ```BibTeX @misc{yu2019deep, title={Deep Layer Aggregation}, author={Fisher Yu and Dequan Wang and Evan Shelhamer and Trevor Darrell}, year={2019}, eprint={1707.06484}, archivePrefix={arXiv}, primaryClass={cs.CV} } ``` <!-- Type: model-index Collections: - Name: DLA Paper: Title: Deep Layer Aggregation URL: https://paperswithcode.com/paper/deep-layer-aggregation Models: - Name: dla102 In Collection: DLA Metadata: FLOPs: 7192952808 Parameters: 33270000 File Size: 135290579 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet Training Resources: 8x GPUs ID: dla102 LR: 0.1 Epochs: 120 Layers: 102 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L410 Weights: http://dl.yf.io/dla/models/imagenet/dla102-d94d9790.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 78.03% Top 5 Accuracy: 93.95% - Name: dla102x In Collection: DLA Metadata: FLOPs: 5886821352 Parameters: 26310000 File Size: 107552695 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet Training Resources: 8x GPUs ID: dla102x LR: 0.1 Epochs: 120 Layers: 102 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L418 Weights: http://dl.yf.io/dla/models/imagenet/dla102x-ad62be81.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 78.51% Top 5 Accuracy: 94.23% - Name: dla102x2 In Collection: DLA Metadata: FLOPs: 9343847400 Parameters: 41280000 File Size: 167645295 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet Training Resources: 8x GPUs ID: dla102x2 LR: 0.1 Epochs: 120 Layers: 102 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L426 Weights: http://dl.yf.io/dla/models/imagenet/dla102x2-262837b6.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 79.44% Top 5 Accuracy: 94.65% - Name: dla169 In Collection: DLA Metadata: FLOPs: 11598004200 Parameters: 53390000 File Size: 216547113 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet Training Resources: 8x GPUs ID: dla169 LR: 0.1 Epochs: 120 Layers: 169 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L434 Weights: http://dl.yf.io/dla/models/imagenet/dla169-0914e092.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 78.69% Top 5 Accuracy: 94.33% - Name: dla34 In Collection: DLA Metadata: FLOPs: 3070105576 Parameters: 15740000 File Size: 63228658 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla34 LR: 0.1 Epochs: 120 Layers: 32 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L362 Weights: http://dl.yf.io/dla/models/imagenet/dla34-ba72cf86.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 74.62% Top 5 Accuracy: 92.06% - Name: dla46_c In Collection: DLA Metadata: FLOPs: 583277288 Parameters: 1300000 File Size: 5307963 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla46_c LR: 0.1 Epochs: 120 Layers: 46 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L369 Weights: http://dl.yf.io/dla/models/imagenet/dla46_c-2bfd52c3.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 64.87% Top 5 Accuracy: 86.29% - Name: dla46x_c In Collection: DLA Metadata: FLOPs: 544052200 Parameters: 1070000 File Size: 4387641 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla46x_c LR: 0.1 Epochs: 120 Layers: 46 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L378 Weights: http://dl.yf.io/dla/models/imagenet/dla46x_c-d761bae7.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 65.98% Top 5 Accuracy: 86.99% - Name: dla60 In Collection: DLA Metadata: FLOPs: 4256251880 Parameters: 22040000 File Size: 89560235 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla60 LR: 0.1 Epochs: 120 Layers: 60 Dropout: 0.2 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L394 Weights: http://dl.yf.io/dla/models/imagenet/dla60-24839fc4.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 77.04% Top 5 Accuracy: 93.32% - Name: dla60_res2net In Collection: DLA Metadata: FLOPs: 4147578504 Parameters: 20850000 File Size: 84886593 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla60_res2net Layers: 60 Crop Pct: '0.875' Image Size: '224' Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L346 Weights: https://github.com/rwightman/pytorch-image-models/releases/download/v0.1-res2net/res2net_dla60_4s-d88db7f9.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 78.46% Top 5 Accuracy: 94.21% - Name: dla60_res2next In Collection: DLA Metadata: FLOPs: 3485335272 Parameters: 17030000 File Size: 69639245 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla60_res2next Layers: 60 Crop Pct: '0.875' Image Size: '224' Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L354 Weights: https://github.com/rwightman/pytorch-image-models/releases/download/v0.1-res2net/res2next_dla60_4s-d327927b.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 78.44% Top 5 Accuracy: 94.16% - Name: dla60x In Collection: DLA Metadata: FLOPs: 3544204264 Parameters: 17350000 File Size: 70883139 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla60x LR: 0.1 Epochs: 120 Layers: 60 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L402 Weights: http://dl.yf.io/dla/models/imagenet/dla60x-d15cacda.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 78.25% Top 5 Accuracy: 94.02% - Name: dla60x_c In Collection: DLA Metadata: FLOPs: 593325032 Parameters: 1320000 File Size: 5454396 Architecture: - 1x1 Convolution - Batch Normalization - Convolution - DLA Bottleneck Residual Block - DLA Residual Block - Global Average Pooling - Max Pooling - ReLU - Residual Block - Residual Connection - Softmax Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet ID: dla60x_c LR: 0.1 Epochs: 120 Layers: 60 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/dla.py#L386 Weights: http://dl.yf.io/dla/models/imagenet/dla60x_c-b870c45c.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 67.91% Top 5 Accuracy: 88.42% -->
pytorch-image-models/hfdocs/source/models/dla.mdx/0
{ "file_path": "pytorch-image-models/hfdocs/source/models/dla.mdx", "repo_id": "pytorch-image-models", "token_count": 6758 }
171
# Res2NeXt **Res2NeXt** is an image model that employs a variation on [ResNeXt](https://paperswithcode.com/method/resnext) bottleneck residual blocks. The motivation is to be able to represent features at multiple scales. This is achieved through a novel building block for CNNs that constructs hierarchical residual-like connections within one single residual block. This represents multi-scale features at a granular level and increases the range of receptive fields for each network layer. ## How do I use this model on an image? To load a pretrained model: ```py >>> import timm >>> model = timm.create_model('res2next50', pretrained=True) >>> model.eval() ``` To load and preprocess the image: ```py >>> import urllib >>> from PIL import Image >>> from timm.data import resolve_data_config >>> from timm.data.transforms_factory import create_transform >>> config = resolve_data_config({}, model=model) >>> transform = create_transform(**config) >>> url, filename = ("https://github.com/pytorch/hub/raw/master/images/dog.jpg", "dog.jpg") >>> urllib.request.urlretrieve(url, filename) >>> img = Image.open(filename).convert('RGB') >>> tensor = transform(img).unsqueeze(0) # transform and add batch dimension ``` To get the model predictions: ```py >>> import torch >>> with torch.no_grad(): ... out = model(tensor) >>> probabilities = torch.nn.functional.softmax(out[0], dim=0) >>> print(probabilities.shape) >>> # prints: torch.Size([1000]) ``` To get the top-5 predictions class names: ```py >>> # Get imagenet class mappings >>> url, filename = ("https://raw.githubusercontent.com/pytorch/hub/master/imagenet_classes.txt", "imagenet_classes.txt") >>> urllib.request.urlretrieve(url, filename) >>> with open("imagenet_classes.txt", "r") as f: ... categories = [s.strip() for s in f.readlines()] >>> # Print top categories per image >>> top5_prob, top5_catid = torch.topk(probabilities, 5) >>> for i in range(top5_prob.size(0)): ... print(categories[top5_catid[i]], top5_prob[i].item()) >>> # prints class names and probabilities like: >>> # [('Samoyed', 0.6425196528434753), ('Pomeranian', 0.04062102362513542), ('keeshond', 0.03186424449086189), ('white wolf', 0.01739676296710968), ('Eskimo dog', 0.011717947199940681)] ``` Replace the model name with the variant you want to use, e.g. `res2next50`. You can find the IDs in the model summaries at the top of this page. To extract image features with this model, follow the [timm feature extraction examples](../feature_extraction), just change the name of the model you want to use. ## How do I finetune this model? You can finetune any of the pre-trained models just by changing the classifier (the last layer). ```py >>> model = timm.create_model('res2next50', pretrained=True, num_classes=NUM_FINETUNE_CLASSES) ``` To finetune on your own dataset, you have to write a training loop or adapt [timm's training script](https://github.com/rwightman/pytorch-image-models/blob/master/train.py) to use your dataset. ## How do I train this model? You can follow the [timm recipe scripts](../scripts) for training a new model afresh. ## Citation ```BibTeX @article{Gao_2021, title={Res2Net: A New Multi-Scale Backbone Architecture}, volume={43}, ISSN={1939-3539}, url={http://dx.doi.org/10.1109/TPAMI.2019.2938758}, DOI={10.1109/tpami.2019.2938758}, number={2}, journal={IEEE Transactions on Pattern Analysis and Machine Intelligence}, publisher={Institute of Electrical and Electronics Engineers (IEEE)}, author={Gao, Shang-Hua and Cheng, Ming-Ming and Zhao, Kai and Zhang, Xin-Yu and Yang, Ming-Hsuan and Torr, Philip}, year={2021}, month={Feb}, pages={652โ€“662} } ``` <!-- Type: model-index Collections: - Name: Res2NeXt Paper: Title: 'Res2Net: A New Multi-scale Backbone Architecture' URL: https://paperswithcode.com/paper/res2net-a-new-multi-scale-backbone Models: - Name: res2next50 In Collection: Res2NeXt Metadata: FLOPs: 5396798208 Parameters: 24670000 File Size: 99019592 Architecture: - Batch Normalization - Convolution - Global Average Pooling - ReLU - Res2NeXt Block Tasks: - Image Classification Training Techniques: - SGD with Momentum - Weight Decay Training Data: - ImageNet Training Resources: 4x Titan Xp GPUs ID: res2next50 LR: 0.1 Epochs: 100 Crop Pct: '0.875' Momentum: 0.9 Batch Size: 256 Image Size: '224' Weight Decay: 0.0001 Interpolation: bilinear Code: https://github.com/rwightman/pytorch-image-models/blob/d8e69206be253892b2956341fea09fdebfaae4e3/timm/models/res2net.py#L207 Weights: https://github.com/rwightman/pytorch-image-models/releases/download/v0.1-res2net/res2next50_4s-6ef7e7bf.pth Results: - Task: Image Classification Dataset: ImageNet Metrics: Top 1 Accuracy: 78.24% Top 5 Accuracy: 93.91% -->
pytorch-image-models/hfdocs/source/models/res2next.mdx/0
{ "file_path": "pytorch-image-models/hfdocs/source/models/res2next.mdx", "repo_id": "pytorch-image-models", "token_count": 1711 }
172
#!/usr/bin/env python3 """PyTorch Inference Script An example inference script that outputs top-k class ids for images in a folder into a csv. Hacked together by / Copyright 2020 Ross Wightman (https://github.com/rwightman) """ import argparse import json import logging import os import time from contextlib import suppress from functools import partial import numpy as np import pandas as pd import torch from timm.data import create_dataset, create_loader, resolve_data_config, ImageNetInfo, infer_imagenet_subset from timm.layers import apply_test_time_pool from timm.models import create_model from timm.utils import AverageMeter, setup_default_logging, set_jit_fuser, ParseKwargs try: from apex import amp has_apex = True except ImportError: has_apex = False has_native_amp = False try: if getattr(torch.cuda.amp, 'autocast') is not None: has_native_amp = True except AttributeError: pass try: from functorch.compile import memory_efficient_fusion has_functorch = True except ImportError as e: has_functorch = False has_compile = hasattr(torch, 'compile') _FMT_EXT = { 'json': '.json', 'json-record': '.json', 'json-split': '.json', 'parquet': '.parquet', 'csv': '.csv', } torch.backends.cudnn.benchmark = True _logger = logging.getLogger('inference') parser = argparse.ArgumentParser(description='PyTorch ImageNet Inference') parser.add_argument('data', nargs='?', metavar='DIR', const=None, help='path to dataset (*deprecated*, use --data-dir)') parser.add_argument('--data-dir', metavar='DIR', help='path to dataset (root dir)') parser.add_argument('--dataset', metavar='NAME', default='', help='dataset type + name ("<type>/<name>") (default: ImageFolder or ImageTar if empty)') parser.add_argument('--split', metavar='NAME', default='validation', help='dataset split (default: validation)') parser.add_argument('--model', '-m', metavar='MODEL', default='resnet50', help='model architecture (default: resnet50)') parser.add_argument('-j', '--workers', default=2, type=int, metavar='N', help='number of data loading workers (default: 2)') parser.add_argument('-b', '--batch-size', default=256, type=int, metavar='N', help='mini-batch size (default: 256)') parser.add_argument('--img-size', default=None, type=int, metavar='N', help='Input image dimension, uses model default if empty') parser.add_argument('--in-chans', type=int, default=None, metavar='N', help='Image input channels (default: None => 3)') parser.add_argument('--input-size', default=None, nargs=3, type=int, metavar='N N N', help='Input all image dimensions (d h w, e.g. --input-size 3 224 224), uses model default if empty') parser.add_argument('--use-train-size', action='store_true', default=False, help='force use of train input size, even when test size is specified in pretrained cfg') parser.add_argument('--crop-pct', default=None, type=float, metavar='N', help='Input image center crop pct') parser.add_argument('--crop-mode', default=None, type=str, metavar='N', help='Input image crop mode (squash, border, center). Model default if None.') parser.add_argument('--mean', type=float, nargs='+', default=None, metavar='MEAN', help='Override mean pixel value of dataset') parser.add_argument('--std', type=float, nargs='+', default=None, metavar='STD', help='Override std deviation of of dataset') parser.add_argument('--interpolation', default='', type=str, metavar='NAME', help='Image resize interpolation type (overrides model)') parser.add_argument('--num-classes', type=int, default=None, help='Number classes in dataset') parser.add_argument('--class-map', default='', type=str, metavar='FILENAME', help='path to class to idx mapping file (default: "")') parser.add_argument('--log-freq', default=10, type=int, metavar='N', help='batch logging frequency (default: 10)') parser.add_argument('--checkpoint', default='', type=str, metavar='PATH', help='path to latest checkpoint (default: none)') parser.add_argument('--pretrained', dest='pretrained', action='store_true', help='use pre-trained model') parser.add_argument('--num-gpu', type=int, default=1, help='Number of GPUS to use') parser.add_argument('--test-pool', dest='test_pool', action='store_true', help='enable test time pool') parser.add_argument('--channels-last', action='store_true', default=False, help='Use channels_last memory layout') parser.add_argument('--device', default='cuda', type=str, help="Device (accelerator) to use.") parser.add_argument('--amp', action='store_true', default=False, help='use Native AMP for mixed precision training') parser.add_argument('--amp-dtype', default='float16', type=str, help='lower precision AMP dtype (default: float16)') parser.add_argument('--fuser', default='', type=str, help="Select jit fuser. One of ('', 'te', 'old', 'nvfuser')") parser.add_argument('--model-kwargs', nargs='*', default={}, action=ParseKwargs) scripting_group = parser.add_mutually_exclusive_group() scripting_group.add_argument('--torchscript', default=False, action='store_true', help='torch.jit.script the full model') scripting_group.add_argument('--torchcompile', nargs='?', type=str, default=None, const='inductor', help="Enable compilation w/ specified backend (default: inductor).") scripting_group.add_argument('--aot-autograd', default=False, action='store_true', help="Enable AOT Autograd support.") parser.add_argument('--results-dir', type=str, default=None, help='folder for output results') parser.add_argument('--results-file', type=str, default=None, help='results filename (relative to results-dir)') parser.add_argument('--results-format', type=str, nargs='+', default=['csv'], help='results format (one of "csv", "json", "json-split", "parquet")') parser.add_argument('--results-separate-col', action='store_true', default=False, help='separate output columns per result index.') parser.add_argument('--topk', default=1, type=int, metavar='N', help='Top-k to output to CSV') parser.add_argument('--fullname', action='store_true', default=False, help='use full sample name in output (not just basename).') parser.add_argument('--filename-col', type=str, default='filename', help='name for filename / sample name column') parser.add_argument('--index-col', type=str, default='index', help='name for output indices column(s)') parser.add_argument('--label-col', type=str, default='label', help='name for output indices column(s)') parser.add_argument('--output-col', type=str, default=None, help='name for logit/probs output column(s)') parser.add_argument('--output-type', type=str, default='prob', help='output type colum ("prob" for probabilities, "logit" for raw logits)') parser.add_argument('--label-type', type=str, default='description', help='type of label to output, one of "none", "name", "description", "detailed"') parser.add_argument('--include-index', action='store_true', default=False, help='include the class index in results') parser.add_argument('--exclude-output', action='store_true', default=False, help='exclude logits/probs from results, just indices. topk must be set !=0.') def main(): setup_default_logging() args = parser.parse_args() # might as well try to do something useful... args.pretrained = args.pretrained or not args.checkpoint if torch.cuda.is_available(): torch.backends.cuda.matmul.allow_tf32 = True torch.backends.cudnn.benchmark = True device = torch.device(args.device) # resolve AMP arguments based on PyTorch / Apex availability amp_autocast = suppress if args.amp: assert has_native_amp, 'Please update PyTorch to a version with native AMP (or use APEX).' assert args.amp_dtype in ('float16', 'bfloat16') amp_dtype = torch.bfloat16 if args.amp_dtype == 'bfloat16' else torch.float16 amp_autocast = partial(torch.autocast, device_type=device.type, dtype=amp_dtype) _logger.info('Running inference in mixed precision with native PyTorch AMP.') else: _logger.info('Running inference in float32. AMP not enabled.') if args.fuser: set_jit_fuser(args.fuser) # create model in_chans = 3 if args.in_chans is not None: in_chans = args.in_chans elif args.input_size is not None: in_chans = args.input_size[0] model = create_model( args.model, num_classes=args.num_classes, in_chans=in_chans, pretrained=args.pretrained, checkpoint_path=args.checkpoint, **args.model_kwargs, ) if args.num_classes is None: assert hasattr(model, 'num_classes'), 'Model must have `num_classes` attr if not set on cmd line/config.' args.num_classes = model.num_classes _logger.info( f'Model {args.model} created, param count: {sum([m.numel() for m in model.parameters()])}') data_config = resolve_data_config(vars(args), model=model) test_time_pool = False if args.test_pool: model, test_time_pool = apply_test_time_pool(model, data_config) model = model.to(device) model.eval() if args.channels_last: model = model.to(memory_format=torch.channels_last) if args.torchscript: model = torch.jit.script(model) elif args.torchcompile: assert has_compile, 'A version of torch w/ torch.compile() is required for --compile, possibly a nightly.' torch._dynamo.reset() model = torch.compile(model, backend=args.torchcompile) elif args.aot_autograd: assert has_functorch, "functorch is needed for --aot-autograd" model = memory_efficient_fusion(model) if args.num_gpu > 1: model = torch.nn.DataParallel(model, device_ids=list(range(args.num_gpu))) root_dir = args.data or args.data_dir dataset = create_dataset( root=root_dir, name=args.dataset, split=args.split, class_map=args.class_map, ) if test_time_pool: data_config['crop_pct'] = 1.0 workers = 1 if 'tfds' in args.dataset or 'wds' in args.dataset else args.workers loader = create_loader( dataset, batch_size=args.batch_size, use_prefetcher=True, num_workers=workers, **data_config, ) to_label = None if args.label_type in ('name', 'description', 'detail'): imagenet_subset = infer_imagenet_subset(model) if imagenet_subset is not None: dataset_info = ImageNetInfo(imagenet_subset) if args.label_type == 'name': to_label = lambda x: dataset_info.index_to_label_name(x) elif args.label_type == 'detail': to_label = lambda x: dataset_info.index_to_description(x, detailed=True) else: to_label = lambda x: dataset_info.index_to_description(x) to_label = np.vectorize(to_label) else: _logger.error("Cannot deduce ImageNet subset from model, no labelling will be performed.") top_k = min(args.topk, args.num_classes) batch_time = AverageMeter() end = time.time() all_indices = [] all_labels = [] all_outputs = [] use_probs = args.output_type == 'prob' with torch.no_grad(): for batch_idx, (input, _) in enumerate(loader): with amp_autocast(): output = model(input) if use_probs: output = output.softmax(-1) if top_k: output, indices = output.topk(top_k) np_indices = indices.cpu().numpy() if args.include_index: all_indices.append(np_indices) if to_label is not None: np_labels = to_label(np_indices) all_labels.append(np_labels) all_outputs.append(output.cpu().numpy()) # measure elapsed time batch_time.update(time.time() - end) end = time.time() if batch_idx % args.log_freq == 0: _logger.info('Predict: [{0}/{1}] Time {batch_time.val:.3f} ({batch_time.avg:.3f})'.format( batch_idx, len(loader), batch_time=batch_time)) all_indices = np.concatenate(all_indices, axis=0) if all_indices else None all_labels = np.concatenate(all_labels, axis=0) if all_labels else None all_outputs = np.concatenate(all_outputs, axis=0).astype(np.float32) filenames = loader.dataset.filenames(basename=not args.fullname) output_col = args.output_col or ('prob' if use_probs else 'logit') data_dict = {args.filename_col: filenames} if args.results_separate_col and all_outputs.shape[-1] > 1: if all_indices is not None: for i in range(all_indices.shape[-1]): data_dict[f'{args.index_col}_{i}'] = all_indices[:, i] if all_labels is not None: for i in range(all_labels.shape[-1]): data_dict[f'{args.label_col}_{i}'] = all_labels[:, i] for i in range(all_outputs.shape[-1]): data_dict[f'{output_col}_{i}'] = all_outputs[:, i] else: if all_indices is not None: if all_indices.shape[-1] == 1: all_indices = all_indices.squeeze(-1) data_dict[args.index_col] = list(all_indices) if all_labels is not None: if all_labels.shape[-1] == 1: all_labels = all_labels.squeeze(-1) data_dict[args.label_col] = list(all_labels) if all_outputs.shape[-1] == 1: all_outputs = all_outputs.squeeze(-1) data_dict[output_col] = list(all_outputs) df = pd.DataFrame(data=data_dict) results_filename = args.results_file if results_filename: filename_no_ext, ext = os.path.splitext(results_filename) if ext and ext in _FMT_EXT.values(): # if filename provided with one of expected ext, # remove it as it will be added back results_filename = filename_no_ext else: # base default filename on model name + img-size img_size = data_config["input_size"][1] results_filename = f'{args.model}-{img_size}' if args.results_dir: results_filename = os.path.join(args.results_dir, results_filename) for fmt in args.results_format: save_results(df, results_filename, fmt) print(f'--result') print(df.set_index(args.filename_col).to_json(orient='index', indent=4)) def save_results(df, results_filename, results_format='csv', filename_col='filename'): results_filename += _FMT_EXT[results_format] if results_format == 'parquet': df.set_index(filename_col).to_parquet(results_filename) elif results_format == 'json': df.set_index(filename_col).to_json(results_filename, indent=4, orient='index') elif results_format == 'json-records': df.to_json(results_filename, lines=True, orient='records') elif results_format == 'json-split': df.to_json(results_filename, indent=4, orient='split', index=False) else: df.to_csv(results_filename, index=False) if __name__ == '__main__': main()
pytorch-image-models/inference.py/0
{ "file_path": "pytorch-image-models/inference.py", "repo_id": "pytorch-image-models", "token_count": 6803 }
173
[dist_conda] conda_name_differences = 'torch:pytorch' channels = pytorch noarch = True
pytorch-image-models/setup.cfg/0
{ "file_path": "pytorch-image-models/setup.cfg", "repo_id": "pytorch-image-models", "token_count": 37 }
174
""" Dataset Factory Hacked together by / Copyright 2021, Ross Wightman """ import os from typing import Optional from torchvision.datasets import CIFAR100, CIFAR10, MNIST, KMNIST, FashionMNIST, ImageFolder try: from torchvision.datasets import Places365 has_places365 = True except ImportError: has_places365 = False try: from torchvision.datasets import INaturalist has_inaturalist = True except ImportError: has_inaturalist = False try: from torchvision.datasets import QMNIST has_qmnist = True except ImportError: has_qmnist = False try: from torchvision.datasets import ImageNet has_imagenet = True except ImportError: has_imagenet = False from .dataset import IterableImageDataset, ImageDataset _TORCH_BASIC_DS = dict( cifar10=CIFAR10, cifar100=CIFAR100, mnist=MNIST, kmnist=KMNIST, fashion_mnist=FashionMNIST, ) _TRAIN_SYNONYM = dict(train=None, training=None) _EVAL_SYNONYM = dict(val=None, valid=None, validation=None, eval=None, evaluation=None) def _search_split(root, split): # look for sub-folder with name of split in root and use that if it exists split_name = split.split('[')[0] try_root = os.path.join(root, split_name) if os.path.exists(try_root): return try_root def _try(syn): for s in syn: try_root = os.path.join(root, s) if os.path.exists(try_root): return try_root return root if split_name in _TRAIN_SYNONYM: root = _try(_TRAIN_SYNONYM) elif split_name in _EVAL_SYNONYM: root = _try(_EVAL_SYNONYM) return root def create_dataset( name: str, root: Optional[str] = None, split: str = 'validation', search_split: bool = True, class_map: dict = None, load_bytes: bool = False, is_training: bool = False, download: bool = False, batch_size: int = 1, num_samples: Optional[int] = None, seed: int = 42, repeats: int = 0, input_img_mode: str = 'RGB', **kwargs, ): """ Dataset factory method In parentheses after each arg are the type of dataset supported for each arg, one of: * folder - default, timm folder (or tar) based ImageDataset * torch - torchvision based datasets * HFDS - Hugging Face Datasets * TFDS - Tensorflow-datasets wrapper in IterabeDataset interface via IterableImageDataset * WDS - Webdataset * all - any of the above Args: name: dataset name, empty is okay for folder based datasets root: root folder of dataset (all) split: dataset split (all) search_split: search for split specific child fold from root so one can specify `imagenet/` instead of `/imagenet/val`, etc on cmd line / config. (folder, torch/folder) class_map: specify class -> index mapping via text file or dict (folder) load_bytes: load data, return images as undecoded bytes (folder) download: download dataset if not present and supported (HFDS, TFDS, torch) is_training: create dataset in train mode, this is different from the split. For Iterable / TDFS it enables shuffle, ignored for other datasets. (TFDS, WDS) batch_size: batch size hint for (TFDS, WDS) seed: seed for iterable datasets (TFDS, WDS) repeats: dataset repeats per iteration i.e. epoch (TFDS, WDS) input_img_mode: Input image color conversion mode e.g. 'RGB', 'L' (folder, TFDS, WDS, HFDS) **kwargs: other args to pass to dataset Returns: Dataset object """ kwargs = {k: v for k, v in kwargs.items() if v is not None} name = name.lower() if name.startswith('torch/'): name = name.split('/', 2)[-1] torch_kwargs = dict(root=root, download=download, **kwargs) if name in _TORCH_BASIC_DS: ds_class = _TORCH_BASIC_DS[name] use_train = split in _TRAIN_SYNONYM ds = ds_class(train=use_train, **torch_kwargs) elif name == 'inaturalist' or name == 'inat': assert has_inaturalist, 'Please update to PyTorch 1.10, torchvision 0.11+ for Inaturalist' target_type = 'full' split_split = split.split('/') if len(split_split) > 1: target_type = split_split[0].split('_') if len(target_type) == 1: target_type = target_type[0] split = split_split[-1] if split in _TRAIN_SYNONYM: split = '2021_train' elif split in _EVAL_SYNONYM: split = '2021_valid' ds = INaturalist(version=split, target_type=target_type, **torch_kwargs) elif name == 'places365': assert has_places365, 'Please update to a newer PyTorch and torchvision for Places365 dataset.' if split in _TRAIN_SYNONYM: split = 'train-standard' elif split in _EVAL_SYNONYM: split = 'val' ds = Places365(split=split, **torch_kwargs) elif name == 'qmnist': assert has_qmnist, 'Please update to a newer PyTorch and torchvision for QMNIST dataset.' use_train = split in _TRAIN_SYNONYM ds = QMNIST(train=use_train, **torch_kwargs) elif name == 'imagenet': assert has_imagenet, 'Please update to a newer PyTorch and torchvision for ImageNet dataset.' if split in _EVAL_SYNONYM: split = 'val' ds = ImageNet(split=split, **torch_kwargs) elif name == 'image_folder' or name == 'folder': # in case torchvision ImageFolder is preferred over timm ImageDataset for some reason if search_split and os.path.isdir(root): # look for split specific sub-folder in root root = _search_split(root, split) ds = ImageFolder(root, **kwargs) else: assert False, f"Unknown torchvision dataset {name}" elif name.startswith('hfds/'): # NOTE right now, HF datasets default arrow format is a random-access Dataset, # There will be a IterableDataset variant too, TBD ds = ImageDataset( root, reader=name, split=split, class_map=class_map, input_img_mode=input_img_mode, **kwargs, ) elif name.startswith('hfids/'): ds = IterableImageDataset( root, reader=name, split=split, class_map=class_map, is_training=is_training, download=download, batch_size=batch_size, num_samples=num_samples, repeats=repeats, seed=seed, input_img_mode=input_img_mode, **kwargs ) elif name.startswith('tfds/'): ds = IterableImageDataset( root, reader=name, split=split, class_map=class_map, is_training=is_training, download=download, batch_size=batch_size, num_samples=num_samples, repeats=repeats, seed=seed, input_img_mode=input_img_mode, **kwargs ) elif name.startswith('wds/'): ds = IterableImageDataset( root, reader=name, split=split, class_map=class_map, is_training=is_training, batch_size=batch_size, num_samples=num_samples, repeats=repeats, seed=seed, input_img_mode=input_img_mode, **kwargs ) else: # FIXME support more advance split cfg for ImageFolder/Tar datasets in the future if search_split and os.path.isdir(root): # look for split specific sub-folder in root root = _search_split(root, split) ds = ImageDataset( root, reader=name, class_map=class_map, load_bytes=load_bytes, input_img_mode=input_img_mode, **kwargs, ) return ds
pytorch-image-models/timm/data/dataset_factory.py/0
{ "file_path": "pytorch-image-models/timm/data/dataset_factory.py", "repo_id": "pytorch-image-models", "token_count": 3864 }
175
""" A dataset reader that reads single tarfile based datasets This reader can read datasets consisting if a single tarfile containing images. I am planning to deprecated it in favour of ParerImageInTar. Hacked together by / Copyright 2020 Ross Wightman """ import os import tarfile from timm.utils.misc import natural_key from .class_map import load_class_map from .img_extensions import get_img_extensions from .reader import Reader def extract_tarinfo(tarfile, class_to_idx=None, sort=True): extensions = get_img_extensions(as_set=True) files = [] labels = [] for ti in tarfile.getmembers(): if not ti.isfile(): continue dirname, basename = os.path.split(ti.path) label = os.path.basename(dirname) ext = os.path.splitext(basename)[1] if ext.lower() in extensions: files.append(ti) labels.append(label) if class_to_idx is None: unique_labels = set(labels) sorted_labels = list(sorted(unique_labels, key=natural_key)) class_to_idx = {c: idx for idx, c in enumerate(sorted_labels)} tarinfo_and_targets = [(f, class_to_idx[l]) for f, l in zip(files, labels) if l in class_to_idx] if sort: tarinfo_and_targets = sorted(tarinfo_and_targets, key=lambda k: natural_key(k[0].path)) return tarinfo_and_targets, class_to_idx class ReaderImageTar(Reader): """ Single tarfile dataset where classes are mapped to folders within tar NOTE: This class is being deprecated in favour of the more capable ReaderImageInTar that can operate on folders of tars or tars in tars. """ def __init__(self, root, class_map=''): super().__init__() class_to_idx = None if class_map: class_to_idx = load_class_map(class_map, root) assert os.path.isfile(root) self.root = root with tarfile.open(root) as tf: # cannot keep this open across processes, reopen later self.samples, self.class_to_idx = extract_tarinfo(tf, class_to_idx) self.imgs = self.samples self.tarfile = None # lazy init in __getitem__ def __getitem__(self, index): if self.tarfile is None: self.tarfile = tarfile.open(self.root) tarinfo, target = self.samples[index] fileobj = self.tarfile.extractfile(tarinfo) return fileobj, target def __len__(self): return len(self.samples) def _filename(self, index, basename=False, absolute=False): filename = self.samples[index][0].name if basename: filename = os.path.basename(filename) return filename
pytorch-image-models/timm/data/readers/reader_image_tar.py/0
{ "file_path": "pytorch-image-models/timm/data/readers/reader_image_tar.py", "repo_id": "pytorch-image-models", "token_count": 1071 }
176
""" Bottleneck Self Attention (Bottleneck Transformers) Paper: `Bottleneck Transformers for Visual Recognition` - https://arxiv.org/abs/2101.11605 @misc{2101.11605, Author = {Aravind Srinivas and Tsung-Yi Lin and Niki Parmar and Jonathon Shlens and Pieter Abbeel and Ashish Vaswani}, Title = {Bottleneck Transformers for Visual Recognition}, Year = {2021}, } Based on ref gist at: https://gist.github.com/aravindsrinivas/56359b79f0ce4449bcb04ab4b56a57a2 This impl is a WIP but given that it is based on the ref gist likely not too far off. Hacked together by / Copyright 2021 Ross Wightman """ from typing import List import torch import torch.nn as nn import torch.nn.functional as F from .helpers import to_2tuple, make_divisible from .weight_init import trunc_normal_ from .trace_utils import _assert def rel_logits_1d(q, rel_k, permute_mask: List[int]): """ Compute relative logits along one dimension As per: https://gist.github.com/aravindsrinivas/56359b79f0ce4449bcb04ab4b56a57a2 Originally from: `Attention Augmented Convolutional Networks` - https://arxiv.org/abs/1904.09925 Args: q: (batch, heads, height, width, dim) rel_k: (2 * width - 1, dim) permute_mask: permute output dim according to this """ B, H, W, dim = q.shape x = (q @ rel_k.transpose(-1, -2)) x = x.reshape(-1, W, 2 * W -1) # pad to shift from relative to absolute indexing x_pad = F.pad(x, [0, 1]).flatten(1) x_pad = F.pad(x_pad, [0, W - 1]) # reshape and slice out the padded elements x_pad = x_pad.reshape(-1, W + 1, 2 * W - 1) x = x_pad[:, :W, W - 1:] # reshape and tile x = x.reshape(B, H, 1, W, W).expand(-1, -1, H, -1, -1) return x.permute(permute_mask) class PosEmbedRel(nn.Module): """ Relative Position Embedding As per: https://gist.github.com/aravindsrinivas/56359b79f0ce4449bcb04ab4b56a57a2 Originally from: `Attention Augmented Convolutional Networks` - https://arxiv.org/abs/1904.09925 """ def __init__(self, feat_size, dim_head, scale): super().__init__() self.height, self.width = to_2tuple(feat_size) self.dim_head = dim_head self.height_rel = nn.Parameter(torch.randn(self.height * 2 - 1, dim_head) * scale) self.width_rel = nn.Parameter(torch.randn(self.width * 2 - 1, dim_head) * scale) def forward(self, q): B, HW, _ = q.shape # relative logits in width dimension. q = q.reshape(B, self.height, self.width, -1) rel_logits_w = rel_logits_1d(q, self.width_rel, permute_mask=(0, 1, 3, 2, 4)) # relative logits in height dimension. q = q.transpose(1, 2) rel_logits_h = rel_logits_1d(q, self.height_rel, permute_mask=(0, 3, 1, 4, 2)) rel_logits = rel_logits_h + rel_logits_w rel_logits = rel_logits.reshape(B, HW, HW) return rel_logits class BottleneckAttn(nn.Module): """ Bottleneck Attention Paper: `Bottleneck Transformers for Visual Recognition` - https://arxiv.org/abs/2101.11605 The internal dimensions of the attention module are controlled by the interaction of several arguments. * the output dimension of the module is specified by dim_out, which falls back to input dim if not set * the value (v) dimension is set to dim_out // num_heads, the v projection determines the output dim * the query and key (qk) dimensions are determined by * num_heads * dim_head if dim_head is not None * num_heads * (dim_out * attn_ratio // num_heads) if dim_head is None * as seen above, attn_ratio determines the ratio of q and k relative to the output if dim_head not used Args: dim (int): input dimension to the module dim_out (int): output dimension of the module, same as dim if not set stride (int): output stride of the module, avg pool used if stride == 2 (default: 1). num_heads (int): parallel attention heads (default: 4) dim_head (int): dimension of query and key heads, calculated from dim_out * attn_ratio // num_heads if not set qk_ratio (float): ratio of q and k dimensions to output dimension when dim_head not set. (default: 1.0) qkv_bias (bool): add bias to q, k, and v projections scale_pos_embed (bool): scale the position embedding as well as Q @ K """ def __init__( self, dim, dim_out=None, feat_size=None, stride=1, num_heads=4, dim_head=None, qk_ratio=1.0, qkv_bias=False, scale_pos_embed=False): super().__init__() assert feat_size is not None, 'A concrete feature size matching expected input (H, W) is required' dim_out = dim_out or dim assert dim_out % num_heads == 0 self.num_heads = num_heads self.dim_head_qk = dim_head or make_divisible(dim_out * qk_ratio, divisor=8) // num_heads self.dim_head_v = dim_out // self.num_heads self.dim_out_qk = num_heads * self.dim_head_qk self.dim_out_v = num_heads * self.dim_head_v self.scale = self.dim_head_qk ** -0.5 self.scale_pos_embed = scale_pos_embed self.qkv = nn.Conv2d(dim, self.dim_out_qk * 2 + self.dim_out_v, 1, bias=qkv_bias) # NOTE I'm only supporting relative pos embedding for now self.pos_embed = PosEmbedRel(feat_size, dim_head=self.dim_head_qk, scale=self.scale) self.pool = nn.AvgPool2d(2, 2) if stride == 2 else nn.Identity() self.reset_parameters() def reset_parameters(self): trunc_normal_(self.qkv.weight, std=self.qkv.weight.shape[1] ** -0.5) # fan-in trunc_normal_(self.pos_embed.height_rel, std=self.scale) trunc_normal_(self.pos_embed.width_rel, std=self.scale) def forward(self, x): B, C, H, W = x.shape _assert(H == self.pos_embed.height, '') _assert(W == self.pos_embed.width, '') x = self.qkv(x) # B, (2 * dim_head_qk + dim_head_v) * num_heads, H, W # NOTE head vs channel split ordering in qkv projection was decided before I allowed qk to differ from v # So, this is more verbose than if heads were before qkv splits, but throughput is not impacted. q, k, v = torch.split(x, [self.dim_out_qk, self.dim_out_qk, self.dim_out_v], dim=1) q = q.reshape(B * self.num_heads, self.dim_head_qk, -1).transpose(-1, -2) k = k.reshape(B * self.num_heads, self.dim_head_qk, -1) # no transpose, for q @ k v = v.reshape(B * self.num_heads, self.dim_head_v, -1).transpose(-1, -2) if self.scale_pos_embed: attn = (q @ k + self.pos_embed(q)) * self.scale # B * num_heads, H * W, H * W else: attn = (q @ k) * self.scale + self.pos_embed(q) attn = attn.softmax(dim=-1) out = (attn @ v).transpose(-1, -2).reshape(B, self.dim_out_v, H, W) # B, dim_out, H, W out = self.pool(out) return out
pytorch-image-models/timm/layers/bottleneck_attn.py/0
{ "file_path": "pytorch-image-models/timm/layers/bottleneck_attn.py", "repo_id": "pytorch-image-models", "token_count": 2907 }
177
""" Filter Response Norm in PyTorch Based on `Filter Response Normalization Layer` - https://arxiv.org/abs/1911.09737 Hacked together by / Copyright 2021 Ross Wightman """ import torch import torch.nn as nn from .create_act import create_act_layer from .trace_utils import _assert def inv_instance_rms(x, eps: float = 1e-5): rms = x.square().float().mean(dim=(2, 3), keepdim=True).add(eps).rsqrt().to(x.dtype) return rms.expand(x.shape) class FilterResponseNormTlu2d(nn.Module): def __init__(self, num_features, apply_act=True, eps=1e-5, rms=True, **_): super(FilterResponseNormTlu2d, self).__init__() self.apply_act = apply_act # apply activation (non-linearity) self.rms = rms self.eps = eps self.weight = nn.Parameter(torch.ones(num_features)) self.bias = nn.Parameter(torch.zeros(num_features)) self.tau = nn.Parameter(torch.zeros(num_features)) if apply_act else None self.reset_parameters() def reset_parameters(self): nn.init.ones_(self.weight) nn.init.zeros_(self.bias) if self.tau is not None: nn.init.zeros_(self.tau) def forward(self, x): _assert(x.dim() == 4, 'expected 4D input') x_dtype = x.dtype v_shape = (1, -1, 1, 1) x = x * inv_instance_rms(x, self.eps) x = x * self.weight.view(v_shape).to(dtype=x_dtype) + self.bias.view(v_shape).to(dtype=x_dtype) return torch.maximum(x, self.tau.reshape(v_shape).to(dtype=x_dtype)) if self.tau is not None else x class FilterResponseNormAct2d(nn.Module): def __init__(self, num_features, apply_act=True, act_layer=nn.ReLU, inplace=None, rms=True, eps=1e-5, **_): super(FilterResponseNormAct2d, self).__init__() if act_layer is not None and apply_act: self.act = create_act_layer(act_layer, inplace=inplace) else: self.act = nn.Identity() self.rms = rms self.eps = eps self.weight = nn.Parameter(torch.ones(num_features)) self.bias = nn.Parameter(torch.zeros(num_features)) self.reset_parameters() def reset_parameters(self): nn.init.ones_(self.weight) nn.init.zeros_(self.bias) def forward(self, x): _assert(x.dim() == 4, 'expected 4D input') x_dtype = x.dtype v_shape = (1, -1, 1, 1) x = x * inv_instance_rms(x, self.eps) x = x * self.weight.view(v_shape).to(dtype=x_dtype) + self.bias.view(v_shape).to(dtype=x_dtype) return self.act(x)
pytorch-image-models/timm/layers/filter_response_norm.py/0
{ "file_path": "pytorch-image-models/timm/layers/filter_response_norm.py", "repo_id": "pytorch-image-models", "token_count": 1182 }
178
""" Bilinear-Attention-Transform and Non-Local Attention Paper: `Non-Local Neural Networks With Grouped Bilinear Attentional Transforms` - https://openaccess.thecvf.com/content_CVPR_2020/html/Chi_Non-Local_Neural_Networks_With_Grouped_Bilinear_Attentional_Transforms_CVPR_2020_paper.html Adapted from original code: https://github.com/BA-Transform/BAT-Image-Classification """ import torch from torch import nn from torch.nn import functional as F from .conv_bn_act import ConvNormAct from .helpers import make_divisible from .trace_utils import _assert class NonLocalAttn(nn.Module): """Spatial NL block for image classification. This was adapted from https://github.com/BA-Transform/BAT-Image-Classification Their NonLocal impl inspired by https://github.com/facebookresearch/video-nonlocal-net. """ def __init__(self, in_channels, use_scale=True, rd_ratio=1/8, rd_channels=None, rd_divisor=8, **kwargs): super(NonLocalAttn, self).__init__() if rd_channels is None: rd_channels = make_divisible(in_channels * rd_ratio, divisor=rd_divisor) self.scale = in_channels ** -0.5 if use_scale else 1.0 self.t = nn.Conv2d(in_channels, rd_channels, kernel_size=1, stride=1, bias=True) self.p = nn.Conv2d(in_channels, rd_channels, kernel_size=1, stride=1, bias=True) self.g = nn.Conv2d(in_channels, rd_channels, kernel_size=1, stride=1, bias=True) self.z = nn.Conv2d(rd_channels, in_channels, kernel_size=1, stride=1, bias=True) self.norm = nn.BatchNorm2d(in_channels) self.reset_parameters() def forward(self, x): shortcut = x t = self.t(x) p = self.p(x) g = self.g(x) B, C, H, W = t.size() t = t.view(B, C, -1).permute(0, 2, 1) p = p.view(B, C, -1) g = g.view(B, C, -1).permute(0, 2, 1) att = torch.bmm(t, p) * self.scale att = F.softmax(att, dim=2) x = torch.bmm(att, g) x = x.permute(0, 2, 1).reshape(B, C, H, W) x = self.z(x) x = self.norm(x) + shortcut return x def reset_parameters(self): for name, m in self.named_modules(): if isinstance(m, nn.Conv2d): nn.init.kaiming_normal_( m.weight, mode='fan_out', nonlinearity='relu') if len(list(m.parameters())) > 1: nn.init.constant_(m.bias, 0.0) elif isinstance(m, nn.BatchNorm2d): nn.init.constant_(m.weight, 0) nn.init.constant_(m.bias, 0) elif isinstance(m, nn.GroupNorm): nn.init.constant_(m.weight, 0) nn.init.constant_(m.bias, 0) class BilinearAttnTransform(nn.Module): def __init__(self, in_channels, block_size, groups, act_layer=nn.ReLU, norm_layer=nn.BatchNorm2d): super(BilinearAttnTransform, self).__init__() self.conv1 = ConvNormAct(in_channels, groups, 1, act_layer=act_layer, norm_layer=norm_layer) self.conv_p = nn.Conv2d(groups, block_size * block_size * groups, kernel_size=(block_size, 1)) self.conv_q = nn.Conv2d(groups, block_size * block_size * groups, kernel_size=(1, block_size)) self.conv2 = ConvNormAct(in_channels, in_channels, 1, act_layer=act_layer, norm_layer=norm_layer) self.block_size = block_size self.groups = groups self.in_channels = in_channels def resize_mat(self, x, t: int): B, C, block_size, block_size1 = x.shape _assert(block_size == block_size1, '') if t <= 1: return x x = x.view(B * C, -1, 1, 1) x = x * torch.eye(t, t, dtype=x.dtype, device=x.device) x = x.view(B * C, block_size, block_size, t, t) x = torch.cat(torch.split(x, 1, dim=1), dim=3) x = torch.cat(torch.split(x, 1, dim=2), dim=4) x = x.view(B, C, block_size * t, block_size * t) return x def forward(self, x): _assert(x.shape[-1] % self.block_size == 0, '') _assert(x.shape[-2] % self.block_size == 0, '') B, C, H, W = x.shape out = self.conv1(x) rp = F.adaptive_max_pool2d(out, (self.block_size, 1)) cp = F.adaptive_max_pool2d(out, (1, self.block_size)) p = self.conv_p(rp).view(B, self.groups, self.block_size, self.block_size).sigmoid() q = self.conv_q(cp).view(B, self.groups, self.block_size, self.block_size).sigmoid() p = p / p.sum(dim=3, keepdim=True) q = q / q.sum(dim=2, keepdim=True) p = p.view(B, self.groups, 1, self.block_size, self.block_size).expand(x.size( 0), self.groups, C // self.groups, self.block_size, self.block_size).contiguous() p = p.view(B, C, self.block_size, self.block_size) q = q.view(B, self.groups, 1, self.block_size, self.block_size).expand(x.size( 0), self.groups, C // self.groups, self.block_size, self.block_size).contiguous() q = q.view(B, C, self.block_size, self.block_size) p = self.resize_mat(p, H // self.block_size) q = self.resize_mat(q, W // self.block_size) y = p.matmul(x) y = y.matmul(q) y = self.conv2(y) return y class BatNonLocalAttn(nn.Module): """ BAT Adapted from: https://github.com/BA-Transform/BAT-Image-Classification """ def __init__( self, in_channels, block_size=7, groups=2, rd_ratio=0.25, rd_channels=None, rd_divisor=8, drop_rate=0.2, act_layer=nn.ReLU, norm_layer=nn.BatchNorm2d, **_): super().__init__() if rd_channels is None: rd_channels = make_divisible(in_channels * rd_ratio, divisor=rd_divisor) self.conv1 = ConvNormAct(in_channels, rd_channels, 1, act_layer=act_layer, norm_layer=norm_layer) self.ba = BilinearAttnTransform(rd_channels, block_size, groups, act_layer=act_layer, norm_layer=norm_layer) self.conv2 = ConvNormAct(rd_channels, in_channels, 1, act_layer=act_layer, norm_layer=norm_layer) self.dropout = nn.Dropout2d(p=drop_rate) def forward(self, x): xl = self.conv1(x) y = self.ba(xl) y = self.conv2(y) y = self.dropout(y) return y + x
pytorch-image-models/timm/layers/non_local_attn.py/0
{ "file_path": "pytorch-image-models/timm/layers/non_local_attn.py", "repo_id": "pytorch-image-models", "token_count": 3028 }
179
""" Convolution with Weight Standardization (StdConv and ScaledStdConv) StdConv: @article{weightstandardization, author = {Siyuan Qiao and Huiyu Wang and Chenxi Liu and Wei Shen and Alan Yuille}, title = {Weight Standardization}, journal = {arXiv preprint arXiv:1903.10520}, year = {2019}, } Code: https://github.com/joe-siyuan-qiao/WeightStandardization ScaledStdConv: Paper: `Characterizing signal propagation to close the performance gap in unnormalized ResNets` - https://arxiv.org/abs/2101.08692 Official Deepmind JAX code: https://github.com/deepmind/deepmind-research/tree/master/nfnets Hacked together by / copyright Ross Wightman, 2021. """ import torch import torch.nn as nn import torch.nn.functional as F from .padding import get_padding, get_padding_value, pad_same class StdConv2d(nn.Conv2d): """Conv2d with Weight Standardization. Used for BiT ResNet-V2 models. Paper: `Micro-Batch Training with Batch-Channel Normalization and Weight Standardization` - https://arxiv.org/abs/1903.10520v2 """ def __init__( self, in_channel, out_channels, kernel_size, stride=1, padding=None, dilation=1, groups=1, bias=False, eps=1e-6): if padding is None: padding = get_padding(kernel_size, stride, dilation) super().__init__( in_channel, out_channels, kernel_size, stride=stride, padding=padding, dilation=dilation, groups=groups, bias=bias) self.eps = eps def forward(self, x): weight = F.batch_norm( self.weight.reshape(1, self.out_channels, -1), None, None, training=True, momentum=0., eps=self.eps).reshape_as(self.weight) x = F.conv2d(x, weight, self.bias, self.stride, self.padding, self.dilation, self.groups) return x class StdConv2dSame(nn.Conv2d): """Conv2d with Weight Standardization. TF compatible SAME padding. Used for ViT Hybrid model. Paper: `Micro-Batch Training with Batch-Channel Normalization and Weight Standardization` - https://arxiv.org/abs/1903.10520v2 """ def __init__( self, in_channel, out_channels, kernel_size, stride=1, padding='SAME', dilation=1, groups=1, bias=False, eps=1e-6): padding, is_dynamic = get_padding_value(padding, kernel_size, stride=stride, dilation=dilation) super().__init__( in_channel, out_channels, kernel_size, stride=stride, padding=padding, dilation=dilation, groups=groups, bias=bias) self.same_pad = is_dynamic self.eps = eps def forward(self, x): if self.same_pad: x = pad_same(x, self.kernel_size, self.stride, self.dilation) weight = F.batch_norm( self.weight.reshape(1, self.out_channels, -1), None, None, training=True, momentum=0., eps=self.eps).reshape_as(self.weight) x = F.conv2d(x, weight, self.bias, self.stride, self.padding, self.dilation, self.groups) return x class ScaledStdConv2d(nn.Conv2d): """Conv2d layer with Scaled Weight Standardization. Paper: `Characterizing signal propagation to close the performance gap in unnormalized ResNets` - https://arxiv.org/abs/2101.08692 NOTE: the operations used in this impl differ slightly from the DeepMind Haiku impl. The impact is minor. """ def __init__( self, in_channels, out_channels, kernel_size, stride=1, padding=None, dilation=1, groups=1, bias=True, gamma=1.0, eps=1e-6, gain_init=1.0): if padding is None: padding = get_padding(kernel_size, stride, dilation) super().__init__( in_channels, out_channels, kernel_size, stride=stride, padding=padding, dilation=dilation, groups=groups, bias=bias) self.gain = nn.Parameter(torch.full((self.out_channels, 1, 1, 1), gain_init)) self.scale = gamma * self.weight[0].numel() ** -0.5 # gamma * 1 / sqrt(fan-in) self.eps = eps def forward(self, x): weight = F.batch_norm( self.weight.reshape(1, self.out_channels, -1), None, None, weight=(self.gain * self.scale).view(-1), training=True, momentum=0., eps=self.eps).reshape_as(self.weight) return F.conv2d(x, weight, self.bias, self.stride, self.padding, self.dilation, self.groups) class ScaledStdConv2dSame(nn.Conv2d): """Conv2d layer with Scaled Weight Standardization and Tensorflow-like SAME padding support Paper: `Characterizing signal propagation to close the performance gap in unnormalized ResNets` - https://arxiv.org/abs/2101.08692 NOTE: the operations used in this impl differ slightly from the DeepMind Haiku impl. The impact is minor. """ def __init__( self, in_channels, out_channels, kernel_size, stride=1, padding='SAME', dilation=1, groups=1, bias=True, gamma=1.0, eps=1e-6, gain_init=1.0): padding, is_dynamic = get_padding_value(padding, kernel_size, stride=stride, dilation=dilation) super().__init__( in_channels, out_channels, kernel_size, stride=stride, padding=padding, dilation=dilation, groups=groups, bias=bias) self.gain = nn.Parameter(torch.full((self.out_channels, 1, 1, 1), gain_init)) self.scale = gamma * self.weight[0].numel() ** -0.5 self.same_pad = is_dynamic self.eps = eps def forward(self, x): if self.same_pad: x = pad_same(x, self.kernel_size, self.stride, self.dilation) weight = F.batch_norm( self.weight.reshape(1, self.out_channels, -1), None, None, weight=(self.gain * self.scale).view(-1), training=True, momentum=0., eps=self.eps).reshape_as(self.weight) return F.conv2d(x, weight, self.bias, self.stride, self.padding, self.dilation, self.groups)
pytorch-image-models/timm/layers/std_conv.py/0
{ "file_path": "pytorch-image-models/timm/layers/std_conv.py", "repo_id": "pytorch-image-models", "token_count": 2483 }
180
""" PyTorch FX Based Feature Extraction Helpers Using https://pytorch.org/vision/stable/feature_extraction.html """ from typing import Callable, List, Dict, Union, Type import torch from torch import nn from ._features import _get_feature_info, _get_return_layers try: from torchvision.models.feature_extraction import create_feature_extractor as _create_feature_extractor has_fx_feature_extraction = True except ImportError: has_fx_feature_extraction = False # Layers we went to treat as leaf modules from timm.layers import Conv2dSame, ScaledStdConv2dSame, CondConv2d, StdConv2dSame from timm.layers.non_local_attn import BilinearAttnTransform from timm.layers.pool2d_same import MaxPool2dSame, AvgPool2dSame from timm.layers.norm_act import ( BatchNormAct2d, SyncBatchNormAct, FrozenBatchNormAct2d, GroupNormAct, GroupNorm1Act, LayerNormAct, LayerNormAct2d ) __all__ = ['register_notrace_module', 'is_notrace_module', 'get_notrace_modules', 'register_notrace_function', 'is_notrace_function', 'get_notrace_functions', 'create_feature_extractor', 'FeatureGraphNet', 'GraphExtractNet'] # NOTE: By default, any modules from timm.models.layers that we want to treat as leaf modules go here # BUT modules from timm.models should use the registration mechanism below _leaf_modules = { BilinearAttnTransform, # reason: flow control t <= 1 # Reason: get_same_padding has a max which raises a control flow error Conv2dSame, MaxPool2dSame, ScaledStdConv2dSame, StdConv2dSame, AvgPool2dSame, CondConv2d, # reason: TypeError: F.conv2d received Proxy in groups=self.groups * B (because B = x.shape[0]), BatchNormAct2d, SyncBatchNormAct, FrozenBatchNormAct2d, GroupNormAct, GroupNorm1Act, LayerNormAct, LayerNormAct2d, } try: from timm.layers import InplaceAbn _leaf_modules.add(InplaceAbn) except ImportError: pass def register_notrace_module(module: Type[nn.Module]): """ Any module not under timm.models.layers should get this decorator if we don't want to trace through it. """ _leaf_modules.add(module) return module def is_notrace_module(module: Type[nn.Module]): return module in _leaf_modules def get_notrace_modules(): return list(_leaf_modules) # Functions we want to autowrap (treat them as leaves) _autowrap_functions = set() def register_notrace_function(func: Callable): """ Decorator for functions which ought not to be traced through """ _autowrap_functions.add(func) return func def is_notrace_function(func: Callable): return func in _autowrap_functions def get_notrace_functions(): return list(_autowrap_functions) def create_feature_extractor(model: nn.Module, return_nodes: Union[Dict[str, str], List[str]]): assert has_fx_feature_extraction, 'Please update to PyTorch 1.10+, torchvision 0.11+ for FX feature extraction' return _create_feature_extractor( model, return_nodes, tracer_kwargs={'leaf_modules': list(_leaf_modules), 'autowrap_functions': list(_autowrap_functions)} ) class FeatureGraphNet(nn.Module): """ A FX Graph based feature extractor that works with the model feature_info metadata """ def __init__(self, model, out_indices, out_map=None): super().__init__() assert has_fx_feature_extraction, 'Please update to PyTorch 1.10+, torchvision 0.11+ for FX feature extraction' self.feature_info = _get_feature_info(model, out_indices) if out_map is not None: assert len(out_map) == len(out_indices) return_nodes = _get_return_layers(self.feature_info, out_map) self.graph_module = create_feature_extractor(model, return_nodes) def forward(self, x): return list(self.graph_module(x).values()) class GraphExtractNet(nn.Module): """ A standalone feature extraction wrapper that maps dict -> list or single tensor NOTE: * one can use feature_extractor directly if dictionary output is desired * unlike FeatureGraphNet, this is intended to be used standalone and not with model feature_info metadata for builtin feature extraction mode * create_feature_extractor can be used directly if dictionary output is acceptable Args: model: model to extract features from return_nodes: node names to return features from (dict or list) squeeze_out: if only one output, and output in list format, flatten to single tensor """ def __init__(self, model, return_nodes: Union[Dict[str, str], List[str]], squeeze_out: bool = True): super().__init__() self.squeeze_out = squeeze_out self.graph_module = create_feature_extractor(model, return_nodes) def forward(self, x) -> Union[List[torch.Tensor], torch.Tensor]: out = list(self.graph_module(x).values()) if self.squeeze_out and len(out) == 1: return out[0] return out
pytorch-image-models/timm/models/_features_fx.py/0
{ "file_path": "pytorch-image-models/timm/models/_features_fx.py", "repo_id": "pytorch-image-models", "token_count": 1801 }
181
""" CoaT architecture. Paper: Co-Scale Conv-Attentional Image Transformers - https://arxiv.org/abs/2104.06399 Official CoaT code at: https://github.com/mlpc-ucsd/CoaT Modified from timm/models/vision_transformer.py """ from functools import partial from typing import Tuple, List, Union import torch import torch.nn as nn import torch.nn.functional as F from timm.data import IMAGENET_DEFAULT_MEAN, IMAGENET_DEFAULT_STD from timm.layers import PatchEmbed, Mlp, DropPath, to_2tuple, trunc_normal_, _assert, LayerNorm from ._builder import build_model_with_cfg from ._registry import register_model, generate_default_cfgs __all__ = ['CoaT'] class ConvRelPosEnc(nn.Module): """ Convolutional relative position encoding. """ def __init__(self, head_chs, num_heads, window): """ Initialization. Ch: Channels per head. h: Number of heads. window: Window size(s) in convolutional relative positional encoding. It can have two forms: 1. An integer of window size, which assigns all attention heads with the same window s size in ConvRelPosEnc. 2. A dict mapping window size to #attention head splits ( e.g. {window size 1: #attention head split 1, window size 2: #attention head split 2}) It will apply different window size to the attention head splits. """ super().__init__() if isinstance(window, int): # Set the same window size for all attention heads. window = {window: num_heads} self.window = window elif isinstance(window, dict): self.window = window else: raise ValueError() self.conv_list = nn.ModuleList() self.head_splits = [] for cur_window, cur_head_split in window.items(): dilation = 1 # Determine padding size. # Ref: https://discuss.pytorch.org/t/how-to-keep-the-shape-of-input-and-output-same-when-dilation-conv/14338 padding_size = (cur_window + (cur_window - 1) * (dilation - 1)) // 2 cur_conv = nn.Conv2d( cur_head_split * head_chs, cur_head_split * head_chs, kernel_size=(cur_window, cur_window), padding=(padding_size, padding_size), dilation=(dilation, dilation), groups=cur_head_split * head_chs, ) self.conv_list.append(cur_conv) self.head_splits.append(cur_head_split) self.channel_splits = [x * head_chs for x in self.head_splits] def forward(self, q, v, size: Tuple[int, int]): B, num_heads, N, C = q.shape H, W = size _assert(N == 1 + H * W, '') # Convolutional relative position encoding. q_img = q[:, :, 1:, :] # [B, h, H*W, Ch] v_img = v[:, :, 1:, :] # [B, h, H*W, Ch] v_img = v_img.transpose(-1, -2).reshape(B, num_heads * C, H, W) v_img_list = torch.split(v_img, self.channel_splits, dim=1) # Split according to channels conv_v_img_list = [] for i, conv in enumerate(self.conv_list): conv_v_img_list.append(conv(v_img_list[i])) conv_v_img = torch.cat(conv_v_img_list, dim=1) conv_v_img = conv_v_img.reshape(B, num_heads, C, H * W).transpose(-1, -2) EV_hat = q_img * conv_v_img EV_hat = F.pad(EV_hat, (0, 0, 1, 0, 0, 0)) # [B, h, N, Ch]. return EV_hat class FactorAttnConvRelPosEnc(nn.Module): """ Factorized attention with convolutional relative position encoding class. """ def __init__( self, dim, num_heads=8, qkv_bias=False, attn_drop=0., proj_drop=0., shared_crpe=None, ): super().__init__() self.num_heads = num_heads head_dim = dim // num_heads self.scale = head_dim ** -0.5 self.qkv = nn.Linear(dim, dim * 3, bias=qkv_bias) self.attn_drop = nn.Dropout(attn_drop) # Note: attn_drop is actually not used. self.proj = nn.Linear(dim, dim) self.proj_drop = nn.Dropout(proj_drop) # Shared convolutional relative position encoding. self.crpe = shared_crpe def forward(self, x, size: Tuple[int, int]): B, N, C = x.shape # Generate Q, K, V. qkv = self.qkv(x).reshape(B, N, 3, self.num_heads, C // self.num_heads).permute(2, 0, 3, 1, 4) q, k, v = qkv.unbind(0) # [B, h, N, Ch] # Factorized attention. k_softmax = k.softmax(dim=2) factor_att = k_softmax.transpose(-1, -2) @ v factor_att = q @ factor_att # Convolutional relative position encoding. crpe = self.crpe(q, v, size=size) # [B, h, N, Ch] # Merge and reshape. x = self.scale * factor_att + crpe x = x.transpose(1, 2).reshape(B, N, C) # [B, h, N, Ch] -> [B, N, h, Ch] -> [B, N, C] # Output projection. x = self.proj(x) x = self.proj_drop(x) return x class ConvPosEnc(nn.Module): """ Convolutional Position Encoding. Note: This module is similar to the conditional position encoding in CPVT. """ def __init__(self, dim, k=3): super(ConvPosEnc, self).__init__() self.proj = nn.Conv2d(dim, dim, k, 1, k//2, groups=dim) def forward(self, x, size: Tuple[int, int]): B, N, C = x.shape H, W = size _assert(N == 1 + H * W, '') # Extract CLS token and image tokens. cls_token, img_tokens = x[:, :1], x[:, 1:] # [B, 1, C], [B, H*W, C] # Depthwise convolution. feat = img_tokens.transpose(1, 2).view(B, C, H, W) x = self.proj(feat) + feat x = x.flatten(2).transpose(1, 2) # Combine with CLS token. x = torch.cat((cls_token, x), dim=1) return x class SerialBlock(nn.Module): """ Serial block class. Note: In this implementation, each serial block only contains a conv-attention and a FFN (MLP) module. """ def __init__( self, dim, num_heads, mlp_ratio=4., qkv_bias=False, proj_drop=0., attn_drop=0., drop_path=0., act_layer=nn.GELU, norm_layer=nn.LayerNorm, shared_cpe=None, shared_crpe=None, ): super().__init__() # Conv-Attention. self.cpe = shared_cpe self.norm1 = norm_layer(dim) self.factoratt_crpe = FactorAttnConvRelPosEnc( dim, num_heads=num_heads, qkv_bias=qkv_bias, attn_drop=attn_drop, proj_drop=proj_drop, shared_crpe=shared_crpe, ) self.drop_path = DropPath(drop_path) if drop_path > 0. else nn.Identity() # MLP. self.norm2 = norm_layer(dim) mlp_hidden_dim = int(dim * mlp_ratio) self.mlp = Mlp( in_features=dim, hidden_features=mlp_hidden_dim, act_layer=act_layer, drop=proj_drop, ) def forward(self, x, size: Tuple[int, int]): # Conv-Attention. x = self.cpe(x, size) cur = self.norm1(x) cur = self.factoratt_crpe(cur, size) x = x + self.drop_path(cur) # MLP. cur = self.norm2(x) cur = self.mlp(cur) x = x + self.drop_path(cur) return x class ParallelBlock(nn.Module): """ Parallel block class. """ def __init__( self, dims, num_heads, mlp_ratios=[], qkv_bias=False, proj_drop=0., attn_drop=0., drop_path=0., act_layer=nn.GELU, norm_layer=nn.LayerNorm, shared_crpes=None, ): super().__init__() # Conv-Attention. self.norm12 = norm_layer(dims[1]) self.norm13 = norm_layer(dims[2]) self.norm14 = norm_layer(dims[3]) self.factoratt_crpe2 = FactorAttnConvRelPosEnc( dims[1], num_heads=num_heads, qkv_bias=qkv_bias, attn_drop=attn_drop, proj_drop=proj_drop, shared_crpe=shared_crpes[1], ) self.factoratt_crpe3 = FactorAttnConvRelPosEnc( dims[2], num_heads=num_heads, qkv_bias=qkv_bias, attn_drop=attn_drop, proj_drop=proj_drop, shared_crpe=shared_crpes[2], ) self.factoratt_crpe4 = FactorAttnConvRelPosEnc( dims[3], num_heads=num_heads, qkv_bias=qkv_bias, attn_drop=attn_drop, proj_drop=proj_drop, shared_crpe=shared_crpes[3], ) self.drop_path = DropPath(drop_path) if drop_path > 0. else nn.Identity() # MLP. self.norm22 = norm_layer(dims[1]) self.norm23 = norm_layer(dims[2]) self.norm24 = norm_layer(dims[3]) # In parallel block, we assume dimensions are the same and share the linear transformation. assert dims[1] == dims[2] == dims[3] assert mlp_ratios[1] == mlp_ratios[2] == mlp_ratios[3] mlp_hidden_dim = int(dims[1] * mlp_ratios[1]) self.mlp2 = self.mlp3 = self.mlp4 = Mlp( in_features=dims[1], hidden_features=mlp_hidden_dim, act_layer=act_layer, drop=proj_drop, ) def upsample(self, x, factor: float, size: Tuple[int, int]): """ Feature map up-sampling. """ return self.interpolate(x, scale_factor=factor, size=size) def downsample(self, x, factor: float, size: Tuple[int, int]): """ Feature map down-sampling. """ return self.interpolate(x, scale_factor=1.0/factor, size=size) def interpolate(self, x, scale_factor: float, size: Tuple[int, int]): """ Feature map interpolation. """ B, N, C = x.shape H, W = size _assert(N == 1 + H * W, '') cls_token = x[:, :1, :] img_tokens = x[:, 1:, :] img_tokens = img_tokens.transpose(1, 2).reshape(B, C, H, W) img_tokens = F.interpolate( img_tokens, scale_factor=scale_factor, recompute_scale_factor=False, mode='bilinear', align_corners=False, ) img_tokens = img_tokens.reshape(B, C, -1).transpose(1, 2) out = torch.cat((cls_token, img_tokens), dim=1) return out def forward(self, x1, x2, x3, x4, sizes: List[Tuple[int, int]]): _, S2, S3, S4 = sizes cur2 = self.norm12(x2) cur3 = self.norm13(x3) cur4 = self.norm14(x4) cur2 = self.factoratt_crpe2(cur2, size=S2) cur3 = self.factoratt_crpe3(cur3, size=S3) cur4 = self.factoratt_crpe4(cur4, size=S4) upsample3_2 = self.upsample(cur3, factor=2., size=S3) upsample4_3 = self.upsample(cur4, factor=2., size=S4) upsample4_2 = self.upsample(cur4, factor=4., size=S4) downsample2_3 = self.downsample(cur2, factor=2., size=S2) downsample3_4 = self.downsample(cur3, factor=2., size=S3) downsample2_4 = self.downsample(cur2, factor=4., size=S2) cur2 = cur2 + upsample3_2 + upsample4_2 cur3 = cur3 + upsample4_3 + downsample2_3 cur4 = cur4 + downsample3_4 + downsample2_4 x2 = x2 + self.drop_path(cur2) x3 = x3 + self.drop_path(cur3) x4 = x4 + self.drop_path(cur4) # MLP. cur2 = self.norm22(x2) cur3 = self.norm23(x3) cur4 = self.norm24(x4) cur2 = self.mlp2(cur2) cur3 = self.mlp3(cur3) cur4 = self.mlp4(cur4) x2 = x2 + self.drop_path(cur2) x3 = x3 + self.drop_path(cur3) x4 = x4 + self.drop_path(cur4) return x1, x2, x3, x4 class CoaT(nn.Module): """ CoaT class. """ def __init__( self, img_size=224, patch_size=16, in_chans=3, num_classes=1000, embed_dims=(64, 128, 320, 512), serial_depths=(3, 4, 6, 3), parallel_depth=0, num_heads=8, mlp_ratios=(4, 4, 4, 4), qkv_bias=True, drop_rate=0., proj_drop_rate=0., attn_drop_rate=0., drop_path_rate=0., norm_layer=LayerNorm, return_interm_layers=False, out_features=None, crpe_window=None, global_pool='token', ): super().__init__() assert global_pool in ('token', 'avg') crpe_window = crpe_window or {3: 2, 5: 3, 7: 3} self.return_interm_layers = return_interm_layers self.out_features = out_features self.embed_dims = embed_dims self.num_features = embed_dims[-1] self.num_classes = num_classes self.global_pool = global_pool # Patch embeddings. img_size = to_2tuple(img_size) self.patch_embed1 = PatchEmbed( img_size=img_size, patch_size=patch_size, in_chans=in_chans, embed_dim=embed_dims[0], norm_layer=nn.LayerNorm) self.patch_embed2 = PatchEmbed( img_size=[x // 4 for x in img_size], patch_size=2, in_chans=embed_dims[0], embed_dim=embed_dims[1], norm_layer=nn.LayerNorm) self.patch_embed3 = PatchEmbed( img_size=[x // 8 for x in img_size], patch_size=2, in_chans=embed_dims[1], embed_dim=embed_dims[2], norm_layer=nn.LayerNorm) self.patch_embed4 = PatchEmbed( img_size=[x // 16 for x in img_size], patch_size=2, in_chans=embed_dims[2], embed_dim=embed_dims[3], norm_layer=nn.LayerNorm) # Class tokens. self.cls_token1 = nn.Parameter(torch.zeros(1, 1, embed_dims[0])) self.cls_token2 = nn.Parameter(torch.zeros(1, 1, embed_dims[1])) self.cls_token3 = nn.Parameter(torch.zeros(1, 1, embed_dims[2])) self.cls_token4 = nn.Parameter(torch.zeros(1, 1, embed_dims[3])) # Convolutional position encodings. self.cpe1 = ConvPosEnc(dim=embed_dims[0], k=3) self.cpe2 = ConvPosEnc(dim=embed_dims[1], k=3) self.cpe3 = ConvPosEnc(dim=embed_dims[2], k=3) self.cpe4 = ConvPosEnc(dim=embed_dims[3], k=3) # Convolutional relative position encodings. self.crpe1 = ConvRelPosEnc(head_chs=embed_dims[0] // num_heads, num_heads=num_heads, window=crpe_window) self.crpe2 = ConvRelPosEnc(head_chs=embed_dims[1] // num_heads, num_heads=num_heads, window=crpe_window) self.crpe3 = ConvRelPosEnc(head_chs=embed_dims[2] // num_heads, num_heads=num_heads, window=crpe_window) self.crpe4 = ConvRelPosEnc(head_chs=embed_dims[3] // num_heads, num_heads=num_heads, window=crpe_window) # Disable stochastic depth. dpr = drop_path_rate assert dpr == 0.0 skwargs = dict( num_heads=num_heads, qkv_bias=qkv_bias, proj_drop=proj_drop_rate, attn_drop=attn_drop_rate, drop_path=dpr, norm_layer=norm_layer, ) # Serial blocks 1. self.serial_blocks1 = nn.ModuleList([ SerialBlock( dim=embed_dims[0], mlp_ratio=mlp_ratios[0], shared_cpe=self.cpe1, shared_crpe=self.crpe1, **skwargs, ) for _ in range(serial_depths[0])] ) # Serial blocks 2. self.serial_blocks2 = nn.ModuleList([ SerialBlock( dim=embed_dims[1], mlp_ratio=mlp_ratios[1], shared_cpe=self.cpe2, shared_crpe=self.crpe2, **skwargs, ) for _ in range(serial_depths[1])] ) # Serial blocks 3. self.serial_blocks3 = nn.ModuleList([ SerialBlock( dim=embed_dims[2], mlp_ratio=mlp_ratios[2], shared_cpe=self.cpe3, shared_crpe=self.crpe3, **skwargs, ) for _ in range(serial_depths[2])] ) # Serial blocks 4. self.serial_blocks4 = nn.ModuleList([ SerialBlock( dim=embed_dims[3], mlp_ratio=mlp_ratios[3], shared_cpe=self.cpe4, shared_crpe=self.crpe4, **skwargs, ) for _ in range(serial_depths[3])] ) # Parallel blocks. self.parallel_depth = parallel_depth if self.parallel_depth > 0: self.parallel_blocks = nn.ModuleList([ ParallelBlock( dims=embed_dims, mlp_ratios=mlp_ratios, shared_crpes=(self.crpe1, self.crpe2, self.crpe3, self.crpe4), **skwargs, ) for _ in range(parallel_depth)] ) else: self.parallel_blocks = None # Classification head(s). if not self.return_interm_layers: if self.parallel_blocks is not None: self.norm2 = norm_layer(embed_dims[1]) self.norm3 = norm_layer(embed_dims[2]) else: self.norm2 = self.norm3 = None self.norm4 = norm_layer(embed_dims[3]) if self.parallel_depth > 0: # CoaT series: Aggregate features of last three scales for classification. assert embed_dims[1] == embed_dims[2] == embed_dims[3] self.aggregate = torch.nn.Conv1d(in_channels=3, out_channels=1, kernel_size=1) self.head_drop = nn.Dropout(drop_rate) self.head = nn.Linear(self.num_features, num_classes) if num_classes > 0 else nn.Identity() else: # CoaT-Lite series: Use feature of last scale for classification. self.aggregate = None self.head_drop = nn.Dropout(drop_rate) self.head = nn.Linear(self.num_features, num_classes) if num_classes > 0 else nn.Identity() # Initialize weights. trunc_normal_(self.cls_token1, std=.02) trunc_normal_(self.cls_token2, std=.02) trunc_normal_(self.cls_token3, std=.02) trunc_normal_(self.cls_token4, std=.02) self.apply(self._init_weights) def _init_weights(self, m): if isinstance(m, nn.Linear): trunc_normal_(m.weight, std=.02) if isinstance(m, nn.Linear) and m.bias is not None: nn.init.constant_(m.bias, 0) elif isinstance(m, nn.LayerNorm): nn.init.constant_(m.bias, 0) nn.init.constant_(m.weight, 1.0) @torch.jit.ignore def no_weight_decay(self): return {'cls_token1', 'cls_token2', 'cls_token3', 'cls_token4'} @torch.jit.ignore def set_grad_checkpointing(self, enable=True): assert not enable, 'gradient checkpointing not supported' @torch.jit.ignore def group_matcher(self, coarse=False): matcher = dict( stem1=r'^cls_token1|patch_embed1|crpe1|cpe1', serial_blocks1=r'^serial_blocks1\.(\d+)', stem2=r'^cls_token2|patch_embed2|crpe2|cpe2', serial_blocks2=r'^serial_blocks2\.(\d+)', stem3=r'^cls_token3|patch_embed3|crpe3|cpe3', serial_blocks3=r'^serial_blocks3\.(\d+)', stem4=r'^cls_token4|patch_embed4|crpe4|cpe4', serial_blocks4=r'^serial_blocks4\.(\d+)', parallel_blocks=[ # FIXME (partially?) overlap parallel w/ serial blocks?? (r'^parallel_blocks\.(\d+)', None), (r'^norm|aggregate', (99999,)), ] ) return matcher @torch.jit.ignore def get_classifier(self): return self.head def reset_classifier(self, num_classes, global_pool=None): self.num_classes = num_classes if global_pool is not None: assert global_pool in ('token', 'avg') self.global_pool = global_pool self.head = nn.Linear(self.num_features, num_classes) if num_classes > 0 else nn.Identity() def forward_features(self, x0): B = x0.shape[0] # Serial blocks 1. x1 = self.patch_embed1(x0) H1, W1 = self.patch_embed1.grid_size x1 = insert_cls(x1, self.cls_token1) for blk in self.serial_blocks1: x1 = blk(x1, size=(H1, W1)) x1_nocls = remove_cls(x1).reshape(B, H1, W1, -1).permute(0, 3, 1, 2).contiguous() # Serial blocks 2. x2 = self.patch_embed2(x1_nocls) H2, W2 = self.patch_embed2.grid_size x2 = insert_cls(x2, self.cls_token2) for blk in self.serial_blocks2: x2 = blk(x2, size=(H2, W2)) x2_nocls = remove_cls(x2).reshape(B, H2, W2, -1).permute(0, 3, 1, 2).contiguous() # Serial blocks 3. x3 = self.patch_embed3(x2_nocls) H3, W3 = self.patch_embed3.grid_size x3 = insert_cls(x3, self.cls_token3) for blk in self.serial_blocks3: x3 = blk(x3, size=(H3, W3)) x3_nocls = remove_cls(x3).reshape(B, H3, W3, -1).permute(0, 3, 1, 2).contiguous() # Serial blocks 4. x4 = self.patch_embed4(x3_nocls) H4, W4 = self.patch_embed4.grid_size x4 = insert_cls(x4, self.cls_token4) for blk in self.serial_blocks4: x4 = blk(x4, size=(H4, W4)) x4_nocls = remove_cls(x4).reshape(B, H4, W4, -1).permute(0, 3, 1, 2).contiguous() # Only serial blocks: Early return. if self.parallel_blocks is None: if not torch.jit.is_scripting() and self.return_interm_layers: # Return intermediate features for down-stream tasks (e.g. Deformable DETR and Detectron2). feat_out = {} if 'x1_nocls' in self.out_features: feat_out['x1_nocls'] = x1_nocls if 'x2_nocls' in self.out_features: feat_out['x2_nocls'] = x2_nocls if 'x3_nocls' in self.out_features: feat_out['x3_nocls'] = x3_nocls if 'x4_nocls' in self.out_features: feat_out['x4_nocls'] = x4_nocls return feat_out else: # Return features for classification. x4 = self.norm4(x4) return x4 # Parallel blocks. for blk in self.parallel_blocks: x2, x3, x4 = self.cpe2(x2, (H2, W2)), self.cpe3(x3, (H3, W3)), self.cpe4(x4, (H4, W4)) x1, x2, x3, x4 = blk(x1, x2, x3, x4, sizes=[(H1, W1), (H2, W2), (H3, W3), (H4, W4)]) if not torch.jit.is_scripting() and self.return_interm_layers: # Return intermediate features for down-stream tasks (e.g. Deformable DETR and Detectron2). feat_out = {} if 'x1_nocls' in self.out_features: x1_nocls = remove_cls(x1).reshape(B, H1, W1, -1).permute(0, 3, 1, 2).contiguous() feat_out['x1_nocls'] = x1_nocls if 'x2_nocls' in self.out_features: x2_nocls = remove_cls(x2).reshape(B, H2, W2, -1).permute(0, 3, 1, 2).contiguous() feat_out['x2_nocls'] = x2_nocls if 'x3_nocls' in self.out_features: x3_nocls = remove_cls(x3).reshape(B, H3, W3, -1).permute(0, 3, 1, 2).contiguous() feat_out['x3_nocls'] = x3_nocls if 'x4_nocls' in self.out_features: x4_nocls = remove_cls(x4).reshape(B, H4, W4, -1).permute(0, 3, 1, 2).contiguous() feat_out['x4_nocls'] = x4_nocls return feat_out else: x2 = self.norm2(x2) x3 = self.norm3(x3) x4 = self.norm4(x4) return [x2, x3, x4] def forward_head(self, x_feat: Union[torch.Tensor, List[torch.Tensor]], pre_logits: bool = False): if isinstance(x_feat, list): assert self.aggregate is not None if self.global_pool == 'avg': x = torch.cat([xl[:, 1:].mean(dim=1, keepdim=True) for xl in x_feat], dim=1) # [B, 3, C] else: x = torch.stack([xl[:, 0] for xl in x_feat], dim=1) # [B, 3, C] x = self.aggregate(x).squeeze(dim=1) # Shape: [B, C] else: x = x_feat[:, 1:].mean(dim=1) if self.global_pool == 'avg' else x_feat[:, 0] x = self.head_drop(x) return x if pre_logits else self.head(x) def forward(self, x) -> torch.Tensor: if not torch.jit.is_scripting() and self.return_interm_layers: # Return intermediate features (for down-stream tasks). return self.forward_features(x) else: # Return features for classification. x_feat = self.forward_features(x) x = self.forward_head(x_feat) return x def insert_cls(x, cls_token): """ Insert CLS token. """ cls_tokens = cls_token.expand(x.shape[0], -1, -1) x = torch.cat((cls_tokens, x), dim=1) return x def remove_cls(x): """ Remove CLS token. """ return x[:, 1:, :] def checkpoint_filter_fn(state_dict, model): out_dict = {} state_dict = state_dict.get('model', state_dict) for k, v in state_dict.items(): # original model had unused norm layers, removing them requires filtering pretrained checkpoints if k.startswith('norm1') or \ (k.startswith('norm2') and getattr(model, 'norm2', None) is None) or \ (k.startswith('norm3') and getattr(model, 'norm3', None) is None) or \ (k.startswith('norm4') and getattr(model, 'norm4', None) is None) or \ (k.startswith('aggregate') and getattr(model, 'aggregate', None) is None) or \ (k.startswith('head') and getattr(model, 'head', None) is None): continue out_dict[k] = v return out_dict def _create_coat(variant, pretrained=False, default_cfg=None, **kwargs): if kwargs.get('features_only', None): raise RuntimeError('features_only not implemented for Vision Transformer models.') model = build_model_with_cfg( CoaT, variant, pretrained, pretrained_filter_fn=checkpoint_filter_fn, **kwargs, ) return model def _cfg_coat(url='', **kwargs): return { 'url': url, 'num_classes': 1000, 'input_size': (3, 224, 224), 'pool_size': None, 'crop_pct': .9, 'interpolation': 'bicubic', 'fixed_input_size': True, 'mean': IMAGENET_DEFAULT_MEAN, 'std': IMAGENET_DEFAULT_STD, 'first_conv': 'patch_embed1.proj', 'classifier': 'head', **kwargs } default_cfgs = generate_default_cfgs({ 'coat_tiny.in1k': _cfg_coat(hf_hub_id='timm/'), 'coat_mini.in1k': _cfg_coat(hf_hub_id='timm/'), 'coat_small.in1k': _cfg_coat(hf_hub_id='timm/'), 'coat_lite_tiny.in1k': _cfg_coat(hf_hub_id='timm/'), 'coat_lite_mini.in1k': _cfg_coat(hf_hub_id='timm/'), 'coat_lite_small.in1k': _cfg_coat(hf_hub_id='timm/'), 'coat_lite_medium.in1k': _cfg_coat(hf_hub_id='timm/'), 'coat_lite_medium_384.in1k': _cfg_coat( hf_hub_id='timm/', input_size=(3, 384, 384), crop_pct=1.0, crop_mode='squash', ), }) @register_model def coat_tiny(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( patch_size=4, embed_dims=[152, 152, 152, 152], serial_depths=[2, 2, 2, 2], parallel_depth=6) model = _create_coat('coat_tiny', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def coat_mini(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( patch_size=4, embed_dims=[152, 216, 216, 216], serial_depths=[2, 2, 2, 2], parallel_depth=6) model = _create_coat('coat_mini', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def coat_small(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( patch_size=4, embed_dims=[152, 320, 320, 320], serial_depths=[2, 2, 2, 2], parallel_depth=6, **kwargs) model = _create_coat('coat_small', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def coat_lite_tiny(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( patch_size=4, embed_dims=[64, 128, 256, 320], serial_depths=[2, 2, 2, 2], mlp_ratios=[8, 8, 4, 4]) model = _create_coat('coat_lite_tiny', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def coat_lite_mini(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( patch_size=4, embed_dims=[64, 128, 320, 512], serial_depths=[2, 2, 2, 2], mlp_ratios=[8, 8, 4, 4]) model = _create_coat('coat_lite_mini', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def coat_lite_small(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( patch_size=4, embed_dims=[64, 128, 320, 512], serial_depths=[3, 4, 6, 3], mlp_ratios=[8, 8, 4, 4]) model = _create_coat('coat_lite_small', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def coat_lite_medium(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( patch_size=4, embed_dims=[128, 256, 320, 512], serial_depths=[3, 6, 10, 8]) model = _create_coat('coat_lite_medium', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def coat_lite_medium_384(pretrained=False, **kwargs) -> CoaT: model_cfg = dict( img_size=384, patch_size=4, embed_dims=[128, 256, 320, 512], serial_depths=[3, 6, 10, 8]) model = _create_coat('coat_lite_medium_384', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model
pytorch-image-models/timm/models/coat.py/0
{ "file_path": "pytorch-image-models/timm/models/coat.py", "repo_id": "pytorch-image-models", "token_count": 15685 }
182
""" EfficientViT (by MSRA) Paper: `EfficientViT: Memory Efficient Vision Transformer with Cascaded Group Attention` - https://arxiv.org/abs/2305.07027 Adapted from official impl at https://github.com/microsoft/Cream/tree/main/EfficientViT """ __all__ = ['EfficientVitMsra'] import itertools from collections import OrderedDict from typing import Dict import torch import torch.nn as nn from timm.data import IMAGENET_DEFAULT_MEAN, IMAGENET_DEFAULT_STD from timm.layers import SqueezeExcite, SelectAdaptivePool2d, trunc_normal_, _assert from ._builder import build_model_with_cfg from ._manipulate import checkpoint_seq from ._registry import register_model, generate_default_cfgs class ConvNorm(torch.nn.Sequential): def __init__(self, in_chs, out_chs, ks=1, stride=1, pad=0, dilation=1, groups=1, bn_weight_init=1): super().__init__() self.conv = nn.Conv2d(in_chs, out_chs, ks, stride, pad, dilation, groups, bias=False) self.bn = nn.BatchNorm2d(out_chs) torch.nn.init.constant_(self.bn.weight, bn_weight_init) torch.nn.init.constant_(self.bn.bias, 0) @torch.no_grad() def fuse(self): c, bn = self.conv, self.bn w = bn.weight / (bn.running_var + bn.eps)**0.5 w = c.weight * w[:, None, None, None] b = bn.bias - bn.running_mean * bn.weight / \ (bn.running_var + bn.eps)**0.5 m = torch.nn.Conv2d( w.size(1) * self.conv.groups, w.size(0), w.shape[2:], stride=self.conv.stride, padding=self.conv.padding, dilation=self.conv.dilation, groups=self.conv.groups) m.weight.data.copy_(w) m.bias.data.copy_(b) return m class NormLinear(torch.nn.Sequential): def __init__(self, in_features, out_features, bias=True, std=0.02, drop=0.): super().__init__() self.bn = nn.BatchNorm1d(in_features) self.drop = nn.Dropout(drop) self.linear = nn.Linear(in_features, out_features, bias=bias) trunc_normal_(self.linear.weight, std=std) if self.linear.bias is not None: nn.init.constant_(self.linear.bias, 0) @torch.no_grad() def fuse(self): bn, linear = self.bn, self.linear w = bn.weight / (bn.running_var + bn.eps)**0.5 b = bn.bias - self.bn.running_mean * \ self.bn.weight / (bn.running_var + bn.eps)**0.5 w = linear.weight * w[None, :] if linear.bias is None: b = b @ self.linear.weight.T else: b = (linear.weight @ b[:, None]).view(-1) + self.linear.bias m = torch.nn.Linear(w.size(1), w.size(0)) m.weight.data.copy_(w) m.bias.data.copy_(b) return m class PatchMerging(torch.nn.Module): def __init__(self, dim, out_dim): super().__init__() hid_dim = int(dim * 4) self.conv1 = ConvNorm(dim, hid_dim, 1, 1, 0) self.act = torch.nn.ReLU() self.conv2 = ConvNorm(hid_dim, hid_dim, 3, 2, 1, groups=hid_dim) self.se = SqueezeExcite(hid_dim, .25) self.conv3 = ConvNorm(hid_dim, out_dim, 1, 1, 0) def forward(self, x): x = self.conv3(self.se(self.act(self.conv2(self.act(self.conv1(x)))))) return x class ResidualDrop(torch.nn.Module): def __init__(self, m, drop=0.): super().__init__() self.m = m self.drop = drop def forward(self, x): if self.training and self.drop > 0: return x + self.m(x) * torch.rand( x.size(0), 1, 1, 1, device=x.device).ge_(self.drop).div(1 - self.drop).detach() else: return x + self.m(x) class ConvMlp(torch.nn.Module): def __init__(self, ed, h): super().__init__() self.pw1 = ConvNorm(ed, h) self.act = torch.nn.ReLU() self.pw2 = ConvNorm(h, ed, bn_weight_init=0) def forward(self, x): x = self.pw2(self.act(self.pw1(x))) return x class CascadedGroupAttention(torch.nn.Module): attention_bias_cache: Dict[str, torch.Tensor] r""" Cascaded Group Attention. Args: dim (int): Number of input channels. key_dim (int): The dimension for query and key. num_heads (int): Number of attention heads. attn_ratio (int): Multiplier for the query dim for value dimension. resolution (int): Input resolution, correspond to the window size. kernels (List[int]): The kernel size of the dw conv on query. """ def __init__( self, dim, key_dim, num_heads=8, attn_ratio=4, resolution=14, kernels=(5, 5, 5, 5), ): super().__init__() self.num_heads = num_heads self.scale = key_dim ** -0.5 self.key_dim = key_dim self.val_dim = int(attn_ratio * key_dim) self.attn_ratio = attn_ratio qkvs = [] dws = [] for i in range(num_heads): qkvs.append(ConvNorm(dim // (num_heads), self.key_dim * 2 + self.val_dim)) dws.append(ConvNorm(self.key_dim, self.key_dim, kernels[i], 1, kernels[i] // 2, groups=self.key_dim)) self.qkvs = torch.nn.ModuleList(qkvs) self.dws = torch.nn.ModuleList(dws) self.proj = torch.nn.Sequential( torch.nn.ReLU(), ConvNorm(self.val_dim * num_heads, dim, bn_weight_init=0) ) points = list(itertools.product(range(resolution), range(resolution))) N = len(points) attention_offsets = {} idxs = [] for p1 in points: for p2 in points: offset = (abs(p1[0] - p2[0]), abs(p1[1] - p2[1])) if offset not in attention_offsets: attention_offsets[offset] = len(attention_offsets) idxs.append(attention_offsets[offset]) self.attention_biases = torch.nn.Parameter(torch.zeros(num_heads, len(attention_offsets))) self.register_buffer('attention_bias_idxs', torch.LongTensor(idxs).view(N, N), persistent=False) self.attention_bias_cache = {} @torch.no_grad() def train(self, mode=True): super().train(mode) if mode and self.attention_bias_cache: self.attention_bias_cache = {} # clear ab cache def get_attention_biases(self, device: torch.device) -> torch.Tensor: if torch.jit.is_tracing() or self.training: return self.attention_biases[:, self.attention_bias_idxs] else: device_key = str(device) if device_key not in self.attention_bias_cache: self.attention_bias_cache[device_key] = self.attention_biases[:, self.attention_bias_idxs] return self.attention_bias_cache[device_key] def forward(self, x): B, C, H, W = x.shape feats_in = x.chunk(len(self.qkvs), dim=1) feats_out = [] feat = feats_in[0] attn_bias = self.get_attention_biases(x.device) for head_idx, (qkv, dws) in enumerate(zip(self.qkvs, self.dws)): if head_idx > 0: feat = feat + feats_in[head_idx] feat = qkv(feat) q, k, v = feat.view(B, -1, H, W).split([self.key_dim, self.key_dim, self.val_dim], dim=1) q = dws(q) q, k, v = q.flatten(2), k.flatten(2), v.flatten(2) q = q * self.scale attn = q.transpose(-2, -1) @ k attn = attn + attn_bias[head_idx] attn = attn.softmax(dim=-1) feat = v @ attn.transpose(-2, -1) feat = feat.view(B, self.val_dim, H, W) feats_out.append(feat) x = self.proj(torch.cat(feats_out, 1)) return x class LocalWindowAttention(torch.nn.Module): r""" Local Window Attention. Args: dim (int): Number of input channels. key_dim (int): The dimension for query and key. num_heads (int): Number of attention heads. attn_ratio (int): Multiplier for the query dim for value dimension. resolution (int): Input resolution. window_resolution (int): Local window resolution. kernels (List[int]): The kernel size of the dw conv on query. """ def __init__( self, dim, key_dim, num_heads=8, attn_ratio=4, resolution=14, window_resolution=7, kernels=(5, 5, 5, 5), ): super().__init__() self.dim = dim self.num_heads = num_heads self.resolution = resolution assert window_resolution > 0, 'window_size must be greater than 0' self.window_resolution = window_resolution window_resolution = min(window_resolution, resolution) self.attn = CascadedGroupAttention( dim, key_dim, num_heads, attn_ratio=attn_ratio, resolution=window_resolution, kernels=kernels, ) def forward(self, x): H = W = self.resolution B, C, H_, W_ = x.shape # Only check this for classifcation models _assert(H == H_, f'input feature has wrong size, expect {(H, W)}, got {(H_, W_)}') _assert(W == W_, f'input feature has wrong size, expect {(H, W)}, got {(H_, W_)}') if H <= self.window_resolution and W <= self.window_resolution: x = self.attn(x) else: x = x.permute(0, 2, 3, 1) pad_b = (self.window_resolution - H % self.window_resolution) % self.window_resolution pad_r = (self.window_resolution - W % self.window_resolution) % self.window_resolution x = torch.nn.functional.pad(x, (0, 0, 0, pad_r, 0, pad_b)) pH, pW = H + pad_b, W + pad_r nH = pH // self.window_resolution nW = pW // self.window_resolution # window partition, BHWC -> B(nHh)(nWw)C -> BnHnWhwC -> (BnHnW)hwC -> (BnHnW)Chw x = x.view(B, nH, self.window_resolution, nW, self.window_resolution, C).transpose(2, 3) x = x.reshape(B * nH * nW, self.window_resolution, self.window_resolution, C).permute(0, 3, 1, 2) x = self.attn(x) # window reverse, (BnHnW)Chw -> (BnHnW)hwC -> BnHnWhwC -> B(nHh)(nWw)C -> BHWC x = x.permute(0, 2, 3, 1).view(B, nH, nW, self.window_resolution, self.window_resolution, C) x = x.transpose(2, 3).reshape(B, pH, pW, C) x = x[:, :H, :W].contiguous() x = x.permute(0, 3, 1, 2) return x class EfficientVitBlock(torch.nn.Module): """ A basic EfficientVit building block. Args: dim (int): Number of input channels. key_dim (int): Dimension for query and key in the token mixer. num_heads (int): Number of attention heads. attn_ratio (int): Multiplier for the query dim for value dimension. resolution (int): Input resolution. window_resolution (int): Local window resolution. kernels (List[int]): The kernel size of the dw conv on query. """ def __init__( self, dim, key_dim, num_heads=8, attn_ratio=4, resolution=14, window_resolution=7, kernels=[5, 5, 5, 5], ): super().__init__() self.dw0 = ResidualDrop(ConvNorm(dim, dim, 3, 1, 1, groups=dim, bn_weight_init=0.)) self.ffn0 = ResidualDrop(ConvMlp(dim, int(dim * 2))) self.mixer = ResidualDrop( LocalWindowAttention( dim, key_dim, num_heads, attn_ratio=attn_ratio, resolution=resolution, window_resolution=window_resolution, kernels=kernels, ) ) self.dw1 = ResidualDrop(ConvNorm(dim, dim, 3, 1, 1, groups=dim, bn_weight_init=0.)) self.ffn1 = ResidualDrop(ConvMlp(dim, int(dim * 2))) def forward(self, x): return self.ffn1(self.dw1(self.mixer(self.ffn0(self.dw0(x))))) class EfficientVitStage(torch.nn.Module): def __init__( self, in_dim, out_dim, key_dim, downsample=('', 1), num_heads=8, attn_ratio=4, resolution=14, window_resolution=7, kernels=[5, 5, 5, 5], depth=1, ): super().__init__() if downsample[0] == 'subsample': self.resolution = (resolution - 1) // downsample[1] + 1 down_blocks = [] down_blocks.append(( 'res1', torch.nn.Sequential( ResidualDrop(ConvNorm(in_dim, in_dim, 3, 1, 1, groups=in_dim)), ResidualDrop(ConvMlp(in_dim, int(in_dim * 2))), ) )) down_blocks.append(('patchmerge', PatchMerging(in_dim, out_dim))) down_blocks.append(( 'res2', torch.nn.Sequential( ResidualDrop(ConvNorm(out_dim, out_dim, 3, 1, 1, groups=out_dim)), ResidualDrop(ConvMlp(out_dim, int(out_dim * 2))), ) )) self.downsample = nn.Sequential(OrderedDict(down_blocks)) else: assert in_dim == out_dim self.downsample = nn.Identity() self.resolution = resolution blocks = [] for d in range(depth): blocks.append(EfficientVitBlock(out_dim, key_dim, num_heads, attn_ratio, self.resolution, window_resolution, kernels)) self.blocks = nn.Sequential(*blocks) def forward(self, x): x = self.downsample(x) x = self.blocks(x) return x class PatchEmbedding(torch.nn.Sequential): def __init__(self, in_chans, dim): super().__init__() self.add_module('conv1', ConvNorm(in_chans, dim // 8, 3, 2, 1)) self.add_module('relu1', torch.nn.ReLU()) self.add_module('conv2', ConvNorm(dim // 8, dim // 4, 3, 2, 1)) self.add_module('relu2', torch.nn.ReLU()) self.add_module('conv3', ConvNorm(dim // 4, dim // 2, 3, 2, 1)) self.add_module('relu3', torch.nn.ReLU()) self.add_module('conv4', ConvNorm(dim // 2, dim, 3, 2, 1)) self.patch_size = 16 class EfficientVitMsra(nn.Module): def __init__( self, img_size=224, in_chans=3, num_classes=1000, embed_dim=(64, 128, 192), key_dim=(16, 16, 16), depth=(1, 2, 3), num_heads=(4, 4, 4), window_size=(7, 7, 7), kernels=(5, 5, 5, 5), down_ops=(('', 1), ('subsample', 2), ('subsample', 2)), global_pool='avg', drop_rate=0., ): super(EfficientVitMsra, self).__init__() self.grad_checkpointing = False self.num_classes = num_classes self.drop_rate = drop_rate # Patch embedding self.patch_embed = PatchEmbedding(in_chans, embed_dim[0]) stride = self.patch_embed.patch_size resolution = img_size // self.patch_embed.patch_size attn_ratio = [embed_dim[i] / (key_dim[i] * num_heads[i]) for i in range(len(embed_dim))] # Build EfficientVit blocks self.feature_info = [] stages = [] pre_ed = embed_dim[0] for i, (ed, kd, dpth, nh, ar, wd, do) in enumerate( zip(embed_dim, key_dim, depth, num_heads, attn_ratio, window_size, down_ops)): stage = EfficientVitStage( in_dim=pre_ed, out_dim=ed, key_dim=kd, downsample=do, num_heads=nh, attn_ratio=ar, resolution=resolution, window_resolution=wd, kernels=kernels, depth=dpth, ) pre_ed = ed if do[0] == 'subsample' and i != 0: stride *= do[1] resolution = stage.resolution stages.append(stage) self.feature_info += [dict(num_chs=ed, reduction=stride, module=f'stages.{i}')] self.stages = nn.Sequential(*stages) if global_pool == 'avg': self.global_pool = SelectAdaptivePool2d(pool_type=global_pool, flatten=True) else: assert num_classes == 0 self.global_pool = nn.Identity() self.num_features = embed_dim[-1] self.head = NormLinear( self.num_features, num_classes, drop=self.drop_rate) if num_classes > 0 else torch.nn.Identity() @torch.jit.ignore def no_weight_decay(self): return {x for x in self.state_dict().keys() if 'attention_biases' in x} @torch.jit.ignore def group_matcher(self, coarse=False): matcher = dict( stem=r'^patch_embed', blocks=r'^stages\.(\d+)' if coarse else [ (r'^stages\.(\d+).downsample', (0,)), (r'^stages\.(\d+)\.\w+\.(\d+)', None), ] ) return matcher @torch.jit.ignore def set_grad_checkpointing(self, enable=True): self.grad_checkpointing = enable @torch.jit.ignore def get_classifier(self): return self.head.linear def reset_classifier(self, num_classes, global_pool=None): self.num_classes = num_classes if global_pool is not None: if global_pool == 'avg': self.global_pool = SelectAdaptivePool2d(pool_type=global_pool, flatten=True) else: assert num_classes == 0 self.global_pool = nn.Identity() self.head = NormLinear( self.num_features, num_classes, drop=self.drop_rate) if num_classes > 0 else torch.nn.Identity() def forward_features(self, x): x = self.patch_embed(x) if self.grad_checkpointing and not torch.jit.is_scripting(): x = checkpoint_seq(self.stages, x) else: x = self.stages(x) return x def forward_head(self, x, pre_logits: bool = False): x = self.global_pool(x) return x if pre_logits else self.head(x) def forward(self, x): x = self.forward_features(x) x = self.forward_head(x) return x # def checkpoint_filter_fn(state_dict, model): # if 'model' in state_dict.keys(): # state_dict = state_dict['model'] # tmp_dict = {} # out_dict = {} # target_keys = model.state_dict().keys() # target_keys = [k for k in target_keys if k.startswith('stages.')] # # for k, v in state_dict.items(): # if 'attention_bias_idxs' in k: # continue # k = k.split('.') # if k[-2] == 'c': # k[-2] = 'conv' # if k[-2] == 'l': # k[-2] = 'linear' # k = '.'.join(k) # tmp_dict[k] = v # # for k, v in tmp_dict.items(): # if k.startswith('patch_embed'): # k = k.split('.') # k[1] = 'conv' + str(int(k[1]) // 2 + 1) # k = '.'.join(k) # elif k.startswith('blocks'): # kw = '.'.join(k.split('.')[2:]) # find_kw = [a for a in list(sorted(tmp_dict.keys())) if kw in a] # idx = find_kw.index(k) # k = [a for a in target_keys if kw in a][idx] # out_dict[k] = v # # return out_dict def _cfg(url='', **kwargs): return { 'url': url, 'num_classes': 1000, 'mean': IMAGENET_DEFAULT_MEAN, 'std': IMAGENET_DEFAULT_STD, 'first_conv': 'patch_embed.conv1.conv', 'classifier': 'head.linear', 'fixed_input_size': True, 'pool_size': (4, 4), **kwargs, } default_cfgs = generate_default_cfgs({ 'efficientvit_m0.r224_in1k': _cfg( hf_hub_id='timm/', #url='https://github.com/xinyuliu-jeffrey/EfficientVit_Model_Zoo/releases/download/v1.0/efficientvit_m0.pth' ), 'efficientvit_m1.r224_in1k': _cfg( hf_hub_id='timm/', #url='https://github.com/xinyuliu-jeffrey/EfficientVit_Model_Zoo/releases/download/v1.0/efficientvit_m1.pth' ), 'efficientvit_m2.r224_in1k': _cfg( hf_hub_id='timm/', #url='https://github.com/xinyuliu-jeffrey/EfficientVit_Model_Zoo/releases/download/v1.0/efficientvit_m2.pth' ), 'efficientvit_m3.r224_in1k': _cfg( hf_hub_id='timm/', #url='https://github.com/xinyuliu-jeffrey/EfficientVit_Model_Zoo/releases/download/v1.0/efficientvit_m3.pth' ), 'efficientvit_m4.r224_in1k': _cfg( hf_hub_id='timm/', #url='https://github.com/xinyuliu-jeffrey/EfficientVit_Model_Zoo/releases/download/v1.0/efficientvit_m4.pth' ), 'efficientvit_m5.r224_in1k': _cfg( hf_hub_id='timm/', #url='https://github.com/xinyuliu-jeffrey/EfficientVit_Model_Zoo/releases/download/v1.0/efficientvit_m5.pth' ), }) def _create_efficientvit_msra(variant, pretrained=False, **kwargs): out_indices = kwargs.pop('out_indices', (0, 1, 2)) model = build_model_with_cfg( EfficientVitMsra, variant, pretrained, feature_cfg=dict(flatten_sequential=True, out_indices=out_indices), **kwargs ) return model @register_model def efficientvit_m0(pretrained=False, **kwargs): model_args = dict( img_size=224, embed_dim=[64, 128, 192], depth=[1, 2, 3], num_heads=[4, 4, 4], window_size=[7, 7, 7], kernels=[5, 5, 5, 5] ) return _create_efficientvit_msra('efficientvit_m0', pretrained=pretrained, **dict(model_args, **kwargs)) @register_model def efficientvit_m1(pretrained=False, **kwargs): model_args = dict( img_size=224, embed_dim=[128, 144, 192], depth=[1, 2, 3], num_heads=[2, 3, 3], window_size=[7, 7, 7], kernels=[7, 5, 3, 3] ) return _create_efficientvit_msra('efficientvit_m1', pretrained=pretrained, **dict(model_args, **kwargs)) @register_model def efficientvit_m2(pretrained=False, **kwargs): model_args = dict( img_size=224, embed_dim=[128, 192, 224], depth=[1, 2, 3], num_heads=[4, 3, 2], window_size=[7, 7, 7], kernels=[7, 5, 3, 3] ) return _create_efficientvit_msra('efficientvit_m2', pretrained=pretrained, **dict(model_args, **kwargs)) @register_model def efficientvit_m3(pretrained=False, **kwargs): model_args = dict( img_size=224, embed_dim=[128, 240, 320], depth=[1, 2, 3], num_heads=[4, 3, 4], window_size=[7, 7, 7], kernels=[5, 5, 5, 5] ) return _create_efficientvit_msra('efficientvit_m3', pretrained=pretrained, **dict(model_args, **kwargs)) @register_model def efficientvit_m4(pretrained=False, **kwargs): model_args = dict( img_size=224, embed_dim=[128, 256, 384], depth=[1, 2, 3], num_heads=[4, 4, 4], window_size=[7, 7, 7], kernels=[7, 5, 3, 3] ) return _create_efficientvit_msra('efficientvit_m4', pretrained=pretrained, **dict(model_args, **kwargs)) @register_model def efficientvit_m5(pretrained=False, **kwargs): model_args = dict( img_size=224, embed_dim=[192, 288, 384], depth=[1, 3, 4], num_heads=[3, 3, 4], window_size=[7, 7, 7], kernels=[7, 5, 3, 3] ) return _create_efficientvit_msra('efficientvit_m5', pretrained=pretrained, **dict(model_args, **kwargs))
pytorch-image-models/timm/models/efficientvit_msra.py/0
{ "file_path": "pytorch-image-models/timm/models/efficientvit_msra.py", "repo_id": "pytorch-image-models", "token_count": 11871 }
183
""" Pytorch Inception-V4 implementation Sourced from https://github.com/Cadene/tensorflow-model-zoo.torch (MIT License) which is based upon Google's Tensorflow implementation and pretrained weights (Apache 2.0 License) """ from functools import partial import torch import torch.nn as nn from timm.data import IMAGENET_INCEPTION_MEAN, IMAGENET_INCEPTION_STD from timm.layers import create_classifier, ConvNormAct from ._builder import build_model_with_cfg from ._registry import register_model, generate_default_cfgs __all__ = ['InceptionV4'] class Mixed3a(nn.Module): def __init__(self, conv_block=ConvNormAct): super(Mixed3a, self).__init__() self.maxpool = nn.MaxPool2d(3, stride=2) self.conv = conv_block(64, 96, kernel_size=3, stride=2) def forward(self, x): x0 = self.maxpool(x) x1 = self.conv(x) out = torch.cat((x0, x1), 1) return out class Mixed4a(nn.Module): def __init__(self, conv_block=ConvNormAct): super(Mixed4a, self).__init__() self.branch0 = nn.Sequential( conv_block(160, 64, kernel_size=1, stride=1), conv_block(64, 96, kernel_size=3, stride=1) ) self.branch1 = nn.Sequential( conv_block(160, 64, kernel_size=1, stride=1), conv_block(64, 64, kernel_size=(1, 7), stride=1, padding=(0, 3)), conv_block(64, 64, kernel_size=(7, 1), stride=1, padding=(3, 0)), conv_block(64, 96, kernel_size=(3, 3), stride=1) ) def forward(self, x): x0 = self.branch0(x) x1 = self.branch1(x) out = torch.cat((x0, x1), 1) return out class Mixed5a(nn.Module): def __init__(self, conv_block=ConvNormAct): super(Mixed5a, self).__init__() self.conv = conv_block(192, 192, kernel_size=3, stride=2) self.maxpool = nn.MaxPool2d(3, stride=2) def forward(self, x): x0 = self.conv(x) x1 = self.maxpool(x) out = torch.cat((x0, x1), 1) return out class InceptionA(nn.Module): def __init__(self, conv_block=ConvNormAct): super(InceptionA, self).__init__() self.branch0 = conv_block(384, 96, kernel_size=1, stride=1) self.branch1 = nn.Sequential( conv_block(384, 64, kernel_size=1, stride=1), conv_block(64, 96, kernel_size=3, stride=1, padding=1) ) self.branch2 = nn.Sequential( conv_block(384, 64, kernel_size=1, stride=1), conv_block(64, 96, kernel_size=3, stride=1, padding=1), conv_block(96, 96, kernel_size=3, stride=1, padding=1) ) self.branch3 = nn.Sequential( nn.AvgPool2d(3, stride=1, padding=1, count_include_pad=False), conv_block(384, 96, kernel_size=1, stride=1) ) def forward(self, x): x0 = self.branch0(x) x1 = self.branch1(x) x2 = self.branch2(x) x3 = self.branch3(x) out = torch.cat((x0, x1, x2, x3), 1) return out class ReductionA(nn.Module): def __init__(self, conv_block=ConvNormAct): super(ReductionA, self).__init__() self.branch0 = conv_block(384, 384, kernel_size=3, stride=2) self.branch1 = nn.Sequential( conv_block(384, 192, kernel_size=1, stride=1), conv_block(192, 224, kernel_size=3, stride=1, padding=1), conv_block(224, 256, kernel_size=3, stride=2) ) self.branch2 = nn.MaxPool2d(3, stride=2) def forward(self, x): x0 = self.branch0(x) x1 = self.branch1(x) x2 = self.branch2(x) out = torch.cat((x0, x1, x2), 1) return out class InceptionB(nn.Module): def __init__(self, conv_block=ConvNormAct): super(InceptionB, self).__init__() self.branch0 = conv_block(1024, 384, kernel_size=1, stride=1) self.branch1 = nn.Sequential( conv_block(1024, 192, kernel_size=1, stride=1), conv_block(192, 224, kernel_size=(1, 7), stride=1, padding=(0, 3)), conv_block(224, 256, kernel_size=(7, 1), stride=1, padding=(3, 0)) ) self.branch2 = nn.Sequential( conv_block(1024, 192, kernel_size=1, stride=1), conv_block(192, 192, kernel_size=(7, 1), stride=1, padding=(3, 0)), conv_block(192, 224, kernel_size=(1, 7), stride=1, padding=(0, 3)), conv_block(224, 224, kernel_size=(7, 1), stride=1, padding=(3, 0)), conv_block(224, 256, kernel_size=(1, 7), stride=1, padding=(0, 3)) ) self.branch3 = nn.Sequential( nn.AvgPool2d(3, stride=1, padding=1, count_include_pad=False), conv_block(1024, 128, kernel_size=1, stride=1) ) def forward(self, x): x0 = self.branch0(x) x1 = self.branch1(x) x2 = self.branch2(x) x3 = self.branch3(x) out = torch.cat((x0, x1, x2, x3), 1) return out class ReductionB(nn.Module): def __init__(self, conv_block=ConvNormAct): super(ReductionB, self).__init__() self.branch0 = nn.Sequential( conv_block(1024, 192, kernel_size=1, stride=1), conv_block(192, 192, kernel_size=3, stride=2) ) self.branch1 = nn.Sequential( conv_block(1024, 256, kernel_size=1, stride=1), conv_block(256, 256, kernel_size=(1, 7), stride=1, padding=(0, 3)), conv_block(256, 320, kernel_size=(7, 1), stride=1, padding=(3, 0)), conv_block(320, 320, kernel_size=3, stride=2) ) self.branch2 = nn.MaxPool2d(3, stride=2) def forward(self, x): x0 = self.branch0(x) x1 = self.branch1(x) x2 = self.branch2(x) out = torch.cat((x0, x1, x2), 1) return out class InceptionC(nn.Module): def __init__(self, conv_block=ConvNormAct): super(InceptionC, self).__init__() self.branch0 = conv_block(1536, 256, kernel_size=1, stride=1) self.branch1_0 = conv_block(1536, 384, kernel_size=1, stride=1) self.branch1_1a = conv_block(384, 256, kernel_size=(1, 3), stride=1, padding=(0, 1)) self.branch1_1b = conv_block(384, 256, kernel_size=(3, 1), stride=1, padding=(1, 0)) self.branch2_0 = conv_block(1536, 384, kernel_size=1, stride=1) self.branch2_1 = conv_block(384, 448, kernel_size=(3, 1), stride=1, padding=(1, 0)) self.branch2_2 = conv_block(448, 512, kernel_size=(1, 3), stride=1, padding=(0, 1)) self.branch2_3a = conv_block(512, 256, kernel_size=(1, 3), stride=1, padding=(0, 1)) self.branch2_3b = conv_block(512, 256, kernel_size=(3, 1), stride=1, padding=(1, 0)) self.branch3 = nn.Sequential( nn.AvgPool2d(3, stride=1, padding=1, count_include_pad=False), conv_block(1536, 256, kernel_size=1, stride=1) ) def forward(self, x): x0 = self.branch0(x) x1_0 = self.branch1_0(x) x1_1a = self.branch1_1a(x1_0) x1_1b = self.branch1_1b(x1_0) x1 = torch.cat((x1_1a, x1_1b), 1) x2_0 = self.branch2_0(x) x2_1 = self.branch2_1(x2_0) x2_2 = self.branch2_2(x2_1) x2_3a = self.branch2_3a(x2_2) x2_3b = self.branch2_3b(x2_2) x2 = torch.cat((x2_3a, x2_3b), 1) x3 = self.branch3(x) out = torch.cat((x0, x1, x2, x3), 1) return out class InceptionV4(nn.Module): def __init__( self, num_classes=1000, in_chans=3, output_stride=32, drop_rate=0., global_pool='avg', norm_layer='batchnorm2d', norm_eps=1e-3, act_layer='relu', ): super(InceptionV4, self).__init__() assert output_stride == 32 self.num_classes = num_classes self.num_features = 1536 conv_block = partial( ConvNormAct, padding=0, norm_layer=norm_layer, act_layer=act_layer, norm_kwargs=dict(eps=norm_eps), act_kwargs=dict(inplace=True), ) features = [ conv_block(in_chans, 32, kernel_size=3, stride=2), conv_block(32, 32, kernel_size=3, stride=1), conv_block(32, 64, kernel_size=3, stride=1, padding=1), Mixed3a(conv_block), Mixed4a(conv_block), Mixed5a(conv_block), ] features += [InceptionA(conv_block) for _ in range(4)] features += [ReductionA(conv_block)] # Mixed6a features += [InceptionB(conv_block) for _ in range(7)] features += [ReductionB(conv_block)] # Mixed7a features += [InceptionC(conv_block) for _ in range(3)] self.features = nn.Sequential(*features) self.feature_info = [ dict(num_chs=64, reduction=2, module='features.2'), dict(num_chs=160, reduction=4, module='features.3'), dict(num_chs=384, reduction=8, module='features.9'), dict(num_chs=1024, reduction=16, module='features.17'), dict(num_chs=1536, reduction=32, module='features.21'), ] self.global_pool, self.head_drop, self.last_linear = create_classifier( self.num_features, self.num_classes, pool_type=global_pool, drop_rate=drop_rate) @torch.jit.ignore def group_matcher(self, coarse=False): return dict( stem=r'^features\.[012]\.', blocks=r'^features\.(\d+)' ) @torch.jit.ignore def set_grad_checkpointing(self, enable=True): assert not enable, 'gradient checkpointing not supported' @torch.jit.ignore def get_classifier(self): return self.last_linear def reset_classifier(self, num_classes, global_pool='avg'): self.num_classes = num_classes self.global_pool, self.last_linear = create_classifier( self.num_features, self.num_classes, pool_type=global_pool) def forward_features(self, x): return self.features(x) def forward_head(self, x, pre_logits: bool = False): x = self.global_pool(x) x = self.head_drop(x) return x if pre_logits else self.last_linear(x) def forward(self, x): x = self.forward_features(x) x = self.forward_head(x) return x def _create_inception_v4(variant, pretrained=False, **kwargs) -> InceptionV4: return build_model_with_cfg( InceptionV4, variant, pretrained, feature_cfg=dict(flatten_sequential=True), **kwargs, ) default_cfgs = generate_default_cfgs({ 'inception_v4.tf_in1k': { 'hf_hub_id': 'timm/', 'num_classes': 1000, 'input_size': (3, 299, 299), 'pool_size': (8, 8), 'crop_pct': 0.875, 'interpolation': 'bicubic', 'mean': IMAGENET_INCEPTION_MEAN, 'std': IMAGENET_INCEPTION_STD, 'first_conv': 'features.0.conv', 'classifier': 'last_linear', } }) @register_model def inception_v4(pretrained=False, **kwargs): return _create_inception_v4('inception_v4', pretrained, **kwargs)
pytorch-image-models/timm/models/inception_v4.py/0
{ "file_path": "pytorch-image-models/timm/models/inception_v4.py", "repo_id": "pytorch-image-models", "token_count": 5528 }
184
"""RegNet X, Y, Z, and more Paper: `Designing Network Design Spaces` - https://arxiv.org/abs/2003.13678 Original Impl: https://github.com/facebookresearch/pycls/blob/master/pycls/models/regnet.py Paper: `Fast and Accurate Model Scaling` - https://arxiv.org/abs/2103.06877 Original Impl: None Based on original PyTorch impl linked above, but re-wrote to use my own blocks (adapted from ResNet here) and cleaned up with more descriptive variable names. Weights from original pycls impl have been modified: * first layer from BGR -> RGB as most PyTorch models are * removed training specific dict entries from checkpoints and keep model state_dict only * remap names to match the ones here Supports weight loading from torchvision and classy-vision (incl VISSL SEER) A number of custom timm model definitions additions including: * stochastic depth, gradient checkpointing, layer-decay, configurable dilation * a pre-activation 'V' variant * only known RegNet-Z model definitions with pretrained weights Hacked together by / Copyright 2020 Ross Wightman """ import math from dataclasses import dataclass, replace from functools import partial from typing import Optional, Union, Callable import numpy as np import torch import torch.nn as nn from timm.data import IMAGENET_DEFAULT_MEAN, IMAGENET_DEFAULT_STD from timm.layers import ClassifierHead, AvgPool2dSame, ConvNormAct, SEModule, DropPath, GroupNormAct from timm.layers import get_act_layer, get_norm_act_layer, create_conv2d, make_divisible from ._builder import build_model_with_cfg from ._manipulate import checkpoint_seq, named_apply from ._registry import generate_default_cfgs, register_model, register_model_deprecations __all__ = ['RegNet', 'RegNetCfg'] # model_registry will add each entrypoint fn to this @dataclass class RegNetCfg: depth: int = 21 w0: int = 80 wa: float = 42.63 wm: float = 2.66 group_size: int = 24 bottle_ratio: float = 1. se_ratio: float = 0. group_min_ratio: float = 0. stem_width: int = 32 downsample: Optional[str] = 'conv1x1' linear_out: bool = False preact: bool = False num_features: int = 0 act_layer: Union[str, Callable] = 'relu' norm_layer: Union[str, Callable] = 'batchnorm' def quantize_float(f, q): """Converts a float to the closest non-zero int divisible by q.""" return int(round(f / q) * q) def adjust_widths_groups_comp(widths, bottle_ratios, groups, min_ratio=0.): """Adjusts the compatibility of widths and groups.""" bottleneck_widths = [int(w * b) for w, b in zip(widths, bottle_ratios)] groups = [min(g, w_bot) for g, w_bot in zip(groups, bottleneck_widths)] if min_ratio: # torchvision uses a different rounding scheme for ensuring bottleneck widths divisible by group widths bottleneck_widths = [make_divisible(w_bot, g, min_ratio) for w_bot, g in zip(bottleneck_widths, groups)] else: bottleneck_widths = [quantize_float(w_bot, g) for w_bot, g in zip(bottleneck_widths, groups)] widths = [int(w_bot / b) for w_bot, b in zip(bottleneck_widths, bottle_ratios)] return widths, groups def generate_regnet(width_slope, width_initial, width_mult, depth, group_size, quant=8): """Generates per block widths from RegNet parameters.""" assert width_slope >= 0 and width_initial > 0 and width_mult > 1 and width_initial % quant == 0 # TODO dWr scaling? # depth = int(depth * (scale ** 0.1)) # width_scale = scale ** 0.4 # dWr scale, exp 0.8 / 2, applied to both group and layer widths widths_cont = np.arange(depth) * width_slope + width_initial width_exps = np.round(np.log(widths_cont / width_initial) / np.log(width_mult)) widths = np.round(np.divide(width_initial * np.power(width_mult, width_exps), quant)) * quant num_stages, max_stage = len(np.unique(widths)), width_exps.max() + 1 groups = np.array([group_size for _ in range(num_stages)]) return widths.astype(int).tolist(), num_stages, groups.astype(int).tolist() def downsample_conv( in_chs, out_chs, kernel_size=1, stride=1, dilation=1, norm_layer=None, preact=False, ): norm_layer = norm_layer or nn.BatchNorm2d kernel_size = 1 if stride == 1 and dilation == 1 else kernel_size dilation = dilation if kernel_size > 1 else 1 if preact: return create_conv2d( in_chs, out_chs, kernel_size, stride=stride, dilation=dilation, ) else: return ConvNormAct( in_chs, out_chs, kernel_size, stride=stride, dilation=dilation, norm_layer=norm_layer, apply_act=False, ) def downsample_avg( in_chs, out_chs, kernel_size=1, stride=1, dilation=1, norm_layer=None, preact=False, ): """ AvgPool Downsampling as in 'D' ResNet variants. This is not in RegNet space but I might experiment.""" norm_layer = norm_layer or nn.BatchNorm2d avg_stride = stride if dilation == 1 else 1 pool = nn.Identity() if stride > 1 or dilation > 1: avg_pool_fn = AvgPool2dSame if avg_stride == 1 and dilation > 1 else nn.AvgPool2d pool = avg_pool_fn(2, avg_stride, ceil_mode=True, count_include_pad=False) if preact: conv = create_conv2d(in_chs, out_chs, 1, stride=1) else: conv = ConvNormAct(in_chs, out_chs, 1, stride=1, norm_layer=norm_layer, apply_act=False) return nn.Sequential(*[pool, conv]) def create_shortcut( downsample_type, in_chs, out_chs, kernel_size, stride, dilation=(1, 1), norm_layer=None, preact=False, ): assert downsample_type in ('avg', 'conv1x1', '', None) if in_chs != out_chs or stride != 1 or dilation[0] != dilation[1]: dargs = dict(stride=stride, dilation=dilation[0], norm_layer=norm_layer, preact=preact) if not downsample_type: return None # no shortcut, no downsample elif downsample_type == 'avg': return downsample_avg(in_chs, out_chs, **dargs) else: return downsample_conv(in_chs, out_chs, kernel_size=kernel_size, **dargs) else: return nn.Identity() # identity shortcut (no downsample) class Bottleneck(nn.Module): """ RegNet Bottleneck This is almost exactly the same as a ResNet Bottlneck. The main difference is the SE block is moved from after conv3 to after conv2. Otherwise, it's just redefining the arguments for groups/bottleneck channels. """ def __init__( self, in_chs, out_chs, stride=1, dilation=(1, 1), bottle_ratio=1, group_size=1, se_ratio=0.25, downsample='conv1x1', linear_out=False, act_layer=nn.ReLU, norm_layer=nn.BatchNorm2d, drop_block=None, drop_path_rate=0., ): super(Bottleneck, self).__init__() act_layer = get_act_layer(act_layer) bottleneck_chs = int(round(out_chs * bottle_ratio)) groups = bottleneck_chs // group_size cargs = dict(act_layer=act_layer, norm_layer=norm_layer) self.conv1 = ConvNormAct(in_chs, bottleneck_chs, kernel_size=1, **cargs) self.conv2 = ConvNormAct( bottleneck_chs, bottleneck_chs, kernel_size=3, stride=stride, dilation=dilation[0], groups=groups, drop_layer=drop_block, **cargs, ) if se_ratio: se_channels = int(round(in_chs * se_ratio)) self.se = SEModule(bottleneck_chs, rd_channels=se_channels, act_layer=act_layer) else: self.se = nn.Identity() self.conv3 = ConvNormAct(bottleneck_chs, out_chs, kernel_size=1, apply_act=False, **cargs) self.act3 = nn.Identity() if linear_out else act_layer() self.downsample = create_shortcut( downsample, in_chs, out_chs, kernel_size=1, stride=stride, dilation=dilation, norm_layer=norm_layer, ) self.drop_path = DropPath(drop_path_rate) if drop_path_rate > 0 else nn.Identity() def zero_init_last(self): nn.init.zeros_(self.conv3.bn.weight) def forward(self, x): shortcut = x x = self.conv1(x) x = self.conv2(x) x = self.se(x) x = self.conv3(x) if self.downsample is not None: # NOTE stuck with downsample as the attr name due to weight compatibility # now represents the shortcut, no shortcut if None, and non-downsample shortcut == nn.Identity() x = self.drop_path(x) + self.downsample(shortcut) x = self.act3(x) return x class PreBottleneck(nn.Module): """ RegNet Bottleneck This is almost exactly the same as a ResNet Bottlneck. The main difference is the SE block is moved from after conv3 to after conv2. Otherwise, it's just redefining the arguments for groups/bottleneck channels. """ def __init__( self, in_chs, out_chs, stride=1, dilation=(1, 1), bottle_ratio=1, group_size=1, se_ratio=0.25, downsample='conv1x1', linear_out=False, act_layer=nn.ReLU, norm_layer=nn.BatchNorm2d, drop_block=None, drop_path_rate=0., ): super(PreBottleneck, self).__init__() norm_act_layer = get_norm_act_layer(norm_layer, act_layer) bottleneck_chs = int(round(out_chs * bottle_ratio)) groups = bottleneck_chs // group_size self.norm1 = norm_act_layer(in_chs) self.conv1 = create_conv2d(in_chs, bottleneck_chs, kernel_size=1) self.norm2 = norm_act_layer(bottleneck_chs) self.conv2 = create_conv2d( bottleneck_chs, bottleneck_chs, kernel_size=3, stride=stride, dilation=dilation[0], groups=groups, ) if se_ratio: se_channels = int(round(in_chs * se_ratio)) self.se = SEModule(bottleneck_chs, rd_channels=se_channels, act_layer=act_layer) else: self.se = nn.Identity() self.norm3 = norm_act_layer(bottleneck_chs) self.conv3 = create_conv2d(bottleneck_chs, out_chs, kernel_size=1) self.downsample = create_shortcut( downsample, in_chs, out_chs, kernel_size=1, stride=stride, dilation=dilation, preact=True, ) self.drop_path = DropPath(drop_path_rate) if drop_path_rate > 0 else nn.Identity() def zero_init_last(self): pass def forward(self, x): x = self.norm1(x) shortcut = x x = self.conv1(x) x = self.norm2(x) x = self.conv2(x) x = self.se(x) x = self.norm3(x) x = self.conv3(x) if self.downsample is not None: # NOTE stuck with downsample as the attr name due to weight compatibility # now represents the shortcut, no shortcut if None, and non-downsample shortcut == nn.Identity() x = self.drop_path(x) + self.downsample(shortcut) return x class RegStage(nn.Module): """Stage (sequence of blocks w/ the same output shape).""" def __init__( self, depth, in_chs, out_chs, stride, dilation, drop_path_rates=None, block_fn=Bottleneck, **block_kwargs, ): super(RegStage, self).__init__() self.grad_checkpointing = False first_dilation = 1 if dilation in (1, 2) else 2 for i in range(depth): block_stride = stride if i == 0 else 1 block_in_chs = in_chs if i == 0 else out_chs block_dilation = (first_dilation, dilation) dpr = drop_path_rates[i] if drop_path_rates is not None else 0. name = "b{}".format(i + 1) self.add_module( name, block_fn( block_in_chs, out_chs, stride=block_stride, dilation=block_dilation, drop_path_rate=dpr, **block_kwargs, ) ) first_dilation = dilation def forward(self, x): if self.grad_checkpointing and not torch.jit.is_scripting(): x = checkpoint_seq(self.children(), x) else: for block in self.children(): x = block(x) return x class RegNet(nn.Module): """RegNet-X, Y, and Z Models Paper: https://arxiv.org/abs/2003.13678 Original Impl: https://github.com/facebookresearch/pycls/blob/master/pycls/models/regnet.py """ def __init__( self, cfg: RegNetCfg, in_chans=3, num_classes=1000, output_stride=32, global_pool='avg', drop_rate=0., drop_path_rate=0., zero_init_last=True, **kwargs, ): """ Args: cfg (RegNetCfg): Model architecture configuration in_chans (int): Number of input channels (default: 3) num_classes (int): Number of classifier classes (default: 1000) output_stride (int): Output stride of network, one of (8, 16, 32) (default: 32) global_pool (str): Global pooling type (default: 'avg') drop_rate (float): Dropout rate (default: 0.) drop_path_rate (float): Stochastic depth drop-path rate (default: 0.) zero_init_last (bool): Zero-init last weight of residual path kwargs (dict): Extra kwargs overlayed onto cfg """ super().__init__() self.num_classes = num_classes self.drop_rate = drop_rate assert output_stride in (8, 16, 32) cfg = replace(cfg, **kwargs) # update cfg with extra passed kwargs # Construct the stem stem_width = cfg.stem_width na_args = dict(act_layer=cfg.act_layer, norm_layer=cfg.norm_layer) if cfg.preact: self.stem = create_conv2d(in_chans, stem_width, 3, stride=2) else: self.stem = ConvNormAct(in_chans, stem_width, 3, stride=2, **na_args) self.feature_info = [dict(num_chs=stem_width, reduction=2, module='stem')] # Construct the stages prev_width = stem_width curr_stride = 2 per_stage_args, common_args = self._get_stage_args( cfg, output_stride=output_stride, drop_path_rate=drop_path_rate, ) assert len(per_stage_args) == 4 block_fn = PreBottleneck if cfg.preact else Bottleneck for i, stage_args in enumerate(per_stage_args): stage_name = "s{}".format(i + 1) self.add_module( stage_name, RegStage( in_chs=prev_width, block_fn=block_fn, **stage_args, **common_args, ) ) prev_width = stage_args['out_chs'] curr_stride *= stage_args['stride'] self.feature_info += [dict(num_chs=prev_width, reduction=curr_stride, module=stage_name)] # Construct the head if cfg.num_features: self.final_conv = ConvNormAct(prev_width, cfg.num_features, kernel_size=1, **na_args) self.num_features = cfg.num_features else: final_act = cfg.linear_out or cfg.preact self.final_conv = get_act_layer(cfg.act_layer)() if final_act else nn.Identity() self.num_features = prev_width self.head = ClassifierHead( in_features=self.num_features, num_classes=num_classes, pool_type=global_pool, drop_rate=drop_rate, ) named_apply(partial(_init_weights, zero_init_last=zero_init_last), self) def _get_stage_args(self, cfg: RegNetCfg, default_stride=2, output_stride=32, drop_path_rate=0.): # Generate RegNet ws per block widths, num_stages, stage_gs = generate_regnet(cfg.wa, cfg.w0, cfg.wm, cfg.depth, cfg.group_size) # Convert to per stage format stage_widths, stage_depths = np.unique(widths, return_counts=True) stage_br = [cfg.bottle_ratio for _ in range(num_stages)] stage_strides = [] stage_dilations = [] net_stride = 2 dilation = 1 for _ in range(num_stages): if net_stride >= output_stride: dilation *= default_stride stride = 1 else: stride = default_stride net_stride *= stride stage_strides.append(stride) stage_dilations.append(dilation) stage_dpr = np.split(np.linspace(0, drop_path_rate, sum(stage_depths)), np.cumsum(stage_depths[:-1])) # Adjust the compatibility of ws and gws stage_widths, stage_gs = adjust_widths_groups_comp( stage_widths, stage_br, stage_gs, min_ratio=cfg.group_min_ratio) arg_names = ['out_chs', 'stride', 'dilation', 'depth', 'bottle_ratio', 'group_size', 'drop_path_rates'] per_stage_args = [ dict(zip(arg_names, params)) for params in zip(stage_widths, stage_strides, stage_dilations, stage_depths, stage_br, stage_gs, stage_dpr) ] common_args = dict( downsample=cfg.downsample, se_ratio=cfg.se_ratio, linear_out=cfg.linear_out, act_layer=cfg.act_layer, norm_layer=cfg.norm_layer, ) return per_stage_args, common_args @torch.jit.ignore def group_matcher(self, coarse=False): return dict( stem=r'^stem', blocks=r'^s(\d+)' if coarse else r'^s(\d+)\.b(\d+)', ) @torch.jit.ignore def set_grad_checkpointing(self, enable=True): for s in list(self.children())[1:-1]: s.grad_checkpointing = enable @torch.jit.ignore def get_classifier(self): return self.head.fc def reset_classifier(self, num_classes, global_pool='avg'): self.head.reset(num_classes, pool_type=global_pool) def forward_features(self, x): x = self.stem(x) x = self.s1(x) x = self.s2(x) x = self.s3(x) x = self.s4(x) x = self.final_conv(x) return x def forward_head(self, x, pre_logits: bool = False): return self.head(x, pre_logits=pre_logits) def forward(self, x): x = self.forward_features(x) x = self.forward_head(x) return x def _init_weights(module, name='', zero_init_last=False): if isinstance(module, nn.Conv2d): fan_out = module.kernel_size[0] * module.kernel_size[1] * module.out_channels fan_out //= module.groups module.weight.data.normal_(0, math.sqrt(2.0 / fan_out)) if module.bias is not None: module.bias.data.zero_() elif isinstance(module, nn.Linear): nn.init.normal_(module.weight, mean=0.0, std=0.01) if module.bias is not None: nn.init.zeros_(module.bias) elif zero_init_last and hasattr(module, 'zero_init_last'): module.zero_init_last() def _filter_fn(state_dict): state_dict = state_dict.get('model', state_dict) replaces = [ ('f.a.0', 'conv1.conv'), ('f.a.1', 'conv1.bn'), ('f.b.0', 'conv2.conv'), ('f.b.1', 'conv2.bn'), ('f.final_bn', 'conv3.bn'), ('f.se.excitation.0', 'se.fc1'), ('f.se.excitation.2', 'se.fc2'), ('f.se', 'se'), ('f.c.0', 'conv3.conv'), ('f.c.1', 'conv3.bn'), ('f.c', 'conv3.conv'), ('proj.0', 'downsample.conv'), ('proj.1', 'downsample.bn'), ('proj', 'downsample.conv'), ] if 'classy_state_dict' in state_dict: # classy-vision & vissl (SEER) weights import re state_dict = state_dict['classy_state_dict']['base_model']['model'] out = {} for k, v in state_dict['trunk'].items(): k = k.replace('_feature_blocks.conv1.stem.0', 'stem.conv') k = k.replace('_feature_blocks.conv1.stem.1', 'stem.bn') k = re.sub( r'^_feature_blocks.res\d.block(\d)-(\d+)', lambda x: f's{int(x.group(1))}.b{int(x.group(2)) + 1}', k) k = re.sub(r's(\d)\.b(\d+)\.bn', r's\1.b\2.downsample.bn', k) for s, r in replaces: k = k.replace(s, r) out[k] = v for k, v in state_dict['heads'].items(): if 'projection_head' in k or 'prototypes' in k: continue k = k.replace('0.clf.0', 'head.fc') out[k] = v return out if 'stem.0.weight' in state_dict: # torchvision weights import re out = {} for k, v in state_dict.items(): k = k.replace('stem.0', 'stem.conv') k = k.replace('stem.1', 'stem.bn') k = re.sub( r'trunk_output.block(\d)\.block(\d+)\-(\d+)', lambda x: f's{int(x.group(1))}.b{int(x.group(3)) + 1}', k) for s, r in replaces: k = k.replace(s, r) k = k.replace('fc.', 'head.fc.') out[k] = v return out return state_dict # Model FLOPS = three trailing digits * 10^8 model_cfgs = dict( # RegNet-X regnetx_002=RegNetCfg(w0=24, wa=36.44, wm=2.49, group_size=8, depth=13), regnetx_004=RegNetCfg(w0=24, wa=24.48, wm=2.54, group_size=16, depth=22), regnetx_004_tv=RegNetCfg(w0=24, wa=24.48, wm=2.54, group_size=16, depth=22, group_min_ratio=0.9), regnetx_006=RegNetCfg(w0=48, wa=36.97, wm=2.24, group_size=24, depth=16), regnetx_008=RegNetCfg(w0=56, wa=35.73, wm=2.28, group_size=16, depth=16), regnetx_016=RegNetCfg(w0=80, wa=34.01, wm=2.25, group_size=24, depth=18), regnetx_032=RegNetCfg(w0=88, wa=26.31, wm=2.25, group_size=48, depth=25), regnetx_040=RegNetCfg(w0=96, wa=38.65, wm=2.43, group_size=40, depth=23), regnetx_064=RegNetCfg(w0=184, wa=60.83, wm=2.07, group_size=56, depth=17), regnetx_080=RegNetCfg(w0=80, wa=49.56, wm=2.88, group_size=120, depth=23), regnetx_120=RegNetCfg(w0=168, wa=73.36, wm=2.37, group_size=112, depth=19), regnetx_160=RegNetCfg(w0=216, wa=55.59, wm=2.1, group_size=128, depth=22), regnetx_320=RegNetCfg(w0=320, wa=69.86, wm=2.0, group_size=168, depth=23), # RegNet-Y regnety_002=RegNetCfg(w0=24, wa=36.44, wm=2.49, group_size=8, depth=13, se_ratio=0.25), regnety_004=RegNetCfg(w0=48, wa=27.89, wm=2.09, group_size=8, depth=16, se_ratio=0.25), regnety_006=RegNetCfg(w0=48, wa=32.54, wm=2.32, group_size=16, depth=15, se_ratio=0.25), regnety_008=RegNetCfg(w0=56, wa=38.84, wm=2.4, group_size=16, depth=14, se_ratio=0.25), regnety_008_tv=RegNetCfg(w0=56, wa=38.84, wm=2.4, group_size=16, depth=14, se_ratio=0.25, group_min_ratio=0.9), regnety_016=RegNetCfg(w0=48, wa=20.71, wm=2.65, group_size=24, depth=27, se_ratio=0.25), regnety_032=RegNetCfg(w0=80, wa=42.63, wm=2.66, group_size=24, depth=21, se_ratio=0.25), regnety_040=RegNetCfg(w0=96, wa=31.41, wm=2.24, group_size=64, depth=22, se_ratio=0.25), regnety_064=RegNetCfg(w0=112, wa=33.22, wm=2.27, group_size=72, depth=25, se_ratio=0.25), regnety_080=RegNetCfg(w0=192, wa=76.82, wm=2.19, group_size=56, depth=17, se_ratio=0.25), regnety_080_tv=RegNetCfg(w0=192, wa=76.82, wm=2.19, group_size=56, depth=17, se_ratio=0.25, group_min_ratio=0.9), regnety_120=RegNetCfg(w0=168, wa=73.36, wm=2.37, group_size=112, depth=19, se_ratio=0.25), regnety_160=RegNetCfg(w0=200, wa=106.23, wm=2.48, group_size=112, depth=18, se_ratio=0.25), regnety_320=RegNetCfg(w0=232, wa=115.89, wm=2.53, group_size=232, depth=20, se_ratio=0.25), regnety_640=RegNetCfg(w0=352, wa=147.48, wm=2.4, group_size=328, depth=20, se_ratio=0.25), regnety_1280=RegNetCfg(w0=456, wa=160.83, wm=2.52, group_size=264, depth=27, se_ratio=0.25), regnety_2560=RegNetCfg(w0=640, wa=230.83, wm=2.53, group_size=373, depth=27, se_ratio=0.25), #regnety_2560=RegNetCfg(w0=640, wa=124.47, wm=2.04, group_size=848, depth=27, se_ratio=0.25), # Experimental regnety_040_sgn=RegNetCfg( w0=96, wa=31.41, wm=2.24, group_size=64, depth=22, se_ratio=0.25, act_layer='silu', norm_layer=partial(GroupNormAct, group_size=16)), # regnetv = 'preact regnet y' regnetv_040=RegNetCfg( depth=22, w0=96, wa=31.41, wm=2.24, group_size=64, se_ratio=0.25, preact=True, act_layer='silu'), regnetv_064=RegNetCfg( depth=25, w0=112, wa=33.22, wm=2.27, group_size=72, se_ratio=0.25, preact=True, act_layer='silu', downsample='avg'), # RegNet-Z (unverified) regnetz_005=RegNetCfg( depth=21, w0=16, wa=10.7, wm=2.51, group_size=4, bottle_ratio=4.0, se_ratio=0.25, downsample=None, linear_out=True, num_features=1024, act_layer='silu', ), regnetz_040=RegNetCfg( depth=28, w0=48, wa=14.5, wm=2.226, group_size=8, bottle_ratio=4.0, se_ratio=0.25, downsample=None, linear_out=True, num_features=0, act_layer='silu', ), regnetz_040_h=RegNetCfg( depth=28, w0=48, wa=14.5, wm=2.226, group_size=8, bottle_ratio=4.0, se_ratio=0.25, downsample=None, linear_out=True, num_features=1536, act_layer='silu', ), ) def _create_regnet(variant, pretrained, **kwargs): return build_model_with_cfg( RegNet, variant, pretrained, model_cfg=model_cfgs[variant], pretrained_filter_fn=_filter_fn, **kwargs) def _cfg(url='', **kwargs): return { 'url': url, 'num_classes': 1000, 'input_size': (3, 224, 224), 'pool_size': (7, 7), 'test_input_size': (3, 288, 288), 'crop_pct': 0.95, 'test_crop_pct': 1.0, 'interpolation': 'bicubic', 'mean': IMAGENET_DEFAULT_MEAN, 'std': IMAGENET_DEFAULT_STD, 'first_conv': 'stem.conv', 'classifier': 'head.fc', **kwargs } def _cfgpyc(url='', **kwargs): return { 'url': url, 'num_classes': 1000, 'input_size': (3, 224, 224), 'pool_size': (7, 7), 'crop_pct': 0.875, 'interpolation': 'bicubic', 'mean': IMAGENET_DEFAULT_MEAN, 'std': IMAGENET_DEFAULT_STD, 'first_conv': 'stem.conv', 'classifier': 'head.fc', 'license': 'mit', 'origin_url': 'https://github.com/facebookresearch/pycls', **kwargs } def _cfgtv2(url='', **kwargs): return { 'url': url, 'num_classes': 1000, 'input_size': (3, 224, 224), 'pool_size': (7, 7), 'crop_pct': 0.965, 'interpolation': 'bicubic', 'mean': IMAGENET_DEFAULT_MEAN, 'std': IMAGENET_DEFAULT_STD, 'first_conv': 'stem.conv', 'classifier': 'head.fc', 'license': 'bsd-3-clause', 'origin_url': 'https://github.com/pytorch/vision', **kwargs } default_cfgs = generate_default_cfgs({ # timm trained models 'regnety_032.ra_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-weights/regnety_032_ra-7f2439f9.pth'), 'regnety_040.ra3_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-tpu-weights/regnety_040_ra3-670e1166.pth'), 'regnety_064.ra3_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-tpu-weights/regnety_064_ra3-aa26dc7d.pth'), 'regnety_080.ra3_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-tpu-weights/regnety_080_ra3-1fdc4344.pth'), 'regnety_120.sw_in12k_ft_in1k': _cfg(hf_hub_id='timm/'), 'regnety_160.sw_in12k_ft_in1k': _cfg(hf_hub_id='timm/'), 'regnety_160.lion_in12k_ft_in1k': _cfg(hf_hub_id='timm/'), # timm in12k pretrain 'regnety_120.sw_in12k': _cfg( hf_hub_id='timm/', num_classes=11821), 'regnety_160.sw_in12k': _cfg( hf_hub_id='timm/', num_classes=11821), # timm custom arch (v and z guess) + trained models 'regnety_040_sgn.untrained': _cfg(url=''), 'regnetv_040.ra3_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-tpu-weights/regnetv_040_ra3-c248f51f.pth', first_conv='stem'), 'regnetv_064.ra3_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-tpu-weights/regnetv_064_ra3-530616c2.pth', first_conv='stem'), 'regnetz_005.untrained': _cfg(url=''), 'regnetz_040.ra3_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-tpu-weights/regnetz_040_ra3-9007edf5.pth', input_size=(3, 256, 256), pool_size=(8, 8), crop_pct=1.0, test_input_size=(3, 320, 320)), 'regnetz_040_h.ra3_in1k': _cfg( hf_hub_id='timm/', url='https://github.com/huggingface/pytorch-image-models/releases/download/v0.1-tpu-weights/regnetz_040h_ra3-f594343b.pth', input_size=(3, 256, 256), pool_size=(8, 8), crop_pct=1.0, test_input_size=(3, 320, 320)), # used in DeiT for distillation (from Facebook DeiT GitHub repository) 'regnety_160.deit_in1k': _cfg( hf_hub_id='timm/', url='https://dl.fbaipublicfiles.com/deit/regnety_160-a5fe301d.pth'), 'regnetx_004_tv.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_x_400mf-62229a5f.pth'), 'regnetx_008.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_x_800mf-94a99ebd.pth'), 'regnetx_016.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_x_1_6gf-a12f2b72.pth'), 'regnetx_032.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_x_3_2gf-7071aa85.pth'), 'regnetx_080.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_x_8gf-2b70d774.pth'), 'regnetx_160.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_x_16gf-ba3796d7.pth'), 'regnetx_320.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_x_32gf-6eb8fdc6.pth'), 'regnety_004.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_400mf-e6988f5f.pth'), 'regnety_008_tv.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_800mf-58fc7688.pth'), 'regnety_016.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_1_6gf-0d7bc02a.pth'), 'regnety_032.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_3_2gf-9180c971.pth'), 'regnety_080_tv.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_8gf-dc2b1b54.pth'), 'regnety_160.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_16gf-3e4a00f9.pth'), 'regnety_320.tv2_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_32gf-8db6d4b5.pth'), 'regnety_160.swag_ft_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_16gf_swag-43afe44d.pth', license='cc-by-nc-4.0', input_size=(3, 384, 384), pool_size=(12, 12), crop_pct=1.0), 'regnety_320.swag_ft_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_32gf_swag-04fdfa75.pth', license='cc-by-nc-4.0', input_size=(3, 384, 384), pool_size=(12, 12), crop_pct=1.0), 'regnety_1280.swag_ft_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_128gf_swag-c8ce3e52.pth', license='cc-by-nc-4.0', input_size=(3, 384, 384), pool_size=(12, 12), crop_pct=1.0), 'regnety_160.swag_lc_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_16gf_lc_swag-f3ec0043.pth', license='cc-by-nc-4.0'), 'regnety_320.swag_lc_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_32gf_lc_swag-e1583746.pth', license='cc-by-nc-4.0'), 'regnety_1280.swag_lc_in1k': _cfgtv2( hf_hub_id='timm/', url='https://download.pytorch.org/models/regnet_y_128gf_lc_swag-cbe8ce12.pth', license='cc-by-nc-4.0'), 'regnety_320.seer_ft_in1k': _cfgtv2( hf_hub_id='timm/', license='other', origin_url='https://github.com/facebookresearch/vissl', url='https://dl.fbaipublicfiles.com/vissl/model_zoo/seer_finetuned/seer_regnet32_finetuned_in1k_model_final_checkpoint_phase78.torch', input_size=(3, 384, 384), pool_size=(12, 12), crop_pct=1.0), 'regnety_640.seer_ft_in1k': _cfgtv2( hf_hub_id='timm/', license='other', origin_url='https://github.com/facebookresearch/vissl', url='https://dl.fbaipublicfiles.com/vissl/model_zoo/seer_finetuned/seer_regnet64_finetuned_in1k_model_final_checkpoint_phase78.torch', input_size=(3, 384, 384), pool_size=(12, 12), crop_pct=1.0), 'regnety_1280.seer_ft_in1k': _cfgtv2( hf_hub_id='timm/', license='other', origin_url='https://github.com/facebookresearch/vissl', url='https://dl.fbaipublicfiles.com/vissl/model_zoo/seer_finetuned/seer_regnet128_finetuned_in1k_model_final_checkpoint_phase78.torch', input_size=(3, 384, 384), pool_size=(12, 12), crop_pct=1.0), 'regnety_2560.seer_ft_in1k': _cfgtv2( hf_hub_id='timm/', license='other', origin_url='https://github.com/facebookresearch/vissl', url='https://dl.fbaipublicfiles.com/vissl/model_zoo/seer_finetuned/seer_regnet256_finetuned_in1k_model_final_checkpoint_phase38.torch', input_size=(3, 384, 384), pool_size=(12, 12), crop_pct=1.0), 'regnety_320.seer': _cfgtv2( hf_hub_id='timm/', url='https://dl.fbaipublicfiles.com/vissl/model_zoo/seer_regnet32d/seer_regnet32gf_model_iteration244000.torch', num_classes=0, license='other', origin_url='https://github.com/facebookresearch/vissl'), 'regnety_640.seer': _cfgtv2( hf_hub_id='timm/', url='https://dl.fbaipublicfiles.com/vissl/model_zoo/seer_regnet64/seer_regnet64gf_model_final_checkpoint_phase0.torch', num_classes=0, license='other', origin_url='https://github.com/facebookresearch/vissl'), 'regnety_1280.seer': _cfgtv2( hf_hub_id='timm/', url='https://dl.fbaipublicfiles.com/vissl/model_zoo/swav_ig1b_regnet128Gf_cnstant_bs32_node16_sinkhorn10_proto16k_syncBN64_warmup8k/model_final_checkpoint_phase0.torch', num_classes=0, license='other', origin_url='https://github.com/facebookresearch/vissl'), # FIXME invalid weight <-> model match, mistake on their end #'regnety_2560.seer': _cfgtv2( # url='https://dl.fbaipublicfiles.com/vissl/model_zoo/swav_ig1b_cosine_rg256gf_noBNhead_wd1e5_fairstore_bs16_node64_sinkhorn10_proto16k_apex_syncBN64_warmup8k/model_final_checkpoint_phase0.torch', # num_classes=0, license='other', origin_url='https://github.com/facebookresearch/vissl'), 'regnetx_002.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_004.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_006.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_008.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_016.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_032.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_040.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_064.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_080.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_120.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_160.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnetx_320.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_002.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_004.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_006.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_008.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_016.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_032.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_040.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_064.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_080.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_120.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_160.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), 'regnety_320.pycls_in1k': _cfgpyc(hf_hub_id='timm/'), }) @register_model def regnetx_002(pretrained=False, **kwargs) -> RegNet: """RegNetX-200MF""" return _create_regnet('regnetx_002', pretrained, **kwargs) @register_model def regnetx_004(pretrained=False, **kwargs) -> RegNet: """RegNetX-400MF""" return _create_regnet('regnetx_004', pretrained, **kwargs) @register_model def regnetx_004_tv(pretrained=False, **kwargs) -> RegNet: """RegNetX-400MF w/ torchvision group rounding""" return _create_regnet('regnetx_004_tv', pretrained, **kwargs) @register_model def regnetx_006(pretrained=False, **kwargs) -> RegNet: """RegNetX-600MF""" return _create_regnet('regnetx_006', pretrained, **kwargs) @register_model def regnetx_008(pretrained=False, **kwargs) -> RegNet: """RegNetX-800MF""" return _create_regnet('regnetx_008', pretrained, **kwargs) @register_model def regnetx_016(pretrained=False, **kwargs) -> RegNet: """RegNetX-1.6GF""" return _create_regnet('regnetx_016', pretrained, **kwargs) @register_model def regnetx_032(pretrained=False, **kwargs) -> RegNet: """RegNetX-3.2GF""" return _create_regnet('regnetx_032', pretrained, **kwargs) @register_model def regnetx_040(pretrained=False, **kwargs) -> RegNet: """RegNetX-4.0GF""" return _create_regnet('regnetx_040', pretrained, **kwargs) @register_model def regnetx_064(pretrained=False, **kwargs) -> RegNet: """RegNetX-6.4GF""" return _create_regnet('regnetx_064', pretrained, **kwargs) @register_model def regnetx_080(pretrained=False, **kwargs) -> RegNet: """RegNetX-8.0GF""" return _create_regnet('regnetx_080', pretrained, **kwargs) @register_model def regnetx_120(pretrained=False, **kwargs) -> RegNet: """RegNetX-12GF""" return _create_regnet('regnetx_120', pretrained, **kwargs) @register_model def regnetx_160(pretrained=False, **kwargs) -> RegNet: """RegNetX-16GF""" return _create_regnet('regnetx_160', pretrained, **kwargs) @register_model def regnetx_320(pretrained=False, **kwargs) -> RegNet: """RegNetX-32GF""" return _create_regnet('regnetx_320', pretrained, **kwargs) @register_model def regnety_002(pretrained=False, **kwargs) -> RegNet: """RegNetY-200MF""" return _create_regnet('regnety_002', pretrained, **kwargs) @register_model def regnety_004(pretrained=False, **kwargs) -> RegNet: """RegNetY-400MF""" return _create_regnet('regnety_004', pretrained, **kwargs) @register_model def regnety_006(pretrained=False, **kwargs) -> RegNet: """RegNetY-600MF""" return _create_regnet('regnety_006', pretrained, **kwargs) @register_model def regnety_008(pretrained=False, **kwargs) -> RegNet: """RegNetY-800MF""" return _create_regnet('regnety_008', pretrained, **kwargs) @register_model def regnety_008_tv(pretrained=False, **kwargs) -> RegNet: """RegNetY-800MF w/ torchvision group rounding""" return _create_regnet('regnety_008_tv', pretrained, **kwargs) @register_model def regnety_016(pretrained=False, **kwargs) -> RegNet: """RegNetY-1.6GF""" return _create_regnet('regnety_016', pretrained, **kwargs) @register_model def regnety_032(pretrained=False, **kwargs) -> RegNet: """RegNetY-3.2GF""" return _create_regnet('regnety_032', pretrained, **kwargs) @register_model def regnety_040(pretrained=False, **kwargs) -> RegNet: """RegNetY-4.0GF""" return _create_regnet('regnety_040', pretrained, **kwargs) @register_model def regnety_064(pretrained=False, **kwargs) -> RegNet: """RegNetY-6.4GF""" return _create_regnet('regnety_064', pretrained, **kwargs) @register_model def regnety_080(pretrained=False, **kwargs) -> RegNet: """RegNetY-8.0GF""" return _create_regnet('regnety_080', pretrained, **kwargs) @register_model def regnety_080_tv(pretrained=False, **kwargs) -> RegNet: """RegNetY-8.0GF w/ torchvision group rounding""" return _create_regnet('regnety_080_tv', pretrained, **kwargs) @register_model def regnety_120(pretrained=False, **kwargs) -> RegNet: """RegNetY-12GF""" return _create_regnet('regnety_120', pretrained, **kwargs) @register_model def regnety_160(pretrained=False, **kwargs) -> RegNet: """RegNetY-16GF""" return _create_regnet('regnety_160', pretrained, **kwargs) @register_model def regnety_320(pretrained=False, **kwargs) -> RegNet: """RegNetY-32GF""" return _create_regnet('regnety_320', pretrained, **kwargs) @register_model def regnety_640(pretrained=False, **kwargs) -> RegNet: """RegNetY-64GF""" return _create_regnet('regnety_640', pretrained, **kwargs) @register_model def regnety_1280(pretrained=False, **kwargs) -> RegNet: """RegNetY-128GF""" return _create_regnet('regnety_1280', pretrained, **kwargs) @register_model def regnety_2560(pretrained=False, **kwargs) -> RegNet: """RegNetY-256GF""" return _create_regnet('regnety_2560', pretrained, **kwargs) @register_model def regnety_040_sgn(pretrained=False, **kwargs) -> RegNet: """RegNetY-4.0GF w/ GroupNorm """ return _create_regnet('regnety_040_sgn', pretrained, **kwargs) @register_model def regnetv_040(pretrained=False, **kwargs) -> RegNet: """RegNetV-4.0GF (pre-activation)""" return _create_regnet('regnetv_040', pretrained, **kwargs) @register_model def regnetv_064(pretrained=False, **kwargs) -> RegNet: """RegNetV-6.4GF (pre-activation)""" return _create_regnet('regnetv_064', pretrained, **kwargs) @register_model def regnetz_005(pretrained=False, **kwargs) -> RegNet: """RegNetZ-500MF NOTE: config found in https://github.com/facebookresearch/ClassyVision/blob/main/classy_vision/models/regnet.py but it's not clear it is equivalent to paper model as not detailed in the paper. """ return _create_regnet('regnetz_005', pretrained, zero_init_last=False, **kwargs) @register_model def regnetz_040(pretrained=False, **kwargs) -> RegNet: """RegNetZ-4.0GF NOTE: config found in https://github.com/facebookresearch/ClassyVision/blob/main/classy_vision/models/regnet.py but it's not clear it is equivalent to paper model as not detailed in the paper. """ return _create_regnet('regnetz_040', pretrained, zero_init_last=False, **kwargs) @register_model def regnetz_040_h(pretrained=False, **kwargs) -> RegNet: """RegNetZ-4.0GF NOTE: config found in https://github.com/facebookresearch/ClassyVision/blob/main/classy_vision/models/regnet.py but it's not clear it is equivalent to paper model as not detailed in the paper. """ return _create_regnet('regnetz_040_h', pretrained, zero_init_last=False, **kwargs) register_model_deprecations(__name__, { 'regnetz_040h': 'regnetz_040_h', })
pytorch-image-models/timm/models/regnet.py/0
{ "file_path": "pytorch-image-models/timm/models/regnet.py", "repo_id": "pytorch-image-models", "token_count": 21400 }
185
""" Transformer in Transformer (TNT) in PyTorch A PyTorch implement of TNT as described in 'Transformer in Transformer' - https://arxiv.org/abs/2103.00112 The official mindspore code is released and available at https://gitee.com/mindspore/mindspore/tree/master/model_zoo/research/cv/TNT """ import math import torch import torch.nn as nn from torch.utils.checkpoint import checkpoint from timm.data import IMAGENET_DEFAULT_MEAN, IMAGENET_DEFAULT_STD from timm.layers import Mlp, DropPath, trunc_normal_, _assert, to_2tuple from ._builder import build_model_with_cfg from ._registry import register_model from .vision_transformer import resize_pos_embed __all__ = ['TNT'] # model_registry will add each entrypoint fn to this def _cfg(url='', **kwargs): return { 'url': url, 'num_classes': 1000, 'input_size': (3, 224, 224), 'pool_size': None, 'crop_pct': .9, 'interpolation': 'bicubic', 'fixed_input_size': True, 'mean': IMAGENET_DEFAULT_MEAN, 'std': IMAGENET_DEFAULT_STD, 'first_conv': 'pixel_embed.proj', 'classifier': 'head', **kwargs } default_cfgs = { 'tnt_s_patch16_224': _cfg( url='https://github.com/contrastive/pytorch-image-models/releases/download/TNT/tnt_s_patch16_224.pth.tar', mean=(0.5, 0.5, 0.5), std=(0.5, 0.5, 0.5), ), 'tnt_b_patch16_224': _cfg( mean=(0.5, 0.5, 0.5), std=(0.5, 0.5, 0.5), ), } class Attention(nn.Module): """ Multi-Head Attention """ def __init__(self, dim, hidden_dim, num_heads=8, qkv_bias=False, attn_drop=0., proj_drop=0.): super().__init__() self.hidden_dim = hidden_dim self.num_heads = num_heads head_dim = hidden_dim // num_heads self.head_dim = head_dim self.scale = head_dim ** -0.5 self.qk = nn.Linear(dim, hidden_dim * 2, bias=qkv_bias) self.v = nn.Linear(dim, dim, bias=qkv_bias) self.attn_drop = nn.Dropout(attn_drop, inplace=True) self.proj = nn.Linear(dim, dim) self.proj_drop = nn.Dropout(proj_drop, inplace=True) def forward(self, x): B, N, C = x.shape qk = self.qk(x).reshape(B, N, 2, self.num_heads, self.head_dim).permute(2, 0, 3, 1, 4) q, k = qk.unbind(0) # make torchscript happy (cannot use tensor as tuple) v = self.v(x).reshape(B, N, self.num_heads, -1).permute(0, 2, 1, 3) attn = (q @ k.transpose(-2, -1)) * self.scale attn = attn.softmax(dim=-1) attn = self.attn_drop(attn) x = (attn @ v).transpose(1, 2).reshape(B, N, -1) x = self.proj(x) x = self.proj_drop(x) return x class Block(nn.Module): """ TNT Block """ def __init__( self, dim, dim_out, num_pixel, num_heads_in=4, num_heads_out=12, mlp_ratio=4., qkv_bias=False, proj_drop=0., attn_drop=0., drop_path=0., act_layer=nn.GELU, norm_layer=nn.LayerNorm, ): super().__init__() # Inner transformer self.norm_in = norm_layer(dim) self.attn_in = Attention( dim, dim, num_heads=num_heads_in, qkv_bias=qkv_bias, attn_drop=attn_drop, proj_drop=proj_drop, ) self.norm_mlp_in = norm_layer(dim) self.mlp_in = Mlp( in_features=dim, hidden_features=int(dim * 4), out_features=dim, act_layer=act_layer, drop=proj_drop, ) self.norm1_proj = norm_layer(dim) self.proj = nn.Linear(dim * num_pixel, dim_out, bias=True) # Outer transformer self.norm_out = norm_layer(dim_out) self.attn_out = Attention( dim_out, dim_out, num_heads=num_heads_out, qkv_bias=qkv_bias, attn_drop=attn_drop, proj_drop=proj_drop, ) self.drop_path = DropPath(drop_path) if drop_path > 0. else nn.Identity() self.norm_mlp = norm_layer(dim_out) self.mlp = Mlp( in_features=dim_out, hidden_features=int(dim_out * mlp_ratio), out_features=dim_out, act_layer=act_layer, drop=proj_drop, ) def forward(self, pixel_embed, patch_embed): # inner pixel_embed = pixel_embed + self.drop_path(self.attn_in(self.norm_in(pixel_embed))) pixel_embed = pixel_embed + self.drop_path(self.mlp_in(self.norm_mlp_in(pixel_embed))) # outer B, N, C = patch_embed.size() patch_embed = torch.cat( [patch_embed[:, 0:1], patch_embed[:, 1:] + self.proj(self.norm1_proj(pixel_embed).reshape(B, N - 1, -1))], dim=1) patch_embed = patch_embed + self.drop_path(self.attn_out(self.norm_out(patch_embed))) patch_embed = patch_embed + self.drop_path(self.mlp(self.norm_mlp(patch_embed))) return pixel_embed, patch_embed class PixelEmbed(nn.Module): """ Image to Pixel Embedding """ def __init__(self, img_size=224, patch_size=16, in_chans=3, in_dim=48, stride=4): super().__init__() img_size = to_2tuple(img_size) patch_size = to_2tuple(patch_size) # grid_size property necessary for resizing positional embedding self.grid_size = (img_size[0] // patch_size[0], img_size[1] // patch_size[1]) num_patches = (self.grid_size[0]) * (self.grid_size[1]) self.img_size = img_size self.num_patches = num_patches self.in_dim = in_dim new_patch_size = [math.ceil(ps / stride) for ps in patch_size] self.new_patch_size = new_patch_size self.proj = nn.Conv2d(in_chans, self.in_dim, kernel_size=7, padding=3, stride=stride) self.unfold = nn.Unfold(kernel_size=new_patch_size, stride=new_patch_size) def forward(self, x, pixel_pos): B, C, H, W = x.shape _assert(H == self.img_size[0], f"Input image size ({H}*{W}) doesn't match model ({self.img_size[0]}*{self.img_size[1]}).") _assert(W == self.img_size[1], f"Input image size ({H}*{W}) doesn't match model ({self.img_size[0]}*{self.img_size[1]}).") x = self.proj(x) x = self.unfold(x) x = x.transpose(1, 2).reshape(B * self.num_patches, self.in_dim, self.new_patch_size[0], self.new_patch_size[1]) x = x + pixel_pos x = x.reshape(B * self.num_patches, self.in_dim, -1).transpose(1, 2) return x class TNT(nn.Module): """ Transformer in Transformer - https://arxiv.org/abs/2103.00112 """ def __init__( self, img_size=224, patch_size=16, in_chans=3, num_classes=1000, global_pool='token', embed_dim=768, inner_dim=48, depth=12, num_heads_inner=4, num_heads_outer=12, mlp_ratio=4., qkv_bias=False, drop_rate=0., pos_drop_rate=0., proj_drop_rate=0., attn_drop_rate=0., drop_path_rate=0., norm_layer=nn.LayerNorm, first_stride=4, ): super().__init__() assert global_pool in ('', 'token', 'avg') self.num_classes = num_classes self.global_pool = global_pool self.num_features = self.embed_dim = embed_dim # num_features for consistency with other models self.grad_checkpointing = False self.pixel_embed = PixelEmbed( img_size=img_size, patch_size=patch_size, in_chans=in_chans, in_dim=inner_dim, stride=first_stride, ) num_patches = self.pixel_embed.num_patches self.num_patches = num_patches new_patch_size = self.pixel_embed.new_patch_size num_pixel = new_patch_size[0] * new_patch_size[1] self.norm1_proj = norm_layer(num_pixel * inner_dim) self.proj = nn.Linear(num_pixel * inner_dim, embed_dim) self.norm2_proj = norm_layer(embed_dim) self.cls_token = nn.Parameter(torch.zeros(1, 1, embed_dim)) self.patch_pos = nn.Parameter(torch.zeros(1, num_patches + 1, embed_dim)) self.pixel_pos = nn.Parameter(torch.zeros(1, inner_dim, new_patch_size[0], new_patch_size[1])) self.pos_drop = nn.Dropout(p=pos_drop_rate) dpr = [x.item() for x in torch.linspace(0, drop_path_rate, depth)] # stochastic depth decay rule blocks = [] for i in range(depth): blocks.append(Block( dim=inner_dim, dim_out=embed_dim, num_pixel=num_pixel, num_heads_in=num_heads_inner, num_heads_out=num_heads_outer, mlp_ratio=mlp_ratio, qkv_bias=qkv_bias, proj_drop=proj_drop_rate, attn_drop=attn_drop_rate, drop_path=dpr[i], norm_layer=norm_layer, )) self.blocks = nn.ModuleList(blocks) self.norm = norm_layer(embed_dim) self.head_drop = nn.Dropout(drop_rate) self.head = nn.Linear(embed_dim, num_classes) if num_classes > 0 else nn.Identity() trunc_normal_(self.cls_token, std=.02) trunc_normal_(self.patch_pos, std=.02) trunc_normal_(self.pixel_pos, std=.02) self.apply(self._init_weights) def _init_weights(self, m): if isinstance(m, nn.Linear): trunc_normal_(m.weight, std=.02) if isinstance(m, nn.Linear) and m.bias is not None: nn.init.constant_(m.bias, 0) elif isinstance(m, nn.LayerNorm): nn.init.constant_(m.bias, 0) nn.init.constant_(m.weight, 1.0) @torch.jit.ignore def no_weight_decay(self): return {'patch_pos', 'pixel_pos', 'cls_token'} @torch.jit.ignore def group_matcher(self, coarse=False): matcher = dict( stem=r'^cls_token|patch_pos|pixel_pos|pixel_embed|norm[12]_proj|proj', # stem and embed / pos blocks=[ (r'^blocks\.(\d+)', None), (r'^norm', (99999,)), ] ) return matcher @torch.jit.ignore def set_grad_checkpointing(self, enable=True): self.grad_checkpointing = enable @torch.jit.ignore def get_classifier(self): return self.head def reset_classifier(self, num_classes, global_pool=None): self.num_classes = num_classes if global_pool is not None: assert global_pool in ('', 'token', 'avg') self.head = nn.Linear(self.embed_dim, num_classes) if num_classes > 0 else nn.Identity() def forward_features(self, x): B = x.shape[0] pixel_embed = self.pixel_embed(x, self.pixel_pos) patch_embed = self.norm2_proj(self.proj(self.norm1_proj(pixel_embed.reshape(B, self.num_patches, -1)))) patch_embed = torch.cat((self.cls_token.expand(B, -1, -1), patch_embed), dim=1) patch_embed = patch_embed + self.patch_pos patch_embed = self.pos_drop(patch_embed) if self.grad_checkpointing and not torch.jit.is_scripting(): for blk in self.blocks: pixel_embed, patch_embed = checkpoint(blk, pixel_embed, patch_embed) else: for blk in self.blocks: pixel_embed, patch_embed = blk(pixel_embed, patch_embed) patch_embed = self.norm(patch_embed) return patch_embed def forward_head(self, x, pre_logits: bool = False): if self.global_pool: x = x[:, 1:].mean(dim=1) if self.global_pool == 'avg' else x[:, 0] x = self.head_drop(x) return x if pre_logits else self.head(x) def forward(self, x): x = self.forward_features(x) x = self.forward_head(x) return x def checkpoint_filter_fn(state_dict, model): """ convert patch embedding weight from manual patchify + linear proj to conv""" if state_dict['patch_pos'].shape != model.patch_pos.shape: state_dict['patch_pos'] = resize_pos_embed(state_dict['patch_pos'], model.patch_pos, getattr(model, 'num_tokens', 1), model.pixel_embed.grid_size) return state_dict def _create_tnt(variant, pretrained=False, **kwargs): if kwargs.get('features_only', None): raise RuntimeError('features_only not implemented for Vision Transformer models.') model = build_model_with_cfg( TNT, variant, pretrained, pretrained_filter_fn=checkpoint_filter_fn, **kwargs) return model @register_model def tnt_s_patch16_224(pretrained=False, **kwargs) -> TNT: model_cfg = dict( patch_size=16, embed_dim=384, inner_dim=24, depth=12, num_heads_outer=6, qkv_bias=False) model = _create_tnt('tnt_s_patch16_224', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model @register_model def tnt_b_patch16_224(pretrained=False, **kwargs) -> TNT: model_cfg = dict( patch_size=16, embed_dim=640, inner_dim=40, depth=12, num_heads_outer=10, qkv_bias=False) model = _create_tnt('tnt_b_patch16_224', pretrained=pretrained, **dict(model_cfg, **kwargs)) return model
pytorch-image-models/timm/models/tnt.py/0
{ "file_path": "pytorch-image-models/timm/models/tnt.py", "repo_id": "pytorch-image-models", "token_count": 6715 }
186
""" Adafactor Optimizer Lifted from https://github.com/pytorch/fairseq/blob/master/fairseq/optim/adafactor.py Original header/copyright below. """ # Copyright (c) Facebook, Inc. and its affiliates. # # This source code is licensed under the MIT license found in the # LICENSE file in the root directory of this source tree. import torch import math class Adafactor(torch.optim.Optimizer): """Implements Adafactor algorithm. This implementation is based on: `Adafactor: Adaptive Learning Rates with Sublinear Memory Cost` (see https://arxiv.org/abs/1804.04235) Note that this optimizer internally adjusts the learning rate depending on the *scale_parameter*, *relative_step* and *warmup_init* options. To use a manual (external) learning rate schedule you should set `scale_parameter=False` and `relative_step=False`. Arguments: params (iterable): iterable of parameters to optimize or dicts defining parameter groups lr (float, optional): external learning rate (default: None) eps (tuple[float, float]): regularization constants for square gradient and parameter scale respectively (default: (1e-30, 1e-3)) clip_threshold (float): threshold of root mean square of final gradient update (default: 1.0) decay_rate (float): coefficient used to compute running averages of square gradient (default: -0.8) beta1 (float): coefficient used for computing running averages of gradient (default: None) weight_decay (float, optional): weight decay (L2 penalty) (default: 0) scale_parameter (bool): if True, learning rate is scaled by root mean square of parameter (default: True) warmup_init (bool): time-dependent learning rate computation depends on whether warm-up initialization is being used (default: False) """ def __init__(self, params, lr=None, eps=1e-30, eps_scale=1e-3, clip_threshold=1.0, decay_rate=-0.8, betas=None, weight_decay=0.0, scale_parameter=True, warmup_init=False): relative_step = not lr if warmup_init and not relative_step: raise ValueError('warmup_init requires relative_step=True') beta1 = None if betas is None else betas[0] # make it compat with standard betas arg defaults = dict(lr=lr, eps=eps, eps_scale=eps_scale, clip_threshold=clip_threshold, decay_rate=decay_rate, beta1=beta1, weight_decay=weight_decay, scale_parameter=scale_parameter, relative_step=relative_step, warmup_init=warmup_init) super(Adafactor, self).__init__(params, defaults) @staticmethod def _get_lr(param_group, param_state): if param_group['relative_step']: min_step = 1e-6 * param_state['step'] if param_group['warmup_init'] else 1e-2 lr_t = min(min_step, 1.0 / math.sqrt(param_state['step'])) param_scale = 1.0 if param_group['scale_parameter']: param_scale = max(param_group['eps_scale'], param_state['RMS']) param_group['lr'] = lr_t * param_scale return param_group['lr'] @staticmethod def _get_options(param_group, param_shape): factored = len(param_shape) >= 2 use_first_moment = param_group['beta1'] is not None return factored, use_first_moment @staticmethod def _rms(tensor): return tensor.norm(2) / (tensor.numel() ** 0.5) def _approx_sq_grad(self, exp_avg_sq_row, exp_avg_sq_col): r_factor = (exp_avg_sq_row / exp_avg_sq_row.mean(dim=-1, keepdim=True)).rsqrt_().unsqueeze(-1) c_factor = exp_avg_sq_col.unsqueeze(-2).rsqrt() return torch.mul(r_factor, c_factor) @torch.no_grad() def step(self, closure=None): """Performs a single optimization step. Arguments: closure (callable, optional): A closure that reevaluates the model and returns the loss. """ loss = None if closure is not None: with torch.enable_grad(): loss = closure() for group in self.param_groups: for p in group['params']: if p.grad is None: continue grad = p.grad if grad.dtype in {torch.float16, torch.bfloat16}: grad = grad.float() if grad.is_sparse: raise RuntimeError('Adafactor does not support sparse gradients.') state = self.state[p] factored, use_first_moment = self._get_options(group, grad.shape) # State Initialization if len(state) == 0: state['step'] = 0 if use_first_moment: # Exponential moving average of gradient values state['exp_avg'] = torch.zeros_like(grad) if factored: state['exp_avg_sq_row'] = torch.zeros(grad.shape[:-1]).to(grad) state['exp_avg_sq_col'] = torch.zeros(grad.shape[:-2] + grad.shape[-1:]).to(grad) else: state['exp_avg_sq'] = torch.zeros_like(grad) state['RMS'] = 0 else: if use_first_moment: state['exp_avg'] = state['exp_avg'].to(grad) if factored: state['exp_avg_sq_row'] = state['exp_avg_sq_row'].to(grad) state['exp_avg_sq_col'] = state['exp_avg_sq_col'].to(grad) else: state['exp_avg_sq'] = state['exp_avg_sq'].to(grad) p_fp32 = p if p.dtype in {torch.float16, torch.bfloat16}: p_fp32 = p_fp32.float() state['step'] += 1 state['RMS'] = self._rms(p_fp32) lr_t = self._get_lr(group, state) beta2t = 1.0 - math.pow(state['step'], group['decay_rate']) update = grad ** 2 + group['eps'] if factored: exp_avg_sq_row = state['exp_avg_sq_row'] exp_avg_sq_col = state['exp_avg_sq_col'] exp_avg_sq_row.mul_(beta2t).add_(update.mean(dim=-1), alpha=1.0 - beta2t) exp_avg_sq_col.mul_(beta2t).add_(update.mean(dim=-2), alpha=1.0 - beta2t) # Approximation of exponential moving average of square of gradient update = self._approx_sq_grad(exp_avg_sq_row, exp_avg_sq_col) update.mul_(grad) else: exp_avg_sq = state['exp_avg_sq'] exp_avg_sq.mul_(beta2t).add_(update, alpha=1.0 - beta2t) update = exp_avg_sq.rsqrt().mul_(grad) update.div_((self._rms(update) / group['clip_threshold']).clamp_(min=1.0)) update.mul_(lr_t) if use_first_moment: exp_avg = state['exp_avg'] exp_avg.mul_(group['beta1']).add_(update, alpha=1 - group['beta1']) update = exp_avg if group['weight_decay'] != 0: p_fp32.add_(p_fp32, alpha=-group['weight_decay'] * lr_t) p_fp32.add_(-update) if p.dtype in {torch.float16, torch.bfloat16}: p.copy_(p_fp32) return loss
pytorch-image-models/timm/optim/adafactor.py/0
{ "file_path": "pytorch-image-models/timm/optim/adafactor.py", "repo_id": "pytorch-image-models", "token_count": 3656 }
187
""" SGDP Optimizer Implementation copied from https://github.com/clovaai/AdamP/blob/master/adamp/sgdp.py Paper: `Slowing Down the Weight Norm Increase in Momentum-based Optimizers` - https://arxiv.org/abs/2006.08217 Code: https://github.com/clovaai/AdamP Copyright (c) 2020-present NAVER Corp. MIT license """ import torch import torch.nn.functional as F from torch.optim.optimizer import Optimizer, required import math from .adamp import projection class SGDP(Optimizer): def __init__(self, params, lr=required, momentum=0, dampening=0, weight_decay=0, nesterov=False, eps=1e-8, delta=0.1, wd_ratio=0.1): defaults = dict( lr=lr, momentum=momentum, dampening=dampening, weight_decay=weight_decay, nesterov=nesterov, eps=eps, delta=delta, wd_ratio=wd_ratio) super(SGDP, self).__init__(params, defaults) @torch.no_grad() def step(self, closure=None): loss = None if closure is not None: with torch.enable_grad(): loss = closure() for group in self.param_groups: weight_decay = group['weight_decay'] momentum = group['momentum'] dampening = group['dampening'] nesterov = group['nesterov'] for p in group['params']: if p.grad is None: continue grad = p.grad state = self.state[p] # State initialization if len(state) == 0: state['momentum'] = torch.zeros_like(p) # SGD buf = state['momentum'] buf.mul_(momentum).add_(grad, alpha=1. - dampening) if nesterov: d_p = grad + momentum * buf else: d_p = buf # Projection wd_ratio = 1. if len(p.shape) > 1: d_p, wd_ratio = projection(p, grad, d_p, group['delta'], group['wd_ratio'], group['eps']) # Weight decay if weight_decay != 0: p.mul_(1. - group['lr'] * group['weight_decay'] * wd_ratio / (1-momentum)) # Step p.add_(d_p, alpha=-group['lr']) return loss
pytorch-image-models/timm/optim/sgdp.py/0
{ "file_path": "pytorch-image-models/timm/optim/sgdp.py", "repo_id": "pytorch-image-models", "token_count": 1186 }
188
""" Batch size decay and retry helpers. Copyright 2022 Ross Wightman """ import math def decay_batch_step(batch_size, num_intra_steps=2, no_odd=False): """ power of two batch-size decay with intra steps Decay by stepping between powers of 2: * determine power-of-2 floor of current batch size (base batch size) * divide above value by num_intra_steps to determine step size * floor batch_size to nearest multiple of step_size (from base batch size) Examples: num_steps == 4 --> 64, 56, 48, 40, 32, 28, 24, 20, 16, 14, 12, 10, 8, 7, 6, 5, 4, 3, 2, 1 num_steps (no_odd=True) == 4 --> 64, 56, 48, 40, 32, 28, 24, 20, 16, 14, 12, 10, 8, 6, 4, 2 num_steps == 2 --> 64, 48, 32, 24, 16, 12, 8, 6, 4, 3, 2, 1 num_steps == 1 --> 64, 32, 16, 8, 4, 2, 1 """ if batch_size <= 1: # return 0 for stopping value so easy to use in loop return 0 base_batch_size = int(2 ** (math.log(batch_size - 1) // math.log(2))) step_size = max(base_batch_size // num_intra_steps, 1) batch_size = base_batch_size + ((batch_size - base_batch_size - 1) // step_size) * step_size if no_odd and batch_size % 2: batch_size -= 1 return batch_size def check_batch_size_retry(error_str): """ check failure error string for conditions where batch decay retry should not be attempted """ error_str = error_str.lower() if 'required rank' in error_str: # Errors involving phrase 'required rank' typically happen when a conv is used that's # not compatible with channels_last memory format. return False if 'illegal' in error_str: # 'Illegal memory access' errors in CUDA typically leave process in unusable state return False return True
pytorch-image-models/timm/utils/decay_batch.py/0
{ "file_path": "pytorch-image-models/timm/utils/decay_batch.py", "repo_id": "pytorch-image-models", "token_count": 656 }
189
[package] name = "text-generation-benchmark" description = "Text Generation Benchmarking tool" version.workspace = true edition.workspace = true authors.workspace = true homepage.workspace = true [lib] path = "src/lib.rs" [[bin]] name = "text-generation-benchmark" path = "src/main.rs" [dependencies] average = "0.14" clap = { version = "4.4.5", features = ["derive", "env"] } crossterm = "0.27" float-ord = "0.3.2" serde = {version = "1.0.188", features = ["derive"]} serde_json = "1.0" tabled = "0.14.0" text-generation-client = { path = "../router/client" } thiserror = "1.0.48" tokenizers = { version = "0.14.0", features = ["http"] } tokio = { version = "1.32.0", features = ["rt", "rt-multi-thread", "parking_lot", "signal", "sync", "macros"] } tui = {package = "ratatui", version = "0.23", default-features = false, features = ["crossterm"]} tracing = "0.1.37" tracing-subscriber = { version = "0.3.17", features = ["json", "env-filter"] } hf-hub = "0.3.1"
text-generation-inference/benchmark/Cargo.toml/0
{ "file_path": "text-generation-inference/benchmark/Cargo.toml", "repo_id": "text-generation-inference", "token_count": 381 }
190
from text_generation.errors import ( parse_error, GenerationError, IncompleteGenerationError, OverloadedError, ValidationError, BadRequestError, ShardNotReadyError, ShardTimeoutError, NotFoundError, RateLimitExceededError, UnknownError, ) def test_generation_error(): payload = {"error_type": "generation", "error": "test"} assert isinstance(parse_error(400, payload), GenerationError) def test_incomplete_generation_error(): payload = {"error_type": "incomplete_generation", "error": "test"} assert isinstance(parse_error(400, payload), IncompleteGenerationError) def test_overloaded_error(): payload = {"error_type": "overloaded", "error": "test"} assert isinstance(parse_error(400, payload), OverloadedError) def test_validation_error(): payload = {"error_type": "validation", "error": "test"} assert isinstance(parse_error(400, payload), ValidationError) def test_bad_request_error(): payload = {"error": "test"} assert isinstance(parse_error(400, payload), BadRequestError) def test_shard_not_ready_error(): payload = {"error": "test"} assert isinstance(parse_error(403, payload), ShardNotReadyError) assert isinstance(parse_error(424, payload), ShardNotReadyError) def test_shard_timeout_error(): payload = {"error": "test"} assert isinstance(parse_error(504, payload), ShardTimeoutError) def test_not_found_error(): payload = {"error": "test"} assert isinstance(parse_error(404, payload), NotFoundError) def test_rate_limit_exceeded_error(): payload = {"error": "test"} assert isinstance(parse_error(429, payload), RateLimitExceededError) def test_unknown_error(): payload = {"error": "test"} assert isinstance(parse_error(500, payload), UnknownError)
text-generation-inference/clients/python/tests/test_errors.py/0
{ "file_path": "text-generation-inference/clients/python/tests/test_errors.py", "repo_id": "text-generation-inference", "token_count": 598 }
191
# Using TGI CLI You can use TGI command-line interface (CLI) to download weights, serve and quantize models, or get information on serving parameters. To install the CLI, please refer to [the installation section](../installation#install-cli). `text-generation-server` lets you download the model with `download-weights` command like below ๐Ÿ‘‡ ```bash text-generation-server download-weights MODEL_HUB_ID ``` You can also use it to quantize models like below ๐Ÿ‘‡ ```bash text-generation-server quantize MODEL_HUB_ID OUTPUT_DIR ``` You can use `text-generation-launcher` to serve models. ```bash text-generation-launcher --model-id MODEL_HUB_ID --port 8080 ``` There are many options and parameters you can pass to `text-generation-launcher`. The documentation for CLI is kept minimal and intended to rely on self-generating documentation, which can be found by running ```bash text-generation-launcher --help ``` You can also find it hosted in this [Swagger UI](https://huggingface.github.io/text-generation-inference/). Same documentation can be found for `text-generation-server`. ```bash text-generation-server --help ```
text-generation-inference/docs/source/basic_tutorials/using_cli.md/0
{ "file_path": "text-generation-inference/docs/source/basic_tutorials/using_cli.md", "repo_id": "text-generation-inference", "token_count": 329 }
192